1FHTA

Rna-binding domain of the u1a spliceosomal protein u1a117, nmr, 43 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
b'AVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Solution structure of the N-terminal RNP domain of U1A protein: the role of C-terminal residues in structure stability and RNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fhtA00
3UCGA 2MZ1A 2E5HA 3D2WA 3H2VE 2J0SD 1X5SA 2PEHA 3N9UC 3SXLA 2L41A 1WTBA 4YOEA 2M7SA 2YTCA 4C0OC 2FC8A 1P1TA 1M5VC 4W92B 3G8TA 3I56S 1W2BR 5GMKa 2FY1A 1M1KT 1WG5A 2F9JA 1UFWA 3CCUS 4IO9Q 2CPEA 3IRWP 5GAGU 3CPWR 2BOPA 1UW4A 4WKRA 1X4AA 2CQPA 3TYTA 2RQ4A 5CXTA 1D9AA 2M70A 2O3DA 2D3OR 1KC8T 1QM9A 1R8HA 1DBDA 3G96A 1FT8A 2CQGA 5H1SV 2DNMA 2N3OA 2MQLA 3S8SA 1FNXH 2DIVA 3VAIA 5EN1A 1IQTA 2MQNA 2AYGA 2MB0B 2DO4A 4CH0S 2MKJA 2B0GA 1CVJA 2MPUA 1WI8A 2QFJA 5DDRC 1FXLA 1HA1A 1JMTA 1WEXA 4C7QA 2QEXS 1JJ2R 2D9PA 1WG4A 1ZZFA 2CQ2A 1SJ3P 2J0QD 2N3LA 3CUNA 2LECA 2MZJA 5GAHU 2M52A 1U1MA 5LJ3Y 1A7GE 1U1PA 3CCVS 2EK1A 1M5PC 5BJRA 1BY9A 3CULA 2XS5A 3MD1A 1VQ5S 4LJMA 1OO0B 2XNRA 2RS2A 2U2FA 2XS2A 2GHPA 5D77A 2LEAA 3US5A 2DHSA 5DDPC 3LQVA 3J7ZT 1VQMS 1VC6A 3RW7A 2ERRA 2KI2A 1U6BA 4ED5A 2VONA 1HD0A 2NLWA 2CPJA 2E5IA 3CCRS 5IM0A 5HO4A 2DGWA 1DRZA 1KOHA 1DZ5A 1NJIT 2VODA 2LEBA 3S01A 3P3DA 4WFBQ 3HI9A 1NO8A 2L9WA 2CQBA 4CH1A 2E5JA 2DNZA 2DHGA 2DGXA 1WELA 2DNHA 5DDQC 2K3KA 2KVIA 1FJEB 3SDEB 3NNCA 2M2BA 2ZJPQ 3CF5Q 2JRSA 2DGSA 2HZCA 5LSOA 2KG1A 2A3JA 2JVOA 1VQPS 1FJCA 4QQBA 3S6EA 1NU4A 2OTLS 3CC2S 1VQOS 2DNPA 3MUVP 2HGLA 2BZ2A 2L08A 2XNQA 1Q7YT 2CQCA 3HHNB 3S7RA 3PIPQ 2MSSA 1FHTA 3H2UB 3CC7S 2MSTA 1X5PA 5LJ5Y 4UY8T 3U1MA 3IWNC 1WHYA 3P5TL 1K73T 2K8GA 2J8AA 1OPIA 2CQ4A 1R8PA 5JVHQ 3FEYB 3R1HA 2MJNA 1VQLS 3VF0B 1VC0A 3THTA 2JX2A 1N52B 2DNQA 2CPIA 5CYJA 3J7YU 4EGLA 2OSRA 2N82B 3B4DA 1KQSR 3CTRA 2MZTA 2DB1A 3MOJB 4PRFA 5HL7Q 2KN4A 3DXBA 4U67Q 1B7FA 2MKSA 1WG1A 1X4EA 2LQ5A 4F25A 2MXYA 1U1NA 4CIOA 5DETA 3VAKA 2CPFA 1KOOA 4QU6A 3BS9A 1VQ9S 1URNA 1X5TA 2I38A 1U6FA 2KHCA 2LXUA 2GO9A 2DH9A 3MXHP 2HYIB 2J76E 1S79A 2NZ4A 3K0JA 2DGTA 3EGNA 2LKZA 5GVQA 3MURP 2YKAA 2DGQA 1OWXA 4WF9Q 5DDOC 1VQKS 1YWXA 1X4CA 1U1RA 1RKJA 5CA5A 3CCSS 1UAWA 1L3KA 2M4MA 1VC5A 2DGOA 3VALA 4TLQA 2DISA 4W90B 5DM6Q 4UQTA 1X4BA 3SMZA 1X5OA 2CPDA 2MQPA 4WFAQ 2CQDA 3UD3P 3SDEA 2CQ3A 4TU9A 4PR6A 2QA4S 4TU7A 1YITS 3EGZA 1F9FA 2MY8A 4IOAQ 1JJ4A 5GAEU 1N88A 2MHNA 3UWTA 