1FCLA

Delta1.5: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TTFKLIINGKTLKGETTTEAVDAATAEKVLKQYINDNGIDGEWTYDDATKTWTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fclA00
1F2RC 1YNTE 4OZCA 2QMTA 4KGSA 1HZ6A 2KWDA 2KDMA 2N9LA 4KGRA 4KGTA 1PGAA 1IBXB 2KACA 2RMMA 2GB1A 2ON8A 2GI9A 2J52A 1UWXA 2KN4A 1MPEA 1EM7A 4IOIE 1JMLA 1MHXA 2JU6X 1F2RI 3FILB 4IKGA 2RPVA 4GLSC 1IGDA 1C9FA 1PGBA 5HHDG 1P7FA 2JWUA 1HZ5A 1K50A 1KH0A 2ZW1A 2I2YA 1Q10A 4D2KA 2PTLA 4HJGE 5BMHA 3UI3A 5HFYA 1FD6A 2LHDA 5BMGA 2ONQA 2QSDA 1IBXA 2IGGA 2N7JA 1MI0A 2PLPA 2I38A 1K53A 2J53A 2LGIA 3V3XA 5HG2A 2OEDA 2PW9A 2ZW0A 1YMHE 1K51A 2IGDA 3FILA 2LUMA 5BMIA 1IGCA 1QKZA 4WH4A 1XF5L 4OZAA 2N9KA 1P7EA 4OZBA 2KQ4X 1GB4A 2K0PA 2JZPA 1FCLA 2JSVX 4HKZE 1FCCC 5HI1A 1D4BA 1ZXHA 2IGHA 1K52A 1GB1A 1HEZE 4MACA 1MVKA 2NMQA 2JXTA 1XCQL 3GB1A 1PGXA 5JXVA 1XCTL 1MHHE 2EELA 2LHEA 3MP9A
chains in the Genus database with same CATH superfamily
3UQAA 3NS8A 4LCDE 3ZW3A 3U2SC 2KAJA 4N59A 1HTOA 2WHIA 2LUEA 1ET9A 1R4NB 2N9LA 2PMVA 4JE3B 2NR2A 1YN5A 1T6BX 1WX7A 4E3CA 1EWYC 2MBHA 1T0YA 3QQ8B 1Q1OA 3AU5A 1J8CA 3SEBA 2K5PA 3VR9B 2MA9B 4RGMA 5C1ZA 4ZHOA 5IP4D 1RFKA 3C8YA 2JT4B 2WXGA 4ZYNA 1T3QA 5D2MB 1VD2A 2KK8A 2ZPYA 1QILA 3QK0A 2ZVNA 3KH0A 2WDQB 1I4XA 1J19A 1WM2A 3P4SB 3N20C 4KSKC 3DBLB 3EFUA 3DHGC 1EO6A 4N9F4 2KWUB 1I7HA 3TEYA 1ZP0B 1KLGD 4K3BA 4CYEA 3TEXA 3C19A 4HWIB 4WWOA 1Y56A 1Y8RC 5JHBA 5EE1A 3VRAB 2RR9A 2Y5PA 1P7EA 1SE4A 1Z2MA 4HCPB 1TBEA 1YOVB 4FJVB 3ETRA 2K0PA 3WAOA 3UINB 1TS4A 4JQWC 2LJIA 3T9LA 2JXXA 4LNIA 4GDKB 4USAA 4WAAA 2KNBA 5EE9A 2B76B 4MJSB 3AEEB 4UDUC 2JUOA 2LVOA 1UUPA 2LXCA 3IT6B 2KMCA 4KSLC 3M62B 4IWOA 2MJDA 2KN5A 1KTKA 2KDMA 5CX3A 3AV8A 1PGAA 5C3JB 3RI7C 1WGYA 2H88B 2KANA 4NPNA 4W9IA 3WALA 2Z0DB 3NUHB 1XLPA 5CHFA 3AE8B 2GI9A 2BS2B 4IOIE 4RFBA 3NVYA 3WAMA 2KVZA 2FBWB 1WYWB 2Y3AA 2WNMA 1QOBA 4YXDB 3RFZB 2M17A 4HLEA 4A20A 1R4MI 1HQRD 2HTHA 4OVZA 4HJGE 3PSEB 5HFYA 3AE9B 1N61A 5D3DA 2I38A 4KZ0A 1CJEA 2J53A 2NBUA 2DHZA 3V3XA 3QCAA 2IO1B 4CO7A 3ABVB 2XK5B 1AYFA 4FN2A 4F7ZA 5BMIA 1VZ7A 1VR9A 2V4IB 2D10A 4EKUA 2LGSA 5AEKB 3AE5B 2N7EA 1XO3A 1BUIC 1HXYD 2BW2A 3ONSA 5HI1A 3DVNU 2IGHA 2AL3A 4RCOA 1QLBB 2KLGA 3PHXB 1WXQA 2OJRA 3M95A 2KX0A 1JRPA 2RD0A 4DHZE 1F0ZA 4OZCA 2QMTA 2PJHA 2LGYA 4DWFA 1EUVB 2L83A 2UWQA 4JL9A 4L23A 3RULA 3HIZA 4HRSA 2V4LA 2KFJA 3U4EG 3JW0X 1P1AA 3I5JC 2K22A 1WM3A 2KN4A 4KV2A 1SGHA 2XN9C 1WJ6A 4RF0A 2NVUI 3RZWC 4IUMB 4BVUC 5LLIA 4PT5A 1I35A 3AEFB 1WR6E 3IAS1 1YX6B 3ML9A 2KVRA 3DQVA 1ZE3D 3TCAA 2V3SA 1V1PA 3VTUA 3ZNGC 1LM8B 2DZIA 2X8XX 4WJPA 3VH4B 3RZFA 4FHKA 2INNE 1L0XB 2KC2A 4ZRQA 1WX8A 4AS1A 4HDOA 2LASA 4A55A 3FILA 5CHVC 4LNNA 4LNFA 2WU2B 5TSSA 2IO2B 2N9EB 1F1HA 1V5TA 1WRDB 3KYDD 2KX3A 1TTNA 5L95C 3MC9A 2AX5A 2BYVE 4XDCA 1GPXA 3DWGC 4P16A 4YTPB 1JALA 3MC0B 1L5PA 3L08A 2Z8LA 1QQRA 1XCQL 2R2QA 3ZJVA 1PGXA 3ZJUA 3VUYA 4B0EA 3BY4B 5FR6A 1V8CA 4O1NA 1N60A 4MGKE 3IVFA 2A4ZA 2L0TA 2HTME 4ANXA 3QWZB 1TT5B 3I3TB 3H8HA 3VXWA 1YIWA 4KGRA 3KQ4A 2JZZA 1C4AA 1E7UA 2INPE 1OFFA 1G6JA 4I6LB 2K3UA 2WX1A 4FJYA 4MEMA 4MSMB 4M8NA 4NQKE 1PFDA 3RNBC 2WXKA 2KJ6A 1XLQA 2NTSA 2MWSB 2MP2A 4GLSC 4NAWA 5GXGB 3M3JA 5J18A 5DCNA 4WWPA 2HE7A 4MDKE 2I1KA 1YJIA 2RDGA 4C80A 1JWSD 3DBRI 3DVNV 5E6JA 3BYYB 3DHHC 1C4PA 2G45B 1OQYA 4IWQA 3ZYYX 1BT0A 1RM6C 4MH0E 3RT3B 1K53A 2LGIA 3VUWA 4HROA 3HVDA 5C23A 1WYGA 2AYOB 3AEAB 4OHJA 1ZDVA 2MBOA 1FNWA 3Q8EA 3KVFB 2AEHA 1OQQA 1WRIA 2L76A 2WXPA 4GOCA 3MC8A 2DENB 3VUXA 4EEWA 4K7UA 4KZCA 2SEBD 1GNUA 1KFYB 3QA8A 3VRBB 2G4DB 3QARA 3LYYA 2CHWA 3V61A 2MX2A 5J17A 2ZJDA 4PYUA 1SE2A 2EELA 3GE8C 2VZKB 2L05A 2LHEA 2JY6A 2NPTB 4JX1C 3L4PA 4II2B 2K8CA 4XX5A 1HZ6A 4DHJB 2UU7A 3BINA 2L0FA 4WIPA 4OVUA 3OJ3A 3NVZA 5D6JB 2DAFA 1K8RB 2K6DB 5D3IB 2L32A 1SE9A 1EF1A 1RLFA 2LFIA 3PS6A 1SBBB 2MHJA 1CMXB 4LNOA 1D5XC 2KQ7A 4LK0M 3NS1A 4JLCA 5IAAC 3VAWA 3ML8A 2D3BA 4URKA 1WE7A 5HHDG 1AARA 2M1MA 3HHMA 3RNEC 4GU2A 4PS8A 4M0WB 1L6VA 3KWLA 4WQMA 3UIOB 4LJPB 1OGWA 1NDDA 1FD6A 1YQBA 4MM3B 1L0VB 4BKSA 4L1BA 2BQQA 1KF6B 3APDA 1TGZB 4ASWC 5JHAA 4B0MA 1C79A 3B2GA 2WDTB 5E6PA 3MJWA 3ZIMA 1EWCA 4G50A 4KIKB 3DVGX 5IKCM 4M8MA 4AQ7A 4LNKA 4OZAA 4TQ1A 1STEA 2N9PC 1NI3A 2BKRB 1C1YB 2L7RA 2QEJC 5AUKA 2K39A 1J7BA 1D4BA 4WJOA 2CU3A 1VZ6A 1NENB 3U7ZA 3E56A 4IDIA 3GOEA 4WJNA 3MFGA 3QX1A 2WXNA 2VZKD 2HDEA 2H89B 2M0AA 2G9HD 4ARCA 2INDC 1WX9A 4JWSC 4RM8A 5EDSA 2L00B 4DHJD 2J42A 3FKYA 4US8A 2LGDA 3NZUA 3QJZA 3I63C 1XD3B 3EHVA 4S0RA 4ZYSA 1IUEA 3EC8A 3NZ3A 5AZGA 4GB9A 2QIEB 4W9DA 3V6CB 3SU8X 1UZXB 3Q8BA 3ZGZA 2IJ0A 4M02A 1JMLA 2KLCA 1NI2A 1ZGUB 1H8CA 3JVZX 2E6XA 2K6QA 2K8BA 3A9JA 5IA7A 2JWUA 2BT6A 4YWGG 1WE6A 1HZ5A 2PTLA 4C4VA 5KHOA 3K9PB 1WGDA 4W9FA 2FCQA 2AL6A 5BMHA 3N1YC 1E8XA 2JPHA 1N5XA 3ZNZB 5JZEB 1QOAA 2WXRA 2ONQA 2QDFA 2LZ6A 3MHSD 1ISNA 4TUUA 4PS3A 2WDVB 3JSVA 3R7QA 2MJ3A 3L17A 3W9CB 1SIFA 1K51A 3UF8A 3MJ5A 1AW7A 4XE0A 3A1QA 2FIFA 3SHQA 3TL5A 4WH4A 1QOGA 2C60A 4A8XC 4KX6B 2WS3B 3VQIA 2EKEC 4P1CC 1GC7A 3ECIA 1WXVA 1OQRA 3H1UA 3URYA 1NYQA 3DBLI 2PVGC 4AWJA 2V3NA 4BBNC 4TSSA 2K1FA 2DYMA 3ZNHB 4FXCA 2KC1A 2V9HA 3MHZA 1WF9A 2V1YA 1SJHD 3PTFC 1V5OA 2BVCA 1I4HA 4ZHPA 2XEWA 3AH7A 1F2RC 3CMMB 2AQ3B 4GMVA 3CIRB 2ASQA 1OTRB 2WX0A 2IY0B 