The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
87
|
structure length |
87
|
Chain Sequence |
SPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transcription
|
| molecule keywords |
CREB-BINDING PROTEIN
|
| publication title |
Solution structure of the TAZ2 (CH3) domain of the transcriptional adaptor protein CBP.
pubmed doi rcsb |
| source organism |
Mus musculus
|
| total genus |
35
|
| structure length |
87
|
| sequence length |
87
|
| ec nomenclature |
ec
2.3.1.48: Histone acetyltransferase. |
| pdb deposition date | 2000-06-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02135 | zf-TAZ | TAZ zinc finger |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | CREB-binding Protein; Chain A | TAZ domain |
#chains in the Genus database with same CATH superfamily 2K8F A; 2KA6 A; 5HP0 A; 1F81 A; 1P4Q B; 2MZD A; 1U2N A; 1R8U B; 3T92 A; 1L3E B; 3IO2 A; 2KJE A; 3P57 P; 2MH0 B; 1L8C A; 2LWW A; 2KA4 A; #chains in the Genus database with same CATH topology 2K8F A; 2KA6 A; 5HP0 A; 1F81 A; 1P4Q B; 2MZD A; 1U2N A; 1R8U B; 3T92 A; 1L3E B; 3IO2 A; 2KJE A; 3P57 P; 2MH0 B; 1L8C A; 2LWW A; 2KA4 A; #chains in the Genus database with same CATH homology 2K8F A; 2KA6 A; 5HP0 A; 1F81 A; 1P4Q B; 2MZD A; 1U2N A; 1R8U B; 3T92 A; 1L3E B; 3IO2 A; 2KJE A; 3P57 P; 2MH0 B; 1L8C A; 2LWW A; 2KA4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