1N8RT 2KH9A 2EVZA 3MDFA 2MKCA 1YHQS 2CQ0A 2N7CA 2YH1A 4FXVA 5MLCV 2CJKA 2KXNB 1H2TZ 4LMZA 3THPA 4LIRA 3DLLQ 4IUFA 4ZKAA 5FJ4A 1SJQA 4J5OA 2AD9A 3MUTP 1N54B 1U1KA 2XSFA 3P6YC 3CD6S 5JVGQ 2MJUA 1X4HA 3ZZZA 2KT5A 3V4MA 3P49B 1ZZNA 1Q82T 1VQ7S 2VOOA 2MGZB 4M5DB 2DHAA 1OIAA 2M8DB 2LCWA 1M90T 2HVZA 1RK8A 5IQQA 2D9OA 1WEYA 1SJFA 4OZ1A 1H2UX 3CC4S 1X0FA 2F3JA 3RW6A 2KXFA 3G9CA 3MD3A 3BO2A 3G4SS 1FJ7A 3VAMA 3VAJA 5D78A 2RNEA 1QVFR 2SXLA 1H2VZ 2MKHA 1VQ6S 3CCES 1WEZA 2LA4A 2OSQA 3BO3A 2ADBA 2G0CA 2X1BA 3U1LA 2CPXA 2CPZA 3JB9k 2DH8A 1YJNS 1WWHA 2CPYA 4ERDA 2FC9A 3MUMP 2KXHA 1U1LA 4CQ1A 2X1GA 2MKIA 3CMAS 2RRAA 1WF0A 2DNKA 2CPHA 2OIHA 1WI6A 2FHOB 2FPHX 1K9MT 2KRBA 1D8ZA 3UCUP 2DNOA 1PO6A 2RQCA 4Z2XA 1WHWA 3CCLS 2VOPA 2DNLA 2U1AA 3VAGA 2DO0A 2DHXA 2DK2A 2RS8A 1SXLA 3G6ES 1HL6A 3G8SA 2G4BA 2PE8A 4FXWA 2F9DA 1ZH5A 2OJ3A 5LSLA 2DGUA 2DH7A 2KM8B 4QPTA 2MZSA 4IOCQ 3BEGB 1U1QA 2KYXA 1WF1A 3TO8A 2DITA 4F26A 2KM8C 1SJRA 3MI7X 3UD4P 1YJWS 1A9NB 2E5GA 3PIOQ 2DNNA 4P6QA 1VQ8S 3Q2TC 2DNRA 2KG0A 3R27A 1UP1A 2Q79A 1K8AT 4BS2A 2CQIA 2ZJRQ 2X1FA 3NS6A 2LMIA 4YUDA 3UE2A 3LPYA 3NNAA 1SJ4P 2JWNA 3CCJS 2DIUA 2DNGA 2ADCA 2KU7A 2MGZA 3CMES 1WHVA 4PKDB 1VBXA 1HD1A 3TP2A 4F02A 2YH0A 2AYMA 1DHMA 1U2FA 4RU2A 3ULHA 1VQNS 4TU8A 1JJHA 2CQ1A 2M0GB 2MYFA 1YJ9S 2I2YA 2MQOA 2MKKA 2V94A 2LA6A 4WCEQ 3OW2R 1FO1A 3I55S 3BO4A 1KD1T 2CQHA 1M5KC 2RUGA 1X4DA 2HGMA 3NNHA 2X1AA 3R1LA 2HGNA 4Y0FA 1YTYA 3CCMS 5DM7Q 2RT3A 2YWKA 1YI2S 4C4WA 4A8XA 2AYEA 1M5OC 1XN9A 5GADU 2MMYA 1P27B 2LYVA 2JVRA 3VAFA 3UCZP 1VQ4S 1VBYA 2MY7A 2DGVA 3NMRA 4OZ0A 3CCQS 2G1DA 2LXIA 2MZQA 3G71S 5LXRA 1Q86T 2DNYA 2KRRA 3L3CA 1O0PA 1YIJS 1S72S 2RRBA 1X4FA 2UP1A 2RVJA 2XB2D 5LXYA 2OTJS 2EK6A 1VBZA 1X4GA 2XS7A 2MQMA 5IFMA 1PGZA 2M8HA 2ZJQQ 2M9KA 3FEXB 3NS5A 3CXCR 1WHXA 2M88A 1G2EA 4WFNQ 3B4MA 2AYBA 4Y00A 3ZZYA 4QU7A 4YB1P 2MZRA 1WF2A 4WIIA 5ITHA 1QVGR 4V19X 2E44A 1U1OA 1H6KX 2WBRA 3Q2SC 2MQQA 3VAHA 1Q81T 1AUDA 5IM0B 2KFYA 2RU3A 3EX7B
chains in the Genus database with same CATH superfamily
2ABYA 4C0HA 4RNMA 1D09B 2W2PP 3NGUA 3TX8A 1AT1B 1BD6A 3SI8A 1U47A 1M0SA 2AJ0A 2XO7A 4HR2A 2Z56B 4NXNF 3LP0A 5ETMA 3IS9B 4QWEA 3D28A 1CG2A 5D4NA 1Q95G 4I2PA 1N0UA 4C6AA 1FNXH 3VAIA 4WWSA 3M8RA 1PAUB 1SV5B 2HFUA 1WI8A 1F9EB 1PC4A 1Q8KA 1SJ1A 2IYGA 4OLPA 4DFMA 3A12A 4MKAA 3MR2A 5A0YA 3F41A 5HN0A 1KHVA 1RAJA 2BJ9A 4Q5VA 4ZHRB 3LQVA 3MECA 1SVDA 7FD1A 4X62J 1X9WA 