1RYJA 1V1OA 2ZEQA 2RGFA 2G3QB 4TMAB 2KACA 2YLMA 2MJEA 4FADA 1RFAA 4DDID 1ZKHA 3MTNB 1EM7A 3PREA 4XYCA 2J4XA 3AE6B 2O2VA 3AE4B 2RPVA 3PRPB 1QOFA 3KUDB 1K50A 3TBLD 2M19A 1JROA 4M00A 4TQ0A 2GMIC 3CSFA 4BOSC 4J6IA 1WGHA 3H7PA 5FR3A 3I57A 2KFKB 1J7CA 3AECB 1IBXA 2E3TA 2BWFA 2XNAC 1C3TA 5JH5C 3BYTB 3RNCC 2RPQA 2ZW0A 1YMHE 4E71A 3K9OB 1WY8A 3CSTA 4PK1A 4JWUC 2V3PA 4DDGD 4S17A 1WMHB 5E6NA 5BYRA 1TYGB 2AQ1B 3T3NA 3KYCD 3Q3MC 3JYUA 4HK2A 3PO0A 1QT9A 2KXJA 2MBBB 4NZLB 4B95A 2NMQA 1HA5A 5CTRC 2DZMA 2N9XA 1I4GA 4H2AA 2BWES 2KKCA 4ANUA 4GDLA 4ZRIA 1SEBD 2KQSA 3C0RB 1ENFA 4IC7B 4F1SA 2BGFA 2CS4A 1WSPA 1KOTA 4N6EB 1GUAB 1UNSA 2KTRA 5G5HA 1A5RA 3DBHB 3ZRCA 1TKYA 4US9A 1XEEA 1Z5SB 1ESFA 3LJ3A 3P1MA 2EMTA 2DWQA 1TZ1A 1C78A 1P7FA 3AE3B 2WXHA 1SJED 1JWUD 5DPTA 1TS2A 2MH7A 4D2KA 1LQBA 1RRBA 4ITKA 4HVBA 3PRZA 5BMGA 1V2YA 4XC2A 1CK1A 1JWAD 4K1RB 2Y5CA 3TMPB 1TKEA 2O6VB 1B1ZA 4X57B 2LUMA 4GN1A 3VTVA 1A70A 2WXMA 2LWPA 3A9KA 3PZDA 1GB4A 1ACCA 3NZSA 2KDIA 1WJUA 1V81A 4NJ6A 3E9SA 3GE3C 2MSED 2D3GA 1Q0WB 3BIID 5HKHA 4W9EA 2FAZA 3WCQA 5AZHA 3GB1A 1L7YA 2PPHA 5CHWA 2RSUA 3VTWA 1MG4A 3VDZA 2HJ1A 3EGRA 4W9KA 3HRDD 3AB5A 1UBQA 1V9JA 3ZXRA 1FNVA 1L0YB 2GBRA 1QZEA 2LI5A 3VFKA 3QAQA 4G3XB 1XLOA 2IDYA 1WXAA 2PKOA 3L13A 4W9HA 2L3ZA 2VH2A 4C00A 3N9YC 4WURA 2BYTA 2NBWB 4WWMA 1E8ZA 3RPFC 2ZCBA 4IW0A 4ICVA 1MPEA 2BYEA 2MBQA 2CJNA 2M56B 1V49A 2MLBA 4RH6A 4DQOC 1JW9D 2BPSA 4C7YA 4BAXA 2W55A 2D5GA 5D7GA 2BBCA 3UI3A 4BKGA 3RN9C 1F77A 1LGRA 4CHKA 3H6NA 2GBKA 2O6VD 1EF5A 1SXTA 4EOYA 2BS4B 1JCKB 3P42A 3ZO5B 2J0MA 1GC6A 3ZUNA 2N9KA 3BVGA 4OZBA 1S1QB 1ET6A 3R2TA 1BMLC 2ZCCA 2CKHB 1MJDA 4JPSA 3N1ZC 5KHQA 4FULA 3IXSA 1FCLA 4DHZB 3IBEA 3NOBA 2JYEA 1K52A 3CF6E 4KVGB 3GP7A 2PE6B 1ZXIA 3SDLC 2W3RA 3H7SA 1AWDA 2WXIA 2WLBA 4PS7A 3AE7B 3TIXA 2IPKD 4K7SA 2CJOA 3M63B 3Q14C 1FPYA 2MCNB 1ZUD2 1WGGA 2N1VA 4KGTA 3DOWA 2LRWA 5DPSA 3TUOA 3ZXVA 2FIDA 1PQSA 3AU4A 2GBJA 1UGJA 1I4PA 4GDKA 2PIAA 2DYBA 5LXIB 2R2OA 1WR1A 4MJSA 4N58A 1JRUA 2OJWA 3B08A 2IO0B 4MSQB 4WWNA 1L4ZB 2QCZA 1IP9A 2DLBA 2JRHA 2LGXA 3V62A 3PT2B 3LB8C 4A3PA 2JWZA 2SAKA 3VHTC 2PLPA 4B6WA 4XDDA 2BTEA 1DOIA 1WXMA 1KLVA 4NJCA 2PW9A 2IO3B 1ROEA 1NVID 1L4DB 2JQRB 4A9AA 3AULA 1P3QU 1QKZA 3N30A 2QJLA 1FMAD 1OEYA 3U7DA 2KQ4X 3V05A 1L2NA 3VH3B 2Y5BB 3J9CA 1E7PB 4KKJA 1D5ZC 1WWTA 2KD0A 2KHWB 1TS5A 3SR6A 2WXJA 1EU3A 1FEHA 2JXTA 2BB5A 4EZJA 1VLBA 4DBGA 1FXTB 2LXAA 3W1YA 1XCTL 2G1EA 1VJKA 4NAMA 2C5LC 1Q5WB 3Q8CA 3NJTA 2RDBC 2KOXA 2XK5A 2KWDA 1FXIA 3DDCB 2LEKA 3V60A 2NS5A 1V1PB 1N62A 3P63A 4AOFA 2PVOD 2I1JA 4L2YA 2K8HA 4HPMB 4XWWA 2W82A 2ON8A 3RNFC 3EECA 1JWBD 1MHXA 5C2TB 3FILB 4HEA1 2DZJA 3AEGB 4G11A 3GZNB 3L54A 2WXFA 3AE2B 4TKNA 4A6QA 2Q5WD 1WGRA 2ZW1A 2NCNA 3ZJTA 3PRMB 1R7SA 1UBIA 4REZA 3GS2A 2D3CA 3B0AA 1HTQA 2FCSA 2WXQA 5G5GA 2FNJB 1DOYA 1R4NI 2NBVB 2KJHB 1UELA 1FRRA 3KUZA 3P2BA 2OEDA 3ZVVA 1YX5B 3SD5A 4M01A 3IFWB 2BB6A 3KUCB 2N1WA 2JZ3B 4ZRKA 1V97A 2MBEA 4DXAB 3A33B 1E6EB 1PDXA 1X1MA 3UIPB 4NJ7A 2ZPNA 2BYFA 3PGEA 2A5UA 4P7IA 4EZKA 3DPDA 2OOBB 4HXDA 3HUIA 4E74A 2MP2B 1BXTA 3NHEB 4NAWB 4CQNA 1WZ3A 2KJRA 1YJJA 3HK0A 2KDEB 5L83A 3AN1A 2FUG1 4JIOU 1FIQA 3U30A 1ZOYB 4NQLB 1UWMA 4TV3A 1FXAA 1YQ3B 1U4AA 3IAM1 1MG8A 2WWZA 3APFA 4J3OD 4LLGM 2J52A 2WDRB 4ANVA 3O65B 3DHIC 4YSXB 3ZDTA 3ZQ4A 4DXGA 2GLSA 1WIAA 4C7ZA 4IKGA 3ZNID 3PZ7A 2DX5B 4EE2A 1FRDA 3Q69A 3ZLZA 2KYWA 5TR5A 2HD5B 1M94A 3P4RB 4BBNF 1OEYJ 2I2YA 4ACFA 3AEDB 2DAJA 3AM9A 1E8WA 3T8MA 3W1SA 4DK5A 1T0SC 1SB3C 2C7HA 2IGGA 3W5VB 1MI0A 4II3B 3SFEB 3T3OA 3RNAC 1F9JA 5HG2A 4FA6A 3BVZA 1L6UA 4IM0A 4HJKA 3WIMA 4ANWA 2IY1B 4ZDVA 2CU1A 3EFCA 2KDBA 1TS3A 3BK1A 1TY2A 4W9CA 4HCNB 3EUB2 3OAWA 4YTNB 1KJTA 2JSVX 2KWVB 2YEPF 4RGTA 1E10A 1PUTA 2IBIB 2CHXA 3H9DA 3HM3A 1E0ZA 3R3MA 4LTUA 4MACA 1J7AA 3L0WB 4YTMB 4IG7B 4KDLB 4AJYB 1UGMA 1C76A 2KZRA 1XLNA 2ZNVB 1J0GA 2OHFA 4GIVA 3LDZE 3MP9A 1H4RA 3QIJA 1TKGA 4RF1A 2N4FA 1WH3A 1FO4A 2C7MB 5GMVA 5IN7A 2J7QB 2ZVOA 3BWUD 3AEBB 2J0KA 1S3SG 2EKIA 2WXLA 4OW0A 3PV1A 4HKQA 3DCGA 1R4MB 1LO5D 4NNJB 3BVMA 4HPPA 5BYSA 4JGHB 1P0RA 2JU6X 2L8JA 2TSSA 4W9JA 3AXCA 2NPTA 2D11A 4B9KA 4YT0B 3DBHI 2KT7A 4YL8A 4DXFA 1UF0A 1SF0A 3HVZA 2KMMA 4QAYA 3X0WA 5LXHA 3WAPA 2QSDA 1ZPSA 4BOZB 5BYQA 4I6PA 1C77A 2BS3B 2N7JA 4FLHA 2CR5A 2W54A 1I42A 4ARIA 2VRRB 3ALBA 1RAXA 2MQJA 2JYTA 2JRIB 1IGCA 1YN4A 3FAHA 3S2AA 5EE3A 1SE3A 1XF5L 5AUIA 3OJ4B 1TIFA 1E8YA 4XWTA 5G55A 2QILA 2M0XA 4K3CA 1JQ4A 2K9XA 2Z59B 2JZPA 1FNUA 4M0WA 1B9RA 2JF5A 1CQVA 3UGBB 2J0JA 3QC8B 1WFYA 1IPGA 4MM3A 5T8IA 1LFDA 1HE8A 1WGKA 2AQ2B 3R8BA 3IT4B 3NVWA 1SSNA 1T0QC 3A9JB 3O13A 5MPOA 4KIKA 1PYWD 4C4VB 2LMCA 3LXFA 3N1XC 4BKSD 3PVLA 4XGAB 4MELA 4IM3A 3TEWA 4WQOB 4YSYB 2W3SA 2ZNVC 3Q3JA 4FHJA 2M4NA 3JSVB 4IWPA 3RUIB 2N7DA 2C9WB 3RD2A 4IM2A 3A1QB 1V80A 4GGQA 3I9V1 3U52E 2LVPA 1IGDA 2QHOA 2PEAA 2RDHA 1C9FA 1PGBA 5AZFA 1SIJA 4XZ4A 2REXA 3PLUA 2LRUA 1DYQA 3R66C 1FFUA 3X23A 2QC8A 3Q3NC 1CZPA 1M4VA 3WANA 2DZKA 4K7WA 4KKIA 1RWSA 3NY5A 4KDIC 1D6EC 4P1BC 1FM0D 2IYDB 1YQ4B 2KDFB 3U8ZA 5J2RA 2EMSA 3B1LX 4MT5A 2NTTA 3OWEB 1WJ4A 1VDVA 2LVQA 2M8SA 1T0RC 3R2IA 2ICIA 4F8CB 1TY0A 1JWMD 1GAQB 1E5WA 1WJNA 4K81A 5H8YE 5I4DA 3UQBA 5G2NA 2Z0EB 2KTFA 3EA6A 2R61A 2O2VB 3A4RA 1TZOA 4RM9A 2ZZPB 