4DR3J 3TVKA 2DCLA 1N5VA 1VK8A 4ZLNA 1HNVB 5J2QB 2FVRA 3U1NA 1YDLA 3AHPA 3KLIA 5BYQA 2ZJPQ 3QT6A 2HRYA 4BDPA 2FJVA 1T9UA 2OPSA 1QDUB 4I7FB 2WVCA 3HHNB 2F7VA 4O4GB 2WONA 1X5PA 3J7A1 2IRXA 4EBCA 5EWFA 4Q8EA 2NS1B 4X66F 5E3PA 2HBZB 3GV5B 4DL7A 3FC9A 2BJDA 5EX3A 4FF3A 4JI4F 2QMXA 2UUCJ 1O51A 1NHKL 1QSSA 4NL5A 5KFDA 2AJ2A 3I0RA 3FFIA 1FEEA 1GX6A 2FIUA 4FF2A 3IR7B 3W8GA 1ROFA 1SC6A 2YKMB 3MR6A 1H7XA 3C15B 1U1RA 4WK3A 1GH8A 3NP5A 2J9EA 2DGOA 4USWA 2VD3A 3VALA 2FD2A 5DM6Q 3LA0A 4ICLB 1Q78A 3CJ8A 4GVLA 1IUJA 1MU2B 4GRSA 2UXCF 4RW4B 3D7SB 3AD9C 3U27A 5IS2A 3AJDA 3WX4A 3QFWA 5E0OA 1F2GA 1OS5A 2YH1A 4FXVA 1NDLA 4LIRA 4Z37A 5RUBA 1NSQA 5JVGQ 2POKA 3KLEA 3AFGA 3TQEA 1U25A 3PX4A 3VVUA 2FLPA 2ZVIA 4KE5A 2IPOB 2HVZA 3LGMA 4MIBA 3NG8A 4B3RF 3JQKA 1UWBB 3JTNA 1X9MA 3VAJA 2AEFA 3DYAB 1H2VZ 5HVHA 3H5YA 3VWSA 4OX8A 2G0CA 4KQZA 3A13A 3IO1A 2DH8A 4NA3A 3W2VB 3EWGA 3DN9A 1RHMB 2CPHA 3DLGB 2V63A 1FA0A 1HBOB 3M2RA 4IQMA 3KHGA 2HFZA 3MPWA 1FE4A 3UCUP 3HD2A 1MN9A 4C11B 2IBKA 3MPYA 1VYAA 1RTIA 1Z4UA 3NGRA 2R7SA 1VS3A 1QSYA 1DTQB 2LP4A 4ZJQA 1FXRA 2DH7A 2MZSA 3JXOA 2IAJB 2PMHA 4IQXA 4DSJA 4RR5A 3NCQA 4CZCA 1P8GA 5KFGA 2KG0A 3I5BA 2ILYA 3BJYA 4K7QA 1RT3B 5L8RC 1MWYA 5T41A 4NLSA 4F2RA 3P8BB 4RU2A 1LXJA 2PDAA 2ZUGA 3MAQA 3H20A 3QSIA 4JI5F 1I5OB 2AV5A 2V5HG 3RZAA 1T03B 4E2FB 1YJ7A 3M6XA 3I32A 4Y0FA 1UA0A 2W9CB 4P2MA 2NYHA 4A8XA 2FJDB 1O6XA 1QAIA 1TL4A 5K8MA 2JL9A 1XBWA 5F3ZA 1FXDA 2RD5C 3AJ1A 3GTYX 3KUEA 3R5DA 1HNXJ 3PO5A 2HHPA 5ITHA 2AGQA 1QAYA 3D1QA 1U1OA 1RT1A 1AUDA 1Q16B 5IM0B 3TZZA 1RT4A 4PG4A 2I1RA 1LWFA 3EGWB 4HHHA 4TLRA 4C97A 4I56A 1W2BR 2MHEA 4RNOA 2HQGA 3CGIA 5AJ3J 1T3NA 1KC8T 1BMQB 1RUSA 4PWWA 3C46A 4Y2CA 3FBBA 3OUYA 3QJJA 1M5SA 1X0PA 3KK3A 2W01A 2XMVA 1Q5VA 1JJ2R 3CDAA 2J0QD 3CUNA 4V1Ak 2IM1A 2LFVA 1U1MA 3OXFA 4FKXA 3CT9A 4PYAA 1ELOA 1PBUA 4KIAA 2GQ2A 4HACB 1VI7A 3J7ZT 1VQMS 2ERRA 2VICA 2RUSA 5K5MA 2KHDA 3QZ7A 1QSLA 2ZH6A 1IKXB 3GIMA 3CVKA 4E0DA 4TN2A 2XQCA 5B09A 2LQBA 4ETZA 2VFSA 1RHRB 4R0EA 5D4OA 2HG4A 1NO8A 4CLZA 2DNZA 2QMUB 3I87A 3PR5B 1RZMA 2Z2ZA 2DNHA 1YRXA 1TMJA 2EKYA 2B6AA 4F4XA 3UDLA 1IKVB 4LRDA 1FJCA 4CLWA 5J2NA 1IBKF 4I68A 4N56A 4AL6A 1TL3B 1REGX 2L08A 2BYCA 1KLMB 1SH0A 4LF5J 1FKOB 5LJ5Y 1UEUA 3IWNC 2H65B 1QLNA 4LUBA 5J2PA 2A6OA 2CZ4A 3QT5A 2A2CA 3H7HB 3QT7A 2Q6CA 2CPIA 2OP5A 1S9FA 2HVDA 3B4DA 2ATCB 2KN4A 1SH3A 1TL1A 3D1OA 4CIOA 1MW7A 2NXCA 1LNQA 3Q8PB 2LU2A 2NREA 3GLJA 2KHCA 3DRPA 2Z30B 3MXHP 3GQCA 2ZHAA 3H90A 1KQKA 2JEFA 1GEHA 2WK4A 5DDOC 3PNIA 5DQGA 4UOCA 3J7YI 4AQYF 1TV6B 2MQ8A 4HH1A 4TU9A 2IMOA 2C2OB 3KHRA 1F9FA 1UKUA 2CJ9A 5CD4H 1Z2ZA 4GMKA 1N88A 5GAEU 5B0GA 3CJKB 1S1UB 3NGTA 2D7SA 4C2MA 4NA1A 3M8PA 4USTA 5C24B 4KJIA 2J9DA 4O3PA 1MWZA 4Q43A 2XSFA 1F3FA 3H59A 2BQUA 2MGZB 2DR9A 2YNFB 4NYZA 1IWAA 1H2UX 3KDNA 3ET6A 2W2MP 2NQPA 3KK1A 4TQSA 4JI0J 1FFWB 2E29A 4RLEA 4Q2MA 2J7KA 4PXCA 2XGQA 2DR5A 3ZNUA 3AQPA 1HMVA 3CCLS 4JI6J 3M4XA 3I9V9 3NGKA 2WVFA 1KFDA 5K8NA 2V4JB 3NRBA 4RW7A 2DPIA 4MK7A 4U7UK 1XNRJ 4FF4A 4PQAA 1WF1A 1U09A 4DPUA 5LT5A 5KFQA 3MMAA 1N34F 2W9AA 1U45A 5BR8J 4OFZA 2CIMA 5LL6d 4ZPWR 4J90A 4ZPVR 2ZKUA 1CEZA 1UFLA 1DHMA 1U2FA 3QLHB 2K1RB 5GMEA 3MFIA 4FN5A 1WC3A 2W9BA 2IHR1 1T95A 3PRVA 4I4BA 4DSFA 3GSIA 3K59A 1KD1T 4R0JA 4ANEA 3SCLE 2X1AA 2VV5A 3ZZTA 4EZ6A 2GHVC 3MCSA 3PJWA 3JSYA 3DDNA 3EVWA 2DEIA 3MM6A 2OD4A 2F1FA 5LXRA 3G71S 5E3RA 1E6YB 1I6JA 3I31A 2XHCA 4LF9J 1X4GA 2XS7A 1PGZA 2HHTA 3X1LB 3Q0AA 4ZP8A 4JV2A 5F41A 1QVGR 2HKEA 1H6KX 4LSZB 3VAHA 2CWKA 2XZWA 3ENQA 3A3PB 1G4CA 4OJ3A 2ZM6J 1HPZB 4LR8A 1R7IA 2C3PA 3ENVA 1RBLA 4WZMA 2DXDA 2XG8A 1C4AA 3GPAA 1D9AA 2O3DA 4NI2A 4ZDNA 2HNYA 3ITHB 4ZITA 1QY7A 3QIPA 1K1SA 4JI1J 3SFGA 1KQGB 1JLEA 4C8LA 3RGIA 3O3LA 4C8KA 5DO2A 2QFJA 1ZTTA 5F8HA 4B9TA 1BLUA 3AODA 2EFPA 5KFMA 1ZZFA 5GAHU 3EUNA 5C7PA 3UPFA 1NJZA 2KYZA 5BJRA 5A8KA 2H4WB 3W3SA 4DXLA 2RS2A 2U2FA 4K8RA 3H4BA 4L3NA 5DLGA 2QIFA 4F7VA 5C2GA 5D15A 2OPQA 3QRRA 3IC1A 2JJ4D 2YWWA 5CYQB 4FYXB 1KOHA 2OPPB 1REVA 3HXMA 3BH7B 2KT2A 4CCHA 3DLBA 2FJBB 3GIJA 4K4XA 1R0AB 2HNDA 2EG2A 4DEZA 2KO1A 2A3JA 4WYWA 2R3VA 1Q4RA 2XYHB 3C16B 3M32A 2VPWB 4OHVA 4OJHA 3MEEB 4ZJOA 2XNQA 4CI0B 1VIOA 3MTKA 4C3MA 2J6UA 4DFJA 1PSDA 3DRSB 4DPYA 2MSTA 2VH7A 3IMQJ 3EZ5A 1OPIA 4BC7A 2BABA 2YPZA 1GAOA 2ZH3A 2D1CA 2JEIA 3GP9A 4UQGA 3IN5A 1JLCB 3C66A 3GIKA 3FBCA 3CTRA 3MOJB 5DGAA 1XEZA 3DXBA 4BC9A 4ECUA 4NXNJ 1U1NA 5DETA 1DQ9A 3LW5C 3QPIA 2LXUA 1ZA1B 3UNYA 2GQCA 1RWPB 4ZK7M 4NLUA 1N6QB 4HVZA 1S76D 3OT9A 3MHYA 4JV5F 3FSXA 4TLQA 3RR7A 3R97A 4DPWA 3BV8A 4WFAQ 3UD3P 1NRKA 1TVRA 1YITS 4DX7A 3QNWB 5U47A 2QMWA 3HVTB 3R9LA 2WTFA 1V5VA 2KXNB 1ZS6A 4OZ2A 1HHQA 3IA0A 2ZH8A 2FQQB 3PX6A 4RNHA 4HI1A 4NCBA 1UETA 1EHWA 3AA9A 4DZ6A 5L1JA 1Q82T 2WB4A 4F2SA 5IQQA 3T1YJ 2XLJA 3F44A 1NZAA 2VBXA 2DR8A 3FEZA 1K1QA 3FQLA 1FRXA 3BBCA 4HDHA 2FVCA 1VQ6S 1WKKA 2BJ3A 4F4AA 3BO3A 1HNWF 1VRTB 