5EE0A 3RCZA 2AWTA 1YNTE 2KMAA 1P9DU 4NY0A 2B3AA 2YVCA 4WJQA 2MEKA 2KO3A 4KGSA 1ZW7A 2WP9B 3IG3A 4BZAA 3D32A 4FJZA 4HPLB 4Q2JA 3TJPA 3Q3OC 5D94A 4PYZA 3H7PB 2VH1A 5E6OA 2DNFA 1IBXB 3W5UB 1FFVA 1VRAB 2XBBC 4EFOA 2LD9A 1GOZA 3P4QB 4LDTB 1UWXA 2V0GA 3NRZA 3DBRB 2HJ8A 5IO9A 3AMZA 2IZVB 3NVVA 1N6ZA 3L10B 2GBMA 2W9NA 3DBSA 2WQYB 1YN3A 4GXBA 3Q6BA 4EZLA 3ZRFA 2CHZA 3N32A 5FKAC 2INCC 4C56C 1VCBA 2UYZB 1EU4A 4MGIE 1KH0A 2D2QA 3BZDB 5DPWA 2K25A 3VVWB 1I4QA 2LHDA 3WA0A 2ACZB 3NG0A 4W9LA 4R3DA 3W2DA 4EUTA 4GDLB 4YSZB 1YD8U 5H92C 4RGNA 1N63A 2WXOA 1V6EA 3ZTDA 1IYFA 3PLVA 4ZRJA 4A90A 5DPRA 2WGSA 1LXDA 2DYOA 2KWCA 3RYTA 4ICUA 2KTRB 3B9JA 3PZ8A 1FCCC 1UD7A 4BKTA 2JX5A 3Q2AC 1NEKB 3V6EB 4HDQA 4I6NB 1D5MC 4G0NB 3AI5A 2BKFA 2PE9A 2KFKA 3DVGY 3SFDB 1N5WA 1WXSA 2LJ5A 1UH6A 4BFRA 1F52A 3TEZA 3APCA 3TSSA 4AUQC 2N0SB 1WZ0A 1GG3A 3OLMD 3W1SC 3ENEA 2GRIA 3Q8AA 4P6VF 2JVCA 3IHPC 1NBFC 1E7VA 1WMHA 2FE8A 3PPAA 1P98A 3OG5A 3Q3FA 4MGYE 2C7NB 5BO4B 2RMMA 3CWIA 1ZDXA 2GB1A 4LDTD 1KLUD 1TJEA 4AP4C 2L52A 2D07B 1GJZA 1QF6A 4MH8A 3L16A 1F2RI 1XXGA 3A4SC 4OVVA 4FBJB 3KW5B 3A9KB 2FUHB 2L1AA 3QHTA 3B2FA 2G4SA 2GOWA 2WYQA 1AN8A 4GSWA 3RMKC 1I4RA 1VZ8A 3VR8B 1Q10A 3KLSX 3ZKJC 4WAFA 1D3ZA 1T5XD 1DOXA 2YEPB 2FCMA 5LNK1 1KRHA 3RNGC 3GZNI 1KM7A 5IOIA 1E90A 1E9MA 2WU5B 1XT9B 3ZDMC 3P4PB 4RMAA 4W9GA 4ZOHC 3Q8FA 1XQQA 2IGDA 5FK9C 3ZTCA 1WI0A 1DGJA 2D3AA 4MGZE 4ZRPA 3FC4A 3PHWB 4AJWA 4RGOS 4A3OA 1YJ1A 4LJOB 3KWVA 4HKZE 2GBNA 1ZXHA 2X38A 2MRPA 1GB1A 1HEZE 1MVKA 1MFWA 2BF8B 3AE1B 3HM6X 1C4CA 4RNAA 3N3KB 2DBYA 3DWMA 5JXVA 2MW5A 1NYRA 1MHHE 3BK2A 2FCNA 1V86A 2O6VA 3R7RA
chains in the Genus database with same CATH topology
1FNVA 1L0YB 3L4PA 1TKGA 4RF1A 1HZ6A 3U2SC 2KAJA 4N59A 1FO4A 1ET9A 1XLOA 2PMVA 2N9LA 4WIPA 2IDYA 2PKOA 4JE3B 3NVZA 1YN5A 3BWUD 1T6BX 3AEBB 2EKIA 2WXLA 3N9YC 4OW0A 4WURA 5D3IB 2BYTA 4HKQA 2L32A 4WWMA 2LFIA 1SBBB 1LO5D 3RPFC 1EWYC 1D5XC 3BVMA 5BYSA 1MPEA 4LK0M 2CJNA 2JU6X 3NS1A 3SEBA 2TSSA 2M56B 2K5PA 3VR9B 4RH6A 4DQOC 4RGMA 1JW9D 4ZHOA 4C7YA 5HHDG 4YT0B 1RFKA 2W55A 2D5GA 3C8YA 1L6VA 2WXGA 3KWLA 4WQMA 5D7GA 2BBCA 4DXFA 1T3QA 1SF0A 1QILA 3HVZA 3UI3A 2KMMA 2WDQB 4MM3B 1I4XA 1FD6A 1L0VB 4L1BA 2QSDA 1KF6B 1ZPSA 5BYQA 1C77A 1F77A 2BS3B 3P4SB 2N7JA 2W54A 4B0MA 1C79A 4ARIA 1I7HA 1SXTA 3B2GA 1ZP0B 3TEYA 1KLGD 2BS4B 3TEXA 1JCKB 2JYTA 1EWCA 3P42A 1IGCA 1YN4A 3FAHA 1Y56A 5EE3A 1SE3A 5EE1A 3VRAB 1XF5L 2Y5PA 4OZAA 4TQ1A 1STEA 2N9KA 1P7EA 3BVGA 1SE4A 5AUIA 1NI3A 4OZBA 1ET6A 3R2TA 1BMLC 3ETRA 4XWTA 2QILA 1JQ4A 2K0PA 2K9XA 2QEJC 4JPSA 2JZPA 1FNUA 3IXSA 1FCLA 4M0WA 1B9RA 5AUKA 1CQVA 1TS4A 1J7BA 1D4BA 2CU3A 2LJIA 2JYEA 1K52A 1VZ6A 1NENB 3U7ZA 3E56A 4IDIA 5T8IA 3GP7A 4GDKB 1WGKA 4USAA 3MFGA 1ZXIA 2AQ2B 2WXNA 2VZKD 3IT4B 3R8BA 2HDEA 3NVWA 2W3RA 2H89B 1SSNA 1AWDA 2M0AA 2WXIA 2G9HD 2WLBA 4ARCA 3O13A 5EE9A 2B76B 4JWSC 3AEEB 4UDUC 1UUPA 3AE7B 3IT6B 2J42A 5MPOA 2IPKD 4US8A 2CJOA 2MJDA 1PYWD 1ZUD2 2LMCA 3LXFA 1KTKA 2KDMA 4KGTA 4ZYSA 1IUEA 3AV8A 3TEWA 3NZ3A 1PGAA 4YSYB 2W3SA 5C3JB 2QIEB 3TUOA 2H88B 3NUHB 1XLPA 3AE8B 2GI9A 3Q8BA 3ZGZA 2BS2B 2IJ0A 4IOIE 1JMLA 1UGJA 1I4PA 2PIAA 4RFBA 2E6XA 3I9V1 3NVYA 3U52E 1IGDA 2FBWB 2Y3AA 2RDHA 1C9FA 1PGBA 1SIJA 2WNMA 2JWUA 1QOBA 2BT6A 4YWGG 4YXDB 3RFZB 1HZ5A 4N58A 1DYQA 1FFUA 1HQRD 4OVZA 2PTLA 4HJGE 5BMHA 1L4ZB 1CZPA 1M4VA 3AE9B 5HFYA 1N5XA 1QOAA 2WXRA 2DLBA 2ONQA 3LB8C 1N61A 4KKIA 5D3DA 1RWSA 2SAKA 2WDVB 2PLPA 2I38A 1CJEA 2J53A 1D6EC 1FM0D 2MJ3A 4XDDA 1DOIA 3V3XA 3W9CB 2BTEA 1YQ4B 4NJCA 2PW9A 1ROEA 1NVID 1K51A 3MJ5A 3ABVB 1AW7A 1L4DB 2JQRB 4XE0A 1AYFA 4A9AA 5BMIA 1QKZA 1VZ7A 2QJLA 1VR9A 1QOGA 4MT5A 4WH4A 2V4IB 4A8XC 2NTTA 1FMAD 3OWEB 4KX6B 1VDVA 2WS3B 3VQIA 2KQ4X 3V05A 3R2IA 1OQRA 3URYA 1NYQA 3J9CA 2PVGC 1E7PB 2ICIA 4KKJA 1D5ZC 1WWTA 3AE5B 2V3NA 1TY0A 1XO3A 1BUIC 1HXYD 2BW2A 1TS5A 5HI1A 1JWMD 4TSSA 1GAQB 2IGHA 3SR6A 2DYMA 5H8YE 2WXJA 5I4DA 4RCOA 1QLBB 1EU3A 1FEHA 4FXCA 3MHZA 2JXTA 1SJHD 3EA6A 1WXQA 2BB5A 2R61A 1VLBA 1XCTL 2G1EA 1I4HA 1JRPA 4ZHPA 1VJKA 1TZOA 4NAMA 5EE0A 3AH7A 3Q8CA 1F2RC 1YNTE 1F0ZA 4OZCA 2MEKA 2AQ3B 2QMTA 4KGSA 3CIRB 2WP9B 2KWDA 1FXIA 2L83A 2LEKA 4L23A 1V1PB 4Q2JA 4HRSA 1N62A 3P63A 3U4EG 1RYJA 2PVOD 2K22A 4L2YA 1V1OA 4XWWA 4TMAB 1IBXB 2KACA 3W5UB 1FFVA 2W82A 1VRAB 2ON8A 1GOZA 2MJEA 3P4QB 1UWXA 2V0GA 3NRZA 1EM7A 2KN4A 1JWBD 1MHXA 5C2TB 2J4XA 3AMZA 3FILB 2XN9C 3NVVA 3AE6B 3AE4B 4HEA1 2RPVA 3AEGB 2WQYB 1YN3A 4RF0A 1QOFA 5FKAC 2WXFA 4C56C 4PT5A 1K50A 3AE2B 3AEFB 4A6QA 1EU4A 2M19A 2Q5WD 1KH0A 2ZW1A 3IAS1 3ZJTA 1JROA 1R7SA 1ZE3D 4REZA 3GS2A 4TQ0A 1V1PA 3BZDB 1I4QA 2LHDA 2WXQA 5FR3A 3I57A 5G5GA 2ACZB 1J7CA 3AECB 1IBXA 2INNE 1DOYA 1L0XB 2E3TA 2XNAC 4ZRQA 4AS1A 1FRRA 4R3DA 3W2DA 3BYTB 2OEDA 2ZW0A 4GDLB 1YMHE 4YSZB 4A55A 5H92C 4RGNA 3FILA 1N63A 2WU2B 2WXOA 5TSSA 4JWUC 2BB6A 1V97A 4A90A 2V3PA 2DYOA 5BYRA 1E6EB 1TYGB 1PDXA 2AQ1B 3T3NA 2AX5A 3B9JA 3PZ8A 1FCCC 4XDCA 1GPXA 3DWGC 4P16A 3PO0A 4YTPB 1JALA 2JX5A 3MC0B 1QT9A 1L5PA 1NEKB 4NZLB 2Z8LA 2NMQA 1D5MC 1QQRA 1XCQL 3ZJVA 3ZJUA 1HA5A 1PGXA 4B0EA 3HUIA 3SFDB 1N5WA 1I4GA 4O1NA 1BXTA 1N60A 4H2AA 4NAWB 4CQNA 3TEZA 1YJJA 2HTME 3TSSA 1SEBD 2N0SB 3AN1A 2FUG1 2GRIA 1FIQA 3Q8AA 3H8HA 4P6VF 1ZOYB 1ENFA 4KGRA 3KQ4A 1UWMA 1C4AA 2INPE 1OFFA 2FE8A 1FXAA 2K3UA 4AQ7A 1WSPA 4N6EB 1YQ3B 3IAM1 1UNSA 5G5HA 2RMMA 3CWIA 1ZDXA 2GB1A 4J3OD 4LLGM 1KLUD 1TJEA 1TKYA 2L52A 4US9A 1XEEA 2J52A 2WDRB 1PFDA 1ESFA 4YSXB 3P1MA 1QF6A 4MH8A 3ZQ4A 4DXGA 1F2RI 2WXKA 4C7ZA 1XXGA 4IKGA 1XLQA 2NTSA 3PZ7A 4EE2A 2DWQA 1FRDA 3Q69A 4GLSC 5GXGB 2L1AA 1C78A 1P7FA 3B2FA 3AE3B 2WXHA 3P4RB 1AN8A 1SJED 1JWUD 1I4RA 1YJIA 1VZ8A 2RDGA 1Q10A 3VR8B 4C80A 1JWSD 3AEDB 2I2YA 1TS2A 2MH7A 3KLSX 5E6JA 4D2KA 3BYYB 3AM9A 4WAFA 1C4PA 4ITKA 3W1SA 1T5XD 1SB3C 5BMGA 1DOXA 2YEPB 1CK1A 1JWAD 5LNK1 1KRHA 3ZYYX 1RM6C 2Y5CA 2IGGA 3W5VB 1MI0A 1K53A 2LGIA 1TKEA 3SFEB 3T3OA 4HROA 1E9MA 3HVDA 2WU5B 3P4PB 1WYGA 5HG2A 1B1ZA 3AEAB 4ZOHC 3Q8FA 3BVZA 4OHJA 1L6UA 2IGDA 5FK9C 1ZDVA 2LUMA 1FNWA 3Q8EA 1DGJA 1A70A 1OQQA 4ZRPA 1WRIA 2WXPA 2WXMA 1TS3A 3BK1A 3FC4A 4RGOS 1TY2A 1GB4A 1ACCA 3EUB2 4YTNB 2SEBD 2JSVX 2YEPF 1KFYB 3KWVA 4RGTA 1E10A 4HKZE 3E9SA 3VRBB 1PUTA 1ZXHA 3LYYA 2X38A 1GB1A 1HEZE 3BIID 1E0ZA 4LTUA 1MVKA 4MACA 1J7AA 4YTMB 3AE1B 3WCQA 3GB1A 1C4CA 4RNAA 2DBYA 1C76A 3DWMA 5JXVA 1SE2A 1XLNA 1NYRA 1MHHE 2EELA 2OHFA 3EGRA 2VZKB 2LHEA 3BK2A 3HRDD 3AB5A 4JX1C 1V8CA 3MP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2R C;  1YNT E;  4OZC A;  2QMT A;  4KGS A;  1HZ6 A;  2KWD A;  2KDM A;  2N9L A;  4KGR A;  4KGT A;  1PGA A;  1IBX B;  2KAC A;  2RMM A;  2GB1 A;  2ON8 A;  2GI9 A;  2J52 A;  1UWX A;  2KN4 A;  1MPE A;  1EM7 A;  4IOI E;  1JML A;  1MHX A;  2JU6 X;  1F2R I;  3FIL B;  4IKG A;  2RPV A;  4GLS C;  1IGD A;  1C9F A;  1PGB A;  5HHD G;  1P7F A;  2JWU A;  1HZ5 A;  1K50 A;  1KH0 A;  2ZW1 A;  2I2Y A;  1Q10 A;  4D2K A;  2PTL A;  4HJG E;  5BMH A;  3UI3 A;  5HFY A;  1FD6 A;  2LHD A;  5BMG A;  2ONQ A;  2QSD A;  1IBX A;  2IGG A;  2N7J A;  1MI0 A;  2PLP A;  2I38 A;  1K53 A;  2J53 A;  2LGI A;  3V3X A;  5HG2 A;  2OED A;  2PW9 A;  2ZW0 A;  1YMH E;  1K51 A;  2IGD A;  3FIL A;  2LUM A;  5BMI A;  1IGC A;  1QKZ A;  4WH4 A;  1XF5 L;  4OZA A;  2N9K A;  1P7E A;  4OZB A;  2KQ4 X;  1GB4 A;  2K0P A;  2JZP A;  1FCL A;  2JSV X;  4HKZ E;  1FCC C;  5HI1 A;  1D4B A;  1ZXH A;  2IGH A;  1K52 A;  1GB1 A;  1HEZ E;  4MAC A;  1MVK A;  2NMQ A;  2JXT A;  1XCQ L;  3GB1 A;  1PGX A;  5JXV A;  1XCT L;  1MHH E;  2EEL A;  2LHE A;  3MP9 A; 
#chains in the Genus database with same CATH topology
 3UQA A;  3NS8 A;  4LCD E;  3ZW3 A;  3U2S C;  2KAJ A;  4N59 A;  1HTO A;  2WHI A;  2LUE A;  1ET9 A;  1R4N B;  2N9L A;  2PMV A;  4JE3 B;  2NR2 A;  1YN5 A;  1T6B X;  1WX7 A;  4E3C A;  1EWY C;  2MBH A;  1T0Y A;  3QQ8 B;  1Q1O A;  3AU5 A;  1J8C A;  3SEB A;  2K5P A;  3VR9 B;  2MA9 B;  4RGM A;  5C1Z A;  4ZHO A;  5IP4 D;  1RFK A;  3C8Y A;  2JT4 B;  2WXG A;  4ZYN A;  1T3Q A;  5D2M B;  1VD2 A;  2KK8 A;  2ZPY A;  1QIL A;  3QK0 A;  2ZVN A;  3KH0 A;  2WDQ B;  1I4X A;  1J19 A;  1WM2 A;  3P4S B;  3N20 C;  4KSK C;  3DBL B;  3EFU A;  3DHG C;  1EO6 A;  4N9F 4;  2KWU B;  1I7H A;  3TEY A;  1ZP0 B;  1KLG D;  4K3B A;  4CYE A;  3TEX A;  3C19 A;  4HWI B;  4WWO A;  1Y56 A;  1Y8R C;  5JHB A;  5EE1 A;  3VRA B;  2RR9 A;  2Y5P A;  1P7E A;  1SE4 A;  1Z2M A;  4HCP B;  1TBE A;  1YOV B;  4FJV B;  3ETR A;  2K0P A;  3WAO A;  3UIN B;  1TS4 A;  4JQW C;  2LJI A;  3T9L A;  2JXX A;  4LNI A;  4GDK B;  4USA A;  4WAA A;  2KNB A;  5EE9 A;  2B76 B;  4MJS B;  3AEE B;  4UDU C;  2JUO A;  2LVO A;  1UUP A;  2LXC A;  3IT6 B;  2KMC A;  4KSL C;  3M62 B;  4IWO A;  2MJD A;  2KN5 A;  1KTK A;  2KDM A;  5CX3 A;  3AV8 A;  1PGA A;  5C3J B;  3RI7 C;  1WGY A;  2H88 B;  2KAN A;  4NPN A;  4W9I A;  3WAL A;  2Z0D B;  3NUH B;  1XLP A;  5CHF A;  3AE8 B;  2GI9 A;  2BS2 B;  4IOI E;  4RFB A;  3NVY A;  3WAM A;  2KVZ A;  2FBW B;  1WYW B;  2Y3A A;  2WNM A;  1QOB A;  4YXD B;  3RFZ B;  2M17 A;  4HLE A;  4A20 A;  1R4M I;  1HQR D;  2HTH A;  4OVZ A;  4HJG E;  3PSE B;  5HFY A;  3AE9 B;  1N61 A;  5D3D A;  2I38 A;  4KZ0 A;  1CJE A;  2J53 A;  2NBU A;  2DHZ A;  3V3X A;  3QCA A;  2IO1 B;  4CO7 A;  3ABV B;  2XK5 B;  1AYF A;  4FN2 A;  4F7Z A;  5BMI A;  1VZ7 A;  1VR9 A;  2V4I B;  2D10 A;  4EKU A;  2LGS A;  5AEK B;  3AE5 B;  2N7E A;  1XO3 A;  1BUI C;  1HXY D;  2BW2 A;  3ONS A;  5HI1 A;  3DVN U;  2IGH A;  2AL3 A;  4RCO A;  1QLB B;  2KLG A;  3PHX B;  1WXQ A;  2OJR A;  3M95 A;  2KX0 A;  1JRP A;  2RD0 A;  4DHZ E;  1F0Z A;  4OZC A;  2QMT A;  2PJH A;  2LGY A;  4DWF A;  1EUV B;  2L83 A;  2UWQ A;  4JL9 A;  4L23 A;  3RUL A;  3HIZ A;  4HRS A;  2V4L A;  2KFJ A;  3U4E G;  3JW0 X;  1P1A A;  3I5J C;  2K22 A;  1WM3 A;  2KN4 A;  4KV2 A;  1SGH A;  2XN9 C;  1WJ6 A;  4RF0 A;  2NVU I;  3RZW C;  4IUM B;  4BVU C;  5LLI A;  4PT5 A;  1I35 A;  3AEF B;  1WR6 E;  3IAS 1;  1YX6 B;  3ML9 A;  2KVR A;  3DQV A;  1ZE3 D;  3TCA A;  2V3S A;  1V1P A;  3VTU A;  3ZNG C;  1LM8 B;  2DZI A;  2X8X X;  4WJP A;  3VH4 B;  3RZF A;  4FHK A;  2INN E;  1L0X B;  2KC2 A;  4ZRQ A;  1WX8 A;  4AS1 A;  4HDO A;  2LAS A;  4A55 A;  3FIL A;  5CHV C;  4LNN A;  4LNF A;  2WU2 B;  5TSS A;  2IO2 B;  2N9E B;  1F1H A;  1V5T A;  1WRD B;  3KYD D;  2KX3 A;  1TTN A;  5L95 C;  3MC9 A;  2AX5 A;  2BYV E;  4XDC A;  1GPX A;  3DWG C;  4P16 A;  4YTP B;  1JAL A;  3MC0 B;  1L5P A;  3L08 A;  2Z8L A;  1QQR A;  1XCQ L;  2R2Q A;  3ZJV A;  1PGX A;  3ZJU A;  3VUY A;  4B0E A;  3BY4 