3PTWA 2CPYA 4L6V3 4LFBF 4K4SA 3LP1B 3TEHB 2BKPA 2DPJA 1XR7A 1D8ZA 3LP2B 2BW7A 3ZZRA 5I3QA 5DQIA 4NEZA 1FTRA 4ZS6A 1DURA 1FDAA 3V81A 4JI4J 2Q6BA 3GV7B 1LWEA 1HL6A 1S49A 3NEKA 2DKOB 5ETRA 2I9SA 1ZH5A 5BXIA 1S1WB 5F8MA 1LKZA 3TO8A 4JYAF 2HIQA 5H9FK 2Q79A 4L74A 2ZBCA 3HD1A 1TAUA 3QAUA 2DIUA 1UWAA 2B4UA 2CJXB 3POTA 4G65A 2VQFF 4TY9A 1CC7A 3MM8B 3HMJG 3NAHA 4L3KA 1Y5LB 1RT6B 4NXMF 1JJHA 1YJ9S 4QPXA 4I1TA 1UVLA 3WQPA 2VF3A 2ZE2A 2C42A 3I55S 5K8PA 2XI3A 3H8YA 5JUMA 5HSPA 2KJVA 2HGMA 4OYXA 2HGNA 2CJQA 2XLKA 3EZOA 4C4WA 3RAMA 2HFSA 2MMYA 1FWPA 2H5IB 1WUUA 2I5JA 2W2NP 1MNEA 2BJ1A 5KFEA 3SQOP 2WRMA 4LRFA 2K7JA 2QX0A 3Q8QB 3BGOP 4MKBA 3OTOF 4X64J 2MQMA 2HFOA 3D3CJ 1ZAXA 1U0HA 3B4MA 2QJ3A 2B4OA 3T3FA 4V19X 1ZYQA 3FCWA 4ECSA 1SL0A 1H73A 3B6BA 4P10A 2V9KA 1I94J 3VV2B 2PC6A 2M7SA 3R6GB 2E9ZA 3FSIA 4AFFA 1P1TA 5T7LB 2VZ9A 2CJAA 4K0KF 1XMQF 4L75A 3R7BB 1D3WA 1FX2A 5GAGU 4AT1B 5ETVA 2RQ4A 3FRZA 2B9WA 4NPOA 3GE9A 1TKXA 3S8SA 2E1PA 2WCXA 3E2EA 3PW5A 5KFHA 2GAGC 4C7QA 5KFOA 2YKPA 3M8QB 3TAMA 4LBIA 2YWEA 2ZHOA 2DHSA 2F4VF 5EHHA 4ID5A 4DUZJ 1K0VA 2VONA 1HD0A 3W65A 5A2QU 4HT7A 5EUHA 2ZOGA 3SSQA 4Y2AA 3FDSA 2L9WA 2YKQA 5HK4A 4KAIA 4CLTA 4IDKA 6AT1B 3CJTA 3WDOA 4XPCA 2DGSA 4U95A 4DUTA 4IG0B 3CC2S 3PHEA 3NCRA 4ILLA 5D6GA 4IKAA 4NLPA 5AXKA 2L48A 3C6TB 3AB4B 1UCNA 1T02A 2YKNA 2F4FA 1C1BB 2OELA 3GIRA 5KFLA 4RU9A 4PRFA 2Z57B 4U67Q 5KFCA 2LQ5A 2HFVA 2DD8S 1X60A 2V69A 2G2YA 3C2PA 2GO9A 5FDLB 1RYSA 1DY3A 2VFTA 2AWZA 3K0JA 4HHUA 2OFHX 4JV0A 1BQMA 2QL5B 4KHRA 1FD2A 5AE1A 2CQ3A 5T14A 4ZVUB 2QA4S 2BQRA 5DG8A 4FBTA 4DL4A 2YWFA 4ED4A 2IYIA 3EZUA 3PRDA 4QIGA 1FFSB 4ANCA 4OJ1A 2AGPA 1ZM3A 2AU0A 2LQ8A 3EPGA 3EM1A 4F8RA 3K57A 2BV3A 4JI2F 2B56A 1VGYA 1FDBA 3SV3A 3RBEA 1HIYA 3SYZA 1MWQA 1VQYA 1R8AA 1SQGA 3S1TA 4M5DB 3T9ZA 4K4VA 4EMDA 1HWIA 1EP4A 2CRLA 1WEYA 1RBAA 1FNMA 3QT8A 2VIHA 4ZIVA 3HHLD 2QV6A 4DQIA 4ECYA 3AB2B 3ZTOA 2VA2A 2OSQA 2OPRA 4KT0C 4NCAA 2XC9A 4RW8B 4D3HA 4X4PA 1WF0A 4X4TA 2B9YA 2VL1A 1RT2A 5DG9A 2HHXA 3WC2A 4M5IA 5HQ8A 3IGNA 4YY3F 1ZPWX 2FB0A 3OR1B 1SUQB 1SXLA 1PYTA 2UZAA 4DWIA 5D0EA 2PE8A 2IVYA 1OY6A 5KT2A 4ECVA 1WSVA 5EGYA 3AJ2A 4X4QA 1IKWB 2KYXA 4NEYA 3LAMA 3DLEB 2E9TA 2UUAF 5F9LA 3L7OA 4AQYJ 4RW6A 2JHEA 4DR1F 4DR6F 3Q8UA 5HBMA 3G6VA 3KJVB 4M5MA 2BDPA 4PAAA 4NOHA 1LWCB 3D0GE 3PACA 4O3QA 1GQEA 7FDRA 2BQ3A 2W2OP 2NPIA 3EDQB 2A6MA 3PM9A 1FTCA 3CEDA 1HFEL 3R5JB 4A4JA 1B99A 2AJ1A 3GU0A 