B;  5FR6 A;  1V8C A;  4O1N A;  1N60 A;  4MGK E;  3IVF A;  2A4Z A;  2L0T A;  2HTM E;  4ANX A;  3QWZ B;  1TT5 B;  3I3T B;  3H8H A;  3VXW A;  1YIW A;  4KGR A;  3KQ4 A;  2JZZ A;  1C4A A;  1E7U A;  2INP E;  1OFF A;  1G6J A;  4I6L B;  2K3U A;  2WX1 A;  4FJY A;  4MEM A;  4MSM B;  4M8N A;  4NQK E;  1PFD A;  3RNB C;  2WXK A;  2KJ6 A;  1XLQ A;  2NTS A;  2MWS B;  2MP2 A;  4GLS C;  4NAW A;  5GXG B;  3M3J A;  5J18 A;  5DCN A;  4WWP A;  2HE7 A;  4MDK E;  2I1K A;  1YJI A;  2RDG A;  4C80 A;  1JWS D;  3DBR I;  3DVN V;  5E6J A;  3BYY B;  3DHH C;  1C4P A;  2G45 B;  1OQY A;  4IWQ A;  3ZYY X;  1BT0 A;  1RM6 C;  4MH0 E;  3RT3 B;  1K53 A;  2LGI A;  3VUW A;  4HRO A;  3HVD A;  5C23 A;  1WYG A;  2AYO B;  3AEA B;  4OHJ A;  1ZDV A;  2MBO A;  1FNW A;  3Q8E A;  3KVF B;  2AEH A;  1OQQ A;  1WRI A;  2L76 A;  2WXP A;  4GOC A;  3MC8 A;  2DEN B;  3VUX A;  4EEW A;  4K7U A;  4KZC A;  2SEB D;  1GNU A;  1KFY B;  3QA8 A;  3VRB B;  2G4D B;  3QAR A;  3LYY A;  2CHW A;  3V61 A;  2MX2 A;  5J17 A;  2ZJD A;  4PYU A;  1SE2 A;  2EEL A;  3GE8 C;  2VZK B;  2L05 A;  2LHE A;  2JY6 A;  2NPT B;  4JX1 C;  3L4P A;  4II2 B;  2K8C A;  4XX5 A;  1HZ6 A;  4DHJ B;  2UU7 A;  3BIN A;  2L0F A;  4WIP A;  4OVU A;  3OJ3 A;  3NVZ A;  5D6J B;  2DAF A;  1K8R B;  2K6D B;  5D3I B;  2L32 A;  1SE9 A;  1EF1 A;  1RLF A;  2LFI A;  3PS6 A;  1SBB B;  2MHJ A;  1CMX B;  4LNO A;  1D5X C;  2KQ7 A;  4LK0 M;  3NS1 A;  4JLC A;  5IAA C;  3VAW A;  3ML8 A;  2D3B A;  4URK A;  1WE7 A;  5HHD G;  1AAR A;  2M1M A;  3HHM A;  3RNE C;  4GU2 A;  4PS8 A;  4M0W B;  1L6V A;  3KWL A;  4WQM A;  3UIO B;  4LJP B;  1OGW A;  1NDD A;  1FD6 A;  1YQB A;  4MM3 B;  1L0V B;  4BKS A;  4L1B A;  2BQQ A;  1KF6 B;  3APD A;  1TGZ B;  4ASW C;  5JHA A;  4B0M A;  1C79 A;  3B2G A;  2WDT B;  5E6P A;  3MJW A;  3ZIM A;  1EWC A;  4G50 A;  4KIK B;  3DVG X;  5IKC M;  4M8M A;  4AQ7 A;  4LNK A;  4OZA A;  4TQ1 A;  1STE A;  2N9P C;  1NI3 A;  2BKR B;  1C1Y B;  2L7R A;  2QEJ C;  5AUK A;  2K39 A;  1J7B A;  1D4B A;  4WJO A;  2CU3 A;  1VZ6 A;  1NEN B;  3U7Z A;  3E56 A;  4IDI A;  3GOE A;  4WJN A;  3MFG A;  3QX1 A;  2WXN A;  2VZK D;  2HDE A;  2H89 B;  2M0A A;  2G9H D;  4ARC A;  2IND C;  1WX9 A;  4JWS C;  4RM8 A;  5EDS A;  2L00 B;  4DHJ D;  2J42 A;  3FKY A;  4US8 A;  2LGD A;  3NZU A;  3QJZ A;  3I63 C;  1XD3 B;  3EHV A;  4S0R A;  4ZYS A;  1IUE A;  3EC8 A;  3NZ3 A;  5AZG A;  4GB9 A;  2QIE B;  4W9D A;  3V6C B;  3SU8 X;  1UZX B;  3Q8B A;  3ZGZ A;  2IJ0 A;  4M02 A;  1JML A;  2KLC A;  1NI2 A;  1ZGU B;  1H8C A;  3JVZ X;  2E6X A;  2K6Q A;  2K8B A;  3A9J A;  5IA7 A;  2JWU A;  2BT6 A;  4YWG G;  1WE6 A;  1HZ5 A;  2PTL A;  4C4V A;  5KHO A;  3K9P B;  1WGD A;  4W9F A;  2FCQ A;  2AL6 A;  5BMH A;  3N1Y C;  1E8X A;  2JPH A;  1N5X A;  3ZNZ B;  5JZE B;  1QOA A;  2WXR A;  2ONQ A;  2QDF A;  2LZ6 A;  3MHS D;  1ISN A;  4TUU A;  4PS3 A;  2WDV B;  3JSV A;  3R7Q A;  2MJ3 A;  3L17 A;  3W9C B;  1SIF A;  1K51 A;  3UF8 A;  3MJ5 A;  1AW7 A;  4XE0 A;  3A1Q A;  2FIF A;  3SHQ A;  3TL5 A;  4WH4 A;  1QOG A;  2C60 A;  4A8X C;  4KX6 B;  2WS3 B;  3VQI A;  2EKE C;  4P1C C;  1GC7 A;  3ECI A;  1WXV A;  1OQR A;  3H1U A;  3URY A;  1NYQ A;  3DBL I;  2PVG C;  4AWJ A;  2V3N A;  4BBN C;  4TSS A;  2K1F A;  2DYM A;  3ZNH B;  4FXC A;  2KC1 A;  2V9H A;  3MHZ A;  1WF9 A;  2V1Y A;  1SJH D;  3PTF C;  1V5O A;  2BVC A;  1I4H A;  4ZHP A;  2XEW A;  3AH7 A;  1F2R C;  3CMM B;  2AQ3 B;  4GMV A;  3CIR B;  2ASQ A;  1OTR B;  2WX0 A;  2IY0 B;  1RYJ A;  1V1O A;  2ZEQ A;  2RGF A;  2G3Q B;  4TMA B;  2KAC A;  2YLM A;  2MJE A;  4FAD A;  1RFA A;  4DDI D;  1ZKH A;  3MTN B;  1EM7 A;  3PRE A;  4XYC A;  2J4X A;  3AE6 B;  2O2V A;  3AE4 B;  2RPV A;  3PRP B;  1QOF A;  3KUD B;  1K50 A;  3TBL D;  2M19 A;  1JRO A;  4M00 A;  4TQ0 A;  2GMI C;  3CSF A;  4BOS C;  4J6I A;  1WGH A;  3H7P A;  5FR3 A;  3I57 A;  2KFK B;  1J7C A;  3AEC B;  1IBX A;  2E3T A;  2BWF A;  2XNA C;  1C3T A;  5JH5 C;  3BYT B;  3RNC C;  2RPQ A;  2ZW0 A;  1YMH E;  4E71 A;  3K9O B;  1WY8 A;  3CST A;  4PK1 A;  4JWU C;  2V3P A;  4DDG D;  4S17 A;  1WMH B;  5E6N A;  5BYR A;  1TYG B;  2AQ1 B;  3T3N A;  3KYC D;  3Q3M C;  3JYU A;  4HK2 A;  3PO0 A;  1QT9 A;  2KXJ A;  2MBB B;  4NZL B;  4B95 A;  2NMQ A;  1HA5 A;  5CTR C;  2DZM A;  2N9X A;  1I4G A;  4H2A A;  2BWE S;  2KKC A;  4ANU A;  4GDL A;  4ZRI A;  1SEB D;  2KQS A;  3C0R B;  1ENF A;  4IC7 B;  4F1S A;  2BGF A;  2CS4 A;  1WSP A;  1KOT A;  4N6E B;  1GUA B;  1UNS A;  2KTR A;  5G5H A;  1A5R A;  3DBH B;  3ZRC A;  1TKY A;  4US9 A;  1XEE A;  1Z5S B;  1ESF A;  3LJ3 A;  3P1M A;  2EMT A;  2DWQ A;  1TZ1 A;  1C78 A;  1P7F A;  3AE3 B;  2WXH A;  1SJE D;  1JWU D;  5DPT A;  1TS2 A;  2MH7 A;  4D2K A;  1LQB A;  1RRB A;  4ITK A;  4HVB A;  3PRZ A;  5BMG A;  1V2Y A;  4XC2 A;  1CK1 A;  1JWA D;  4K1R B;  2Y5C A;  3TMP B;  1TKE A;  2O6V B;  1B1Z A;  4X57 B;  2LUM A;  4GN1 A;  3VTV A;  1A70 A;  2WXM A;  2LWP A;  3A9K A;  3PZD A;  1GB4 A;  1ACC A;  3NZS A;  2KDI A;  1WJU A;  1V81 A;  4NJ6 A;  3E9S A;  3GE3 C;  2MSE D;  2D3G A;  1Q0W B;  3BII D;  5HKH A;  4W9E A;  2FAZ A;  3WCQ A;  5AZH A;  3GB1 A;  1L7Y A;  2PPH A;  5CHW A;  2RSU A;  3VTW A;  1MG4 A;  3VDZ A;  2HJ1 A;  3EGR A;  4W9K A;  3HRD D;  