1R31A 1RB0A 4YS2A 2WW4A 5GADU 1CJKB 2XMMA 2R8IA 3PJ9A 1EZZB 4OZ5A 1BQXA 1Y5IB 2JNJA 3HKZD 4UOFA 2HQFA 3PFEA 2XWXA 1CULA 3BGFA 3FCHA 4DV2J 1L3UA 2OTJS 1PBAA 5HAOA 1HHTP 2M8HA 1D9DA 2WVDA 4LVOP 1S1TA 2W7OA 1WF2A 1B4SA 5K14B 3GYNA 4KBIA 1HQEA 1F6TA 2XEXA 3AOAA 2PEHA 2XZTB 4I2QB 4YOEA 2GZOA 4M5NA 4LSNB 4AD6A 5D0HA 3JQMA 5CXTA 1J5OA 1T05B 1R8HA 1UJ5A 3MEGB 3MOZA 4WFYA 3D6HB 2DNMA 2N3OA 4LQ9A 3G8QA 1SL1A 2B9EA 4B3MF 1V5IB 2G1HA 4F4YA 1Y4ZB 3A8IA 1HQUA 1FK9A 2BMBA 5CAAA 3DMJA 5AT1B 4XDCA 2GFFA 1B3TA 1A7GE 4G3IA 4DV1J 1EQ0A 1WTFA 3SQGB 4XPEA 1RWKB 5DDPC 1BXNA 2P5VA 3PHTA 1VC6A 3RW7A 2BANB 4PQUB 3MEDA 1LW0A 2BVZA 4DL3A 2B9XA 3QQCD 1S4FA 4NLVA 3NOCA 3NAIA 4IRKA 4UTGA 2B4PA 4KFBB 2YNGA 4ZIWA 1P1LA 1EB0A 2KG1A 1RA6A 1T7PA 3F0NA 1RA7A 1G7CB 1LEOA 3HVRA 1S1XB 3MUVP 4Q7AA 4NLGA 1JIHA 4GVBA 5D3GA 2MSSA 3H2UB 2FDNA 4IFVB 3QATA 3TUZC 2B4VA 1R8PA 5KFKA 3QO9A 4GKJF 2VFRA 3V6DB 1NEEA 2H4YB 1NDKA 3RAXA 4U6PA 4DL2A 3MAAB 2MXYA 2RQKA 1JLQB 3IFEA 3NWRA 5KG0A 3HFZB 1AFIA 3GJRB 4O3SA 2G2OA 4ZP6A 3MCOA 2JLFA 4DN9A 2HYIB 1RADB 3DI6B 1S79A 3TUIC 1T8EA 4K4UA 2DY1A 1IJFB 4J9RA 2C2EA 3E51A 1HBNA 2JLEA 3BGRB 6FDRA 4ELUA 1HW8A 2Y1RI 5MAOA 4L72B 2P2CB 3EGZA 4IOAQ 3M2UA 4A8QA 2WHOA 5DJBA 2ZWOA 4J9QA 2KH9A 3MDFA 1T9XA 4QCLA 2MKCA 2YX1A 1TTHB 8ATCB 3Q8VA 3DLLQ 4X62F 4DR3F 4J5OA 3HKWA 1IJEB 2AD9A 2BW2A 2ZOMA 1JXLA 1BHNA 1S9EA 2F8EX 2IC3B 2MJUA 3GFXA 2HRTA 3EICA 1UVIA 2VOOA 1FKPB 4EU0A 5G0RA 1SJFA 3ONQA 3KG1A 4DBQA 1FJ7A 1OJ4A 1HBUB 3SIPB 2CPXA 1RWVB 3ZTSA 2GJIA 3D0IE 3H2LA 4RZRA 3EXYA 1OPZA 4JI3J 2D3O1 4PCQA 1FJGF 2VOPA 2U1AA 4USMA 3H98A 3KJFB 2UUCF 2NYIA 5LSLA 2FHKA 2V8PA 4QPTA 1JLAA 1QTMA 4RUBA 5HP1A 2KM8C 3MM7A 2HMIA 2B51A 3ZZOA 2VFUA 4DR7J 2W7AA 4F4WA 2ZJRQ 4RL1A 5FD1A 1FVQA 3Q8RB 3NNAA 3OHBA 2FLLA 3LP0B 2XZDB 1AW0A 4C48A 3F73A 4DX6A 5B0BA 1IWGA 2CG8A 3RBZA 3V6KA 2M0GB 2MKKA 4I2PB 2BR0A 3UVJA 4DV7J 4CO1A 5CHCB 4PEOA 4DFKA 1HKAA 4DR4J 3RB6A 1TMMA 2ROEA 1TFWA 1RWWB 2OKQA 2RT3A 1W2IA 4ZLLA 2LLZA 2EBEA 1PJ5A 1M1HA 2FHJA 3EVOA 1D0EA 2JVRA 4OZ0A 2G1DA 1SC4B 3GFYA 5D4PA 2EK6A 5A0YB 4WP9A 4F3QA 3QGHA 2M9KA 1N56A 3MECB 4EI2A 3GJTB 3TUJC 3MPUB 3J7AN 3RR8A 1HNWJ 2FZCB 5K20B 3V4IA 1S99A 4L76A 4OZLA 2YTCA 1GTHA 1KONA 3PVXA 3KLIB 2FY1A 1V3RA 3RB3A 2FJEB 4O3OA 5E7OB 1RAAB 1YBUA 3CJ0A 4YR2A 2OPSB 3AD7C 3QGPA 3BM7A 1FERA 3KUGA 2WONB 3N6LA 4FZVA 3D1HA 5EN1A 4K5SA 4JYAJ 1UJ4A 3FCVA 3KK2B 1R6YA 2D9PA 1FRMA 3E8OA 4M1KA 2NPFA 1EKRA 4U7CA 2ZNYA 3K2YA 4ZCLA 3CCVS 1M1GA 4WP8A 2J0WA 2FHMA 3KLFA 2VQFJ 3W2WA 3TUPA 4DFPA 3BQ2A 3I0RB 3FFIB 4NXMJ 1LFWA 4LRAA 2RF2A 1RTHA 3E3XA 1P9YA 1F5AA 2VODA 3HI9A 2XBPA 6FD1A 3J81U 2FLNA 4TY8A 3Q83A 2RAQA 2QO3A 4DCJB 4E8UA 5DDQC 2PMZD 2UV8G 3K5MA 4FBUA 4RW9A 2J8SA 1U49A 1HNXF 2CQCA 2EC2A 1TKTA 4P73A 3PIPQ 4DL5A 4WU3A 3LH2S 1C0TA 3C6UA 5KFZA 3FEYB 2ZDPA 2AX1A 3KLEB 1DQAA 3EJMA 1NPRA 4JP8A 3H40A 1NHUA 4YB6A 1LW2A 2VKZG 4K0KJ 3NOGA 1B7FA 4ZPCA 4AYBD 3VAKA 1RXOB 1SC3B 4USVA 4PXBA 4QU6A 1L3VA 5AJ3F 4ELVA 2M3DA 2XMWA 2DXEA 2QGFB 5L1IA 3KLHA 5C25A 2NZ4A 3BSAA 5ETKA 2DGTA 4FDFA 3MURP 4UOGA 2DJWA 3A4TA 4UT4A 2ZWPA 1R89A 2ZH1A 2G2ZA 4ATNA 3SMZA 3SDEA 2GC8A 4O44A 4TU7A 2E7WA 4MJKA 2QL7B 4HYKA 3QZ8A 5EWGA 1WD6A 5LMUF 4DZDA 3MMBA 2F4VJ 1S6PA 3IAM9 3BDEA 5IT9Y 3PCOB 4TXSA 1NAQA 1ZZNA 1DARA 3JTOA 1RQ0A 4ZVTB 3LWLA 1CQNA 3GONA 3SCIE 1CJUA 1JLGA 2HURA 2OEMA 2B8PA 2WZ1A 2ROPA 2R8KA 1WWHA 4B9LA 4ES3A 3EVMA 4X4UA 5KG2A 4X4VA 2XCAA 3J81Y 3PX0A 4KO0A 1C2PA 1KKHA 2ZH4A 1FWKA 3IRXA 3NKYA 3DDKA 2HAFA 4USUA 4N5SA 2KDOA 1HHSA 2XI2A 5CZVA 2IVFB 1RT1B 2RU9A 2DITA 2Z4PA 4LFAF 1X31C 5THWA 2E5GA 5DG7A 1RT4B 5HLFA 2OFGX 2HQDA 1GMUA 1LWFB 1SJ4P 3R2CJ 3T41A 2V2ZA 1IN0A 1WOSA 3L09A 4F02A 2AYMA 5HATA 4EUVA 1NK6A 2R4FA 9ATCB 4TU8A 5IZHA 1D1UA 3OTDA 4NMLA 2MQOA 2GQQA 4LF6F 3OUYB 4OZJA 3EE3A 2IA0A 1RJJA 3KK3B 4JI2J 2MEWA 3HJVA 4KKOB 4B3OA 1YI2S 5L46A 1RISA 2QSFA 2PSZA 2ZHBA 1XMOF 2OLWA 4YR3A 1VBYA 3ISNC 1YBTA 2UU9J 2BX6A 5LXYA 4Y34A 1WHXA 4XK8C 4NCGA 4ZVSB 4JI0F 1K44A 4QU7A 2ZD1A 1FEHA 2B43A 5I3PA 3GCXP 2X3DA 1XK8A 4QIFA 4OI4A 2PFDA 3D6FB 2ZC3A 2P6SA 1R0CB 4JI6F 2B6AB 2JFDA 3CJKA 4WKRA 1CC8A 3HHLA 5J2NB 1C0UA 3BB5A 1IVZA 2HZAA 1XMBA 4RWXA 2AYGA 2M5YA 1VHIA 1NUEA 5J2PB 3AH6A 1HA1A 1WEXA 5BR8F 1U24A 2CQ2A 2DTJA 2YWGA 1BY9A 3GYGA 8RUCA 3OQ2A 1VQ5S 1OO0B 1YRTA 2E66A 1X7VA 3DRPB 4DG1A 4OI2A 1N5YA 3CJSA 4DQQA 1VHFA 3NL0A 5A8RA 5ETPA 1YQHA 2GV1A 4F4ZA 1G3OA 4PWDA 1WORA 3VQTA 1BUXA 3CJ5A 4M63A 2M2BA 3R5BA 1RI7A 1OY9A 2L9DA 1NU4A 3HVWA 2AT1B 2YQ0A 3FMWA 1WOOA 3M8PB 3S7RA 3IBCB 1B0VA 4ECWA 3CD5A 3BBFA 2CQ4A 4ED8A 3TQ1A 4OX9F 2ZM6F 5KFIA 3T9NA 4H4KA 2UXBF 2QYGA 2R2UA 2G0JA 4GKKF 1FRJA 3ET6B 3KK1B 1XJWB 3CE8A 4F0KA 4FPRA 4O0IA 5IT0A 1R8CA 3O8WA 2R2SA 2PGCA 4G1PA 3EXCX 4WF9Q 4S0MA 3VVTA 3QRQA 1CJVA 1IBCB 1Y3JA 2R7UA 1W25A 3M8ZA 1S0MA 1HMVB 1QE1A 4F4KA 4WP3A 1RLCL 4P52A 9RUBA 5SZTA 2RRNA 4ECQA 