3AB5 A;  1UBQ A;  1V9J A;  3ZXR A;  1FNV A;  1L0Y B;  2GBR A;  1QZE A;  2LI5 A;  3VFK A;  3QAQ A;  4G3X B;  1XLO A;  2IDY A;  1WXA A;  2PKO A;  3L13 A;  4W9H A;  2L3Z A;  2VH2 A;  4C00 A;  3N9Y C;  4WUR A;  2BYT A;  2NBW B;  4WWM A;  1E8Z A;  3RPF C;  2ZCB A;  4IW0 A;  4ICV A;  1MPE A;  2BYE A;  2MBQ A;  2CJN A;  2M56 B;  1V49 A;  2MLB A;  4RH6 A;  4DQO C;  1JW9 D;  2BPS A;  4C7Y A;  4BAX A;  2W55 A;  2D5G A;  5D7G A;  2BBC A;  3UI3 A;  4BKG A;  3RN9 C;  1F77 A;  1LGR A;  4CHK A;  3H6N A;  2GBK A;  2O6V D;  1EF5 A;  1SXT A;  4EOY A;  2BS4 B;  1JCK B;  3P42 A;  3ZO5 B;  2J0M A;  1GC6 A;  3ZUN A;  2N9K A;  3BVG A;  4OZB A;  1S1Q B;  1ET6 A;  3R2T A;  1BML C;  2ZCC A;  2CKH B;  1MJD A;  4JPS A;  3N1Z C;  5KHQ A;  4FUL A;  3IXS A;  1FCL A;  4DHZ B;  3IBE A;  3NOB A;  2JYE A;  1K52 A;  3CF6 E;  4KVG B;  3GP7 A;  2PE6 B;  1ZXI A;  3SDL C;  2W3R A;  3H7S A;  1AWD A;  2WXI A;  2WLB A;  4PS7 A;  3AE7 B;  3TIX A;  2IPK D;  4K7S A;  2CJO A;  3M63 B;  3Q14 C;  1FPY A;  2MCN B;  1ZUD 2;  1WGG A;  2N1V A;  4KGT A;  3DOW A;  2LRW A;  5DPS A;  3TUO A;  3ZXV A;  2FID A;  1PQS A;  3AU4 A;  2GBJ A;  1UGJ A;  1I4P A;  4GDK A;  2PIA A;  2DYB A;  5LXI B;  2R2O A;  1WR1 A;  4MJS A;  4N58 A;  1JRU A;  2OJW A;  3B08 A;  2IO0 B;  4MSQ B;  4WWN A;  1L4Z B;  2QCZ A;  1IP9 A;  2DLB A;  2JRH A;  2LGX A;  3V62 A;  3PT2 B;  3LB8 C;  4A3P A;  2JWZ A;  2SAK A;  3VHT C;  2PLP A;  4B6W A;  4XDD A;  2BTE A;  1DOI A;  1WXM A;  1KLV A;  4NJC A;  2PW9 A;  2IO3 B;  1ROE A;  1NVI D;  1L4D B;  2JQR B;  4A9A A;  3AUL A;  1P3Q U;  1QKZ A;  3N30 A;  2QJL A;  1FMA D;  1OEY A;  3U7D A;  2KQ4 X;  3V05 A;  1L2N A;  3VH3 B;  2Y5B B;  3J9C A;  1E7P B;  4KKJ A;  1D5Z C;  1WWT A;  2KD0 A;  2KHW B;  1TS5 A;  3SR6 A;  2WXJ A;  1EU3 A;  1FEH A;  2JXT A;  2BB5 A;  4EZJ A;  1VLB A;  4DBG A;  1FXT B;  2LXA A;  3W1Y A;  1XCT L;  2G1E A;  1VJK A;  4NAM A;  2C5L C;  1Q5W B;  3Q8C A;  3NJT A;  2RDB C;  2KOX A;  2XK5 A;  2KWD A;  1FXI A;  3DDC B;  2LEK A;  3V60 A;  2NS5 A;  1V1P B;  1N62 A;  3P63 A;  4AOF A;  2PVO D;  2I1J A;  4L2Y A;  2K8H A;  4HPM B;  4XWW A;  2W82 A;  2ON8 A;  3RNF C;  3EEC A;  1JWB D;  1MHX A;  5C2T B;  3FIL B;  4HEA 1;  2DZJ A;  3AEG B;  4G11 A;  3GZN B;  3L54 A;  2WXF A;  3AE2 B;  4TKN A;  4A6Q A;  2Q5W D;  1WGR A;  2ZW1 A;  2NCN A;  3ZJT A;  3PRM B;  1R7S A;  1UBI A;  4REZ A;  3GS2 A;  2D3C A;  3B0A A;  1HTQ A;  2FCS A;  2WXQ A;  5G5G A;  2FNJ B;  1DOY A;  1R4N I;  2NBV B;  2KJH B;  1UEL A;  1FRR A;  3KUZ A;  3P2B A;  2OED A;  3ZVV A;  1YX5 B;  3SD5 A;  4M01 A;  3IFW B;  2BB6 A;  3KUC B;  2N1W A;  2JZ3 B;  4ZRK A;  1V97 A;  2MBE A;  4DXA B;  3A33 B;  1E6E B;  1PDX A;  1X1M A;  3UIP B;  4NJ7 A;  2ZPN A;  2BYF A;  3PGE A;  2A5U A;  4P7I A;  4EZK A;  3DPD A;  2OOB B;  4HXD A;  3HUI A;  4E74 A;  2MP2 B;  1BXT A;  3NHE B;  4NAW B;  4CQN A;  1WZ3 A;  2KJR A;  1YJJ A;  3HK0 A;  2KDE B;  5L83 A;  3AN1 A;  2FUG 1;  4JIO U;  1FIQ A;  3U30 A;  1ZOY B;  4NQL B;  1UWM A;  4TV3 A;  1FXA A;  1YQ3 B;  1U4A A;  3IAM 1;  1MG8 A;  2WWZ A;  3APF A;  4J3O D;  4LLG M;  2J52 A;  2WDR B;  4ANV A;  3O65 B;  3DHI C;  4YSX B;  3ZDT A;  3ZQ4 A;  4DXG A;  2GLS A;  1WIA A;  4C7Z A;  4IKG A;  3ZNI D;  3PZ7 A;  2DX5 B;  4EE2 A;  1FRD A;  3Q69 A;  3ZLZ A;  2KYW A;  5TR5 A;  2HD5 B;  1M94 A;  3P4R B;  4BBN F;  1OEY J;  2I2Y A;  4ACF A;  3AED B;  2DAJ A;  3AM9 A;  1E8W A;  3T8M A;  3W1S A;  4DK5 A;  1T0S C;  1SB3 C;  2C7H A;  2IGG A;  3W5V B;  1MI0 A;  4II3 B;  3SFE B;  3T3O A;  3RNA C;  1F9J A;  5HG2 A;  4FA6 A;  3BVZ A;  1L6U A;  4IM0 A;  4HJK A;  3WIM A;  4ANW A;  2IY1 B;  4ZDV A;  2CU1 A;  3EFC A;  2KDB A;  1TS3 A;  3BK1 A;  1TY2 A;  4W9C A;  4HCN B;  3EUB 2;  3OAW A;  4YTN B;  1KJT A;  2JSV X;  2KWV B;  2YEP F;  4RGT A;  1E10 A;  1PUT A;  2IBI B;  2CHX A;  3H9D A;  3HM3 A;  1E0Z A;  3R3M A;  4LTU A;  4MAC A;  1J7A A;  3L0W B;  4YTM B;  4IG7 B;  4KDL B;  4AJY B;  1UGM A;  1C76 A;  2KZR A;  1XLN A;  2ZNV B;  1J0G A;  2OHF A;  4GIV A;  3LDZ E;  3MP9 A;  1H4R A;  3QIJ A;  1TKG A;  4RF1 A;  2N4F A;  1WH3 A;  1FO4 A;  2C7M B;  5GMV A;  5IN7 A;  2J7Q B;  2ZVO A;  3BWU D;  3AEB B;  2J0K A;  1S3S G;  2EKI A;  2WXL A;  4OW0 A;  3PV1 A;  4HKQ A;  3DCG A;  1R4M B;  1LO5 D;  4NNJ B;  3BVM A;  4HPP A;  5BYS A;  4JGH B;  1P0R A;  2JU6 X;  2L8J A;  2TSS A;  4W9J A;  3AXC A;  2NPT A;  2D11 A;  4B9K A;  4YT0 B;  3DBH I;  2KT7 A;  4YL8 A;  4DXF A;  1UF0 A;  1SF0 A;  3HVZ A;  2KMM A;  4QAY A;  3X0W A;  5LXH A;  3WAP A;  2QSD A;  1ZPS A;  4BOZ B;  5BYQ A;  4I6P A;  1C77 A;  2BS3 B;  2N7J A;  4FLH A;  2CR5 A;  2W54 A;  1I42 A;  4ARI A;  2VRR B;  3ALB A;  1RAX A;  2MQJ A;  2JYT A;  2JRI B;  1IGC A;  1YN4 A;  3FAH A;  3S2A A;  5EE3 A;  1SE3 A;  1XF5 L;  5AUI A;  3OJ4 B;  1TIF A;  1E8Y A;  4XWT A;  5G55 A;  2QIL A;  2M0X A;  4K3C A;  1JQ4 A;  2K9X A;  2Z59 B;  2JZP A;  1FNU A;  4M0W A;  1B9R A;  2JF5 A;  1CQV A;  3UGB B;  2J0J A;  3QC8 B;  1WFY A;  1IPG A;  4MM3 A;  5T8I A;  1LFD A;  1HE8 A;  1WGK A;  2AQ2 B;  3R8B A;  3IT4 B;  3NVW A;  1SSN A;  1T0Q C;  3A9J B;  3O13 A;  5MPO A;  4KIK A;  1PYW D;  4C4V B;  2LMC A;  3LXF A;  3N1X C;  4BKS D;  3PVL A;  4XGA B;  4MEL A;  4IM3 A;  3TEW A;  4WQO B;  4YSY B;  2W3S A;  2ZNV C;  3Q3J A;  4FHJ A;  2M4N A;  3JSV B;  4IWP A;  3RUI B;  2N7D A;  2C9W B;  3RD2 A;  4IM2 A;  3A1Q B;  1V80 A;  4GGQ A;  3I9V 1;  3U52 E;  2LVP A;  1IGD A;  2QHO A;  2PEA A;  2RDH A;  1C9F A;  1PGB A;  5AZF A;  1SIJ A;  4XZ4 A;  2REX A;  3PLU A;  2LRU A;  1DYQ A;  3R66 C;  1FFU A;  3X23 A;  2QC8 A;  3Q3N C;  1CZP A;  1M4V A;  3WAN A;  2DZK A;  4K7W A;  4KKI A;  1RWS A;  3NY5 A;  4KDI C;  1D6E C;  4P1B C;  1FM0 D;  2IYD B;  1YQ4 B;  2KDF B;  3U8Z A;  5J2R A;  2EMS A;  3B1L X;  4MT5 A;  2NTT A;  3OWE B;  1WJ4 A;  1VDV A;  2LVQ A;  2M8S A;  1T0R C;  3R2I A;  2ICI A;  4F8C B;  1TY0 A;  1JWM D;  1GAQ B;  1E5W A;  1WJN A;  4K81 A;  5H8Y E;  5I4D A;  3UQB A;  5G2N A;  2Z0E B;  2KTF A;  3EA6 A;  2R61 A;  2O2V B;  3A4R A;  1TZO A;  4RM9 A;  2ZZP B;  5EE0 A;  3RCZ A;  2AWT A;  1YNT E;  2KMA A;  1P9D U;  4NY0 A;  2B3A A;  2YVC A;  4WJQ A;  2MEK A;  2KO3 A;  4KGS A;  1ZW7 A;  2WP9 B;  3IG3 A;  4BZA A;  3D32 A;  4FJZ A;  4HPL B;  4Q2J A;  3TJP A;  3Q3O C;  5D94 A;  4PYZ A;  3H7P B;  2VH1 A;  5E6O A;  2DNF A;  1IBX B;  3W5U B;  1FFV A;  1VRA B;  2XBB C;  4EFO A;  2LD9 A;  1GOZ A;  3P4Q B;  4LDT B;  1UWX A;  2V0G A;  3NRZ A;  3DBR B;  2HJ8 A;  5IO9 A;  3AMZ A;  2IZV B;  3NVV A;  1N6Z A;  3L10 B;  2GBM A;  2W9N A;  3DBS A;  2WQY B;  1YN3 A;  4GXB A;  3Q6B A;  4EZL A;  3ZRF A;  2CHZ A;  3N32 A;  5FKA C;  2INC C;  4C56 C;  1VCB A;  2UYZ B;  1EU4 A;  4MGI E;  1KH0 A;  2D2Q A;  3BZD B;  5DPW A;  2K25 A;  3VVW B;  1I4Q A;  2LHD A;  3WA0 A;  2ACZ B;  3NG0 A;  4W9L A;  4R3D A;  3W2D A;  4EUT A;  4GDL B;  4YSZ B;  1YD8 U;  5H92 C;  4RGN A;  1N63 A;  2WXO A;  1V6E A;  3ZTD A;  1IYF A;  3PLV A;  4ZRJ A;  4A90 A;  5DPR A;  2WGS A;  1LXD A;  2DYO A;  2KWC A;  3RYT A;  4ICU A;  2KTR B;  3B9J A;  3PZ8 A;  1FCC C;  1UD7 A;  4BKT A;  2JX5 A;  3Q2A C;  1NEK B;  3V6E B;  4HDQ A;  4I6N B;  1D5M C;  4G0N B;  3AI5 A;  2BKF A;  2PE9 A;  2KFK A;  3DVG Y;  3SFD B;  1N5W A;  1WXS A;  2LJ5 A;  1UH6 A;  4BFR A;  1F52 A;  3TEZ A;  3APC A;  3TSS A;  4AUQ C;  2N0S B;  1WZ0 A;  1GG3 A;  3OLM D;  3W1S C;  3ENE A;  2GRI A;  3Q8A A;  4P6V F;  2JVC A;  3IHP C;  1NBF C;  1E7V A;  1WMH A;  2FE8 A;  3PPA A;  1P98 A;  3OG5 A;  3Q3F A;  4MGY E;  2C7N B;  5BO4 B;  2RMM A;  3CWI A;  1ZDX A;  2GB1 A;  4LDT D;  1KLU D;  1TJE A;  4AP4 C;  2L52 A;  2D07 B;  1GJZ A;  1QF6 A;  4MH8 A;  3L16 A;  1F2R I;  1XXG A;  3A4S C;  4OVV A;  4FBJ B;  3KW5 B;  3A9K B;  2FUH B;  2L1A A;  3QHT A;  3B2F A;  2G4S A;  2GOW A;  2WYQ A;  1AN8 A;  4GSW A;  3RMK C;  1I4R A;  1VZ8 A;  3VR8 B;  1Q10 A;  3KLS X;  3ZKJ C;  4WAF A;  1D3Z A;  1T5X D;  1DOX A;  2YEP B;  2FCM A;  5LNK 1;  1KRH A;  3RNG C;  3GZN I;  1KM7 A;  5IOI A;  1E90 A;  1E9M A;  2WU5 B;  1XT9 B;  3ZDM C;  3P4P B;  4RMA A;  4W9G A;  4ZOH C;  3Q8F A;  1XQQ A;  2IGD A;  5FK9 C;  3ZTC A;  1WI0 A;  1DGJ A;  2D3A A;  4MGZ E;  4ZRP A;  3FC4 A;  3PHW B;  4AJW A;  4RGO S;  4A3O A;  1YJ1 A;  4LJO B;  3KWV A;  4HKZ E;  2GBN A;  1ZXH A;  2X38 A;  2MRP A;  1GB1 A;  1HEZ E;  1MVK A;  1MFW A;  2BF8 B;  3AE1 B;  3HM6 X;  1C4C A;  4RNA A;  3N3K B;  2DBY A;  3DWM A;  5JXV A;  2MW5 A;  1NYR A;  1MHH E;  3BK2 A;  2FCN A;  1V86 A;  2O6V A;  3R7R A; 
#chains in the Genus database with same CATH homology
 1FNV A;  1L0Y B;  3L4P A;  1TKG A;  4RF1 A;  1HZ6 A;  3U2S C;  2KAJ A;  4N59 A;  1FO4 A;  1ET9 A;  1XLO A;  2PMV A;  2N9L A;  4WIP A;  2IDY A;  2PKO A;  4JE3 B;  3NVZ A;  1YN5 A;  3BWU D;  1T6B X;  3AEB B;  2EKI A;  2WXL A;  3N9Y C;  4OW0 A;  4WUR A;  5D3I B;  2BYT A;  4HKQ A;  2L32 A;  4WWM A;  2LFI A;  1SBB B;  1LO5 D;  3RPF C;  1EWY C;  1D5X C;  3BVM A;  5BYS A;  1MPE A;  4LK0 M;  2CJN A;  2JU6 X;  3NS1 A;  3SEB A;  2TSS A;  2M56 B;  2K5P A;  3VR9 B;  4RH6 A;  4DQO C;  4RGM A;  1JW9 D;  4ZHO A;  4C7Y A;  5HHD G;  4YT0 B;  1RFK A;  2W55 A;  2D5G A;  3C8Y A;  1L6V A;  2WXG A;  3KWL A;  4WQM A;  5D7G A;  2BBC A;  4DXF A;  1T3Q A;  1SF0 A;  1QIL A;  3HVZ A;  3UI3 A;  2KMM A;  2WDQ B;  4MM3 B;  1I4X A;  1FD6 A;  1L0V B;  4L1B A;  2QSD A;  1KF6 B;  1ZPS A;  5BYQ A;  1C77 A;  1F77 A;  2BS3 B;  3P4S B;  2N7J A;  2W54 A;  4B0M A;  1C79 A;  4ARI A;  1I7H A;  1SXT A;  3B2G A;  1ZP0 B;  3TEY A;  1KLG D;  2BS4 B;  3TEX A;  1JCK B;  2JYT A;  1EWC A;  3P42 A;  1IGC A;  1YN4 A;  3FAH A;  1Y56 A;  5EE3 A;  1SE3 A;  5EE1 A;  3VRA B;  1XF5 L;  2Y5P A;  4OZA A;  4TQ1 A;  1STE A;  2N9K A;  1P7E A;  3BVG A;  1SE4 A;  5AUI A;  1NI3 A;  4OZB A;  1ET6 A;  3R2T A;  1BML C;  3ETR A;  4XWT A;  2QIL A;  1JQ4 A;  2K0P A;  2K9X A;  2QEJ C;  4JPS A;  2JZP A;  1FNU A;  3IXS A;  1FCL A;  4M0W A;  1B9R A;  5AUK A;  1CQV A;  1TS4 A;  1J7B A;  1D4B A;  2CU3 A;  2LJI A;  2JYE A;  1K52 A;  1VZ6 A;  1NEN B;  3U7Z A;  3E56 A;  4IDI A;  5T8I A;  3GP7 A;  4GDK B;  1WGK A;  4USA A;  3MFG A;  1ZXI A;  2AQ2 B;  2WXN A;  2VZK D;  3IT4 B;  3R8B A;  2HDE A;  3NVW A;  2W3R A;  2H89 B;  1SSN A;  1AWD A;  2M0A A;  2WXI A;  2G9H D;  2WLB A;  4ARC A;  3O13 A;  5EE9 A;  2B76 B;  4JWS C;  3AEE B;  4UDU C;  1UUP A;  3AE7 B;  3IT6 B;  2J42 A;  5MPO A;  2IPK D;  4US8 A;  2CJO A;  2MJD A;  1PYW D;  1ZUD 2;  2LMC A;  3LXF A;  1KTK A;  2KDM A;  4KGT A;  4ZYS A;  1IUE A;  3AV8 A;  3TEW A;  3NZ3 A;  1PGA A;  4YSY B;  2W3S A;  5C3J B;  2QIE B;  3TUO A;  2H88 B;  3NUH B;  1XLP A;  3AE8 B;  2GI9 A;  3Q8B A;  3ZGZ A;  2BS2 B;  2IJ0 A;  4IOI E;  1JML A;  1UGJ A;  1I4P A;  2PIA A;  4RFB A;  2E6X A;  3I9V 1;  3NVY A;  3U52 E;  1IGD A;  2FBW B;  2Y3A A;  2RDH A;  1C9F A;  1PGB A;  1SIJ A;  2WNM A;  2JWU A;  1QOB A;  2BT6 A;  4YWG G;  4YXD B;  3RFZ B;  1HZ5 A;  4N58 A;  1DYQ A;  1FFU A;  1HQR D;  4OVZ A;  2PTL A;  4HJG E;  5BMH A;  1L4Z B;  1CZP A;  1M4V A;  3AE9 B;  5HFY A;  1N5X A;  1QOA A;  2WXR A;  2DLB A;  2ONQ A;  3LB8 C;  1N61 A;  4KKI A;  5D3D A;  1RWS A;  2SAK A;  2WDV B;  2PLP A;  2I38 A;  1CJE A;  2J53 A;  1D6E C;  1FM0 D;  2MJ3 A;  4XDD A;  1DOI A;  3V3X A;  3W9C B;  2BTE A;  1YQ4 B;  4NJC A;  2PW9 A;  1ROE A;  1NVI D;  1K51 A;  3MJ5 A;  3ABV B;  1AW7 A;  1L4D B;  2JQR B;  4XE0 A;  1AYF A;  4A9A A;  5BMI A;  1QKZ A;  1VZ7 A;  2QJL A;  1VR9 A;  1QOG A;  4MT5 A;  4WH4 A;  2V4I B;  4A8X C;  2NTT A;  1FMA D;  3OWE B;  4KX6 B;  1VDV A;  2WS3 B;  3VQI A;  2KQ4 X;  3V05 A;  3R2I A;  1OQR A;  3URY A;  1NYQ A;  3J9C A;  2PVG C;  1E7P B;  2ICI A;  4KKJ A;  1D5Z C;  1WWT A;  3AE5 B;  2V3N A;  1TY0 A;  1XO3 A;  1BUI C;  1HXY D;  2BW2 A;  1TS5 A;  5HI1 A;  1JWM D;  4TSS A;  1GAQ B;  2IGH A;  3SR6 A;  2DYM A;  5H8Y E;  2WXJ A;  5I4D A;  4RCO A;  1QLB B;  1EU3 A;  1FEH A;  4FXC A;  3MHZ A;  2JXT A;  1SJH D;  3EA6 A;  1WXQ A;  2BB5 A;  2R61 A;  1VLB A;  1XCT L;  2G1E A;  1I4H A;  1JRP A;  4ZHP A;  1VJK A;  1TZO A;  4NAM A;  5EE0 A;  3AH7 A;  3Q8C A;  1F2R C;  1YNT E;  1F0Z A;  4OZC A;  2MEK A;  2AQ3 B;  2QMT A;  4KGS A;  3CIR B;  2WP9 B;  2KWD A;  1FXI A;  2L83 A;  2LEK A;  4L23 A;  1V1P B;  4Q2J A;  4HRS A;  1N62 A;  3P63 A;  3U4E G;  1RYJ A;  2PVO D;  2K22 A;  4L2Y A;  1V1O A;  4XWW A;  4TMA B;  1IBX B;  2KAC A;  3W5U B;  1FFV A;  2W82 A;  1VRA B;  2ON8 A;  1GOZ A;  2MJE A;  3P4Q B;  1UWX A;  2V0G A;  3NRZ A;  1EM7 A;  2KN4 A;  1JWB D;  1MHX A;  5C2T B;  2J4X A;  3AMZ A;  3FIL B;  2XN9 C;  3NVV A;  3AE6 B;  3AE4 B;  4HEA 1;  2RPV A;  3AEG B;  2WQY B;  1YN3 A;  4RF0 A;  1QOF A;  5FKA C;  2WXF A;  4C56 C;  4PT5 A;  1K50 A;  3AE2 B;  3AEF B;  4A6Q A;  1EU4 A;  2M19 A;  2Q5W D;  1KH0 A;  2ZW1 A;  3IAS 1;  3ZJT A;  1JRO A;  1R7S A;  1ZE3 D;  4REZ A;  3GS2 A;  4TQ0 A;  1V1P A;  3BZD B;  1I4Q A;  2LHD A;  2WXQ A;  5FR3 A;  3I57 A;  5G5G A;  2ACZ B;  1J7C A;  3AEC B;  1IBX A;  2INN E;  1DOY A;  1L0X B;  2E3T A;  2XNA C;  4ZRQ A;  4AS1 A;  1FRR A;  4R3D A;  3W2D A;  3BYT B;  2OED A;  2ZW0 A;  4GDL B;  1YMH E;  4YSZ B;  4A55 A;  5H92 C;  4RGN A;  3FIL A;  1N63 A;  2WU2 B;  2WXO A;  5TSS A;  4JWU C;  2BB6 A;  1V97 A;  4A90 A;  2V3P A;  2DYO A;  5BYR A;  1E6E B;  1TYG B;  1PDX A;  2AQ1 B;  3T3N A;  2AX5 A;  3B9J A;  3PZ8 A;  1FCC C;  4XDC A;  1GPX A;  3DWG C;  4P16 A;  3PO0 A;  4YTP B;  1JAL A;  2JX5 A;  3MC0 B;  1QT9 A;  1L5P A;  1NEK B;  4NZL B;  2Z8L A;  2NMQ A;  1D5M C;  1QQR A;  1XCQ L;  3ZJV A;  3ZJU A;  1HA5 A;  1PGX A;  4B0E A;  3HUI A;  3SFD B;  1N5W A;  1I4G A;  4O1N A;  1BXT A;  1N60 A;  4H2A A;  4NAW B;  4CQN A;  3TEZ A;  1YJJ A;  2HTM E;  3TSS A;  1SEB D;  2N0S B;  3AN1 A;  2FUG 1;  2GRI A;  1FIQ A;  3Q8A A;  3H8H A;  4P6V F;  1ZOY B;  1ENF A;  4KGR A;  3KQ4 A;  1UWM A;  1C4A A;  2INP E;  1OFF A;  2FE8 A;  1FXA A;  2K3U A;  4AQ7 A;  1WSP A;  4N6E B;  1YQ3 B;  3IAM 1;  1UNS A;  5G5H A;  2RMM A;  3CWI A;  1ZDX A;  2GB1 A;  4J3O D;  4LLG M;  1KLU D;  1TJE A;  1TKY A;  2L52 A;  4US9 A;  1XEE A;  2J52 A;  2WDR B;  1PFD A;  1ESF A;  4YSX B;  3P1M A;  1QF6 A;  4MH8 A;  3ZQ4 A;  4DXG A;  1F2R I;  2WXK A;  4C7Z A;  1XXG A;  4IKG A;  1XLQ A;  2NTS A;  3PZ7 A;  4EE2 A;  2DWQ A;  1FRD A;  3Q69 A;  4GLS C;  5GXG B;  2L1A A;  1C78 A;  1P7F A;  3B2F A;  3AE3 B;  2WXH A;  3P4R B;  1AN8 A;  1SJE D;  1JWU D;  1I4R A;  1YJI A;  1VZ8 A;  2RDG A;  1Q10 A;  3VR8 B;  4C80 A;  1JWS D;  3AED B;  2I2Y A;  1TS2 A;  2MH7 A;  3KLS X;  5E6J A;  4D2K A;  3BYY B;  3AM9 A;  4WAF A;  1C4P A;  4ITK A;  3W1S A;  1T5X D;  1SB3 C;  5BMG A;  1DOX A;  2YEP B;  1CK1 A;  1JWA D;  5LNK 1;  1KRH A;  3ZYY X;  1RM6 C;  2Y5C A;  2IGG A;  3W5V B;  1MI0 A;  1K53 A;  2LGI A;  1TKE A;  3SFE B;  3T3O A;  4HRO A;  1E9M A;  3HVD A;  2WU5 B;  3P4P B;  1WYG A;  5HG2 A;  1B1Z A;  3AEA B;  4ZOH C;  3Q8F A;  3BVZ A;  4OHJ A;  1L6U A;  2IGD A;  5FK9 C;  1ZDV A;  2LUM A;  1FNW A;  3Q8E A;  1DGJ A;  1A70 A;  1OQQ A;  4ZRP A;  1WRI A;  2WXP A;  2WXM A;  1TS3 A;  3BK1 A;  3FC4 A;  4RGO S;  1TY2 A;  1GB4 A;  1ACC A;  3EUB 2;  4YTN B;  2SEB D;  2JSV X;  2YEP F;  1KFY B;  3KWV A;  4RGT A;  1E10 A;  4HKZ E;  3E9S A;  3VRB B;  1PUT A;  1ZXH A;  3LYY A;  2X38 A;  1GB1 A;  1HEZ E;  3BII D;  1E0Z A;  4LTU A;  1MVK A;  4MAC A;  1J7A A;  4YTM B;  3AE1 B;  3WCQ A;  3GB1 A;  1C4C A;  4RNA A;  2DBY A;  1C76 A;  3DWM A;  5JXV A;  1SE2 A;  1XLN A;  1NYR A;  1MHH E;  2EEL A;  2OHF A;  3EGR A;  2VZK B;  2LHE A;  3BK2 A;  3HRD D;  3AB5 A;  4JX1 C;  1V8C A;  3MP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...