4LF7F 3JSMB 2MHNA 5BYSA 3A8JA 2RILA 2AQ4A 3SCJE 2H1YA 2ZNZA 5MLCV 4RW7B 4CLKA 1RTDA 3THPA 2X3GA 4RBUA 3LUYA 1UZDA 2ASLA 4ENOA 3MMAB 1SH2A 4P72A 3Q8YA 2C3UA 3W7BA 4ZCMA 3KG4A 3P49B 3M6WA 1RT5A 3I6PA 4EWTA 3G82A 2V6AA 3PG9A 2W9BB 2AGOA 3QMQA 2BXJA 5L1LA 2ALYB 1UMJA 1D9FA 4EYIB 4ERDA 2HHVA 1AFJA 4CO3A 5KFWA 3M8SA 4EYHB 1JQGA 3FUYA 2FHOB 5D0GA 4GKJJ 2KB2A 3VZHA 1PO6A 3MM6B 1QTNB 2PO4A 4X4SA 1JNZB 1C1CA 2IDEA 1S77D 1RWOB 4C8ZA 5KTQA 1VBKA 2C2DA 1U48A 4PXDA 4KTQA 4F26A 2HQ3A 5F3TA 2CJBA 4URSA 4WE1A 2A1BA 2R7TA 1XQIA 4TNOA 5LSRA 1NPKA 2APOA 1Y00A 4PKDB 4DMZA 1VBXA 3QFHA 1DAXA 2YH0A 3H4DA 3ULHA 2QE5A 3WIUA 3BF4A 2HNYB 2VC1A 3QIPB 3HHLC 2OGUA 2V94A 1HR0F 2E7VA 1B0PA 2PI5A 1JLEB 1WC1A 3FK4A 5KT7A 4EK2A 4F50A 3NNHA 3KOAA 1PJ6A 4KGKA 1XN9A 1RAFB 3PW2A 3TVZA 3VAFA 3UCZP 1VQ4S 5D8HB 4IG3A 5A8KB 3AT1B 3T1YF 5IFMA 3FEXB 2OAUA 1T9WA 2YPYA 4R25A 2ZUAA 1B7YB 2AJFE 2OPQB 3R5GA 2AW0A 2VC0A 2W8LA 3JSBA 2MZ1A 1URRA 2CA9A 1REVB 3N9UC 1QUVA 1VIXA 1WTBA 3KMSA 3RU0A 5L9NA 4H4MA 3IR5B 3DGPA 2H5EA 2HNDB 3D6TB 4GC6A 5E3CA 3ILOA 2HVIA 2P9EA 3L4BC 1UW4A 2QLWA 1FJGJ 2CQPA 3M32B 3PW7A 4J9MA 5H9EK 2D3OR 2YY3A 2LQJA 1DBDA 3G6YA 4MK8A 4ECTA 3CCWA 2C2NA 3CJQA 1Z2LA 4XDDA 2MQNA 1IQTA 5JMNA 3K8WA 2B0GA 1CVJA 4NX9A 5DZ6A 4ZLPA 1JMTA 4OHWA 2ZVSA 3TWZA 4XO0A 2A2DA 2YNIA 4CLFA 2M52A 3QJPA 4H4KC 2BE2A 2W1BA 4QZVB 4F0MA 4LJMA 2LEAA 5G4DA 2KI2A 4DV0J 1W26A 5B0AA 2VB6A 2FJXA 4QOTA 1OQ6A 1KVKA 3M9MB 2G0IA 3O5TB 4YB5A 2KZZA 3NNCA 2R7VA 1UZHA 3TAPA 1TVRB 2ZDOA 3W63A 5HMYA 3UR0A 4D3GA 2HNZB 1YK9A 1S1WA 4X64F 3T5LA 2QLJB 4OHYA 1Q7YT 3ZZUA 1H74A 2WVBA 1RAHB 3LGHA 4DHVA 3M2VA 1KP6A 4K2JA 1I94F 1VC0A 1MN7A 2Q66A 1N52B 3GMGA 1HI1A 5IQ6A 4B02A 3OVBA 2BEFA 4OQJA 4JOUA 2DR7A 3IGVA 4IR1A 2YKAA 3BKFA 2ZZNA 3CCSS 2BA9A 1TQLA 3ADAC 4ED6A 4PG6A 4UQTA 1SKSA 1NK0A 1H72C 1HLWA 4PR6A 3I0SA 2KJWA 4FS2A 4OYAA 3NLCA 5CYMA 3MM5A 3V81B 1LWEB 1XNQJ 1AROP 2LXFA 2EVZA 2YNHA 2I6WA 4I6AA 2HHQA 5KFNA 3D6MB 4DUZF 3DRRA 1SJQA 5FJ4A 1NZ8A 1N54B 1FF2A 1F60B 3P6YC 2VG5A 5T7LA 1YZ7A 3IM9A 3OFHA 4CLSA 3MMCA 3POTB 3B78A 2ZZMA 4UY85 2IBOA 2VDIA 4MT1A 3EGVA 1YZ6A 5GMDA 1KTQA 5IWAF 2UVVA 2H51B 4P2SA 2G13A 2ZE2B 2LA4A 1QAJA 1NKCA 4CQ1A 2Y0SD 2XY5A 2JH3A 5B0FA 2OO4A 1K9MT 2I5JB 4Z2XA 5I42A 4J9KA 4CLYA 5H9EJ 4A8MP 3BSOA 3D66A 4B3SF 4OYWA 1FRIA 2WVEA 1U0HB 4K50A 2W8KA 1TUWA 2BRLA 4YEAA 3D5MA 4IOCQ 3RB4A 3BEGB 1F5BA 1SJRA 4Y6IA 3IAS9 3MI7X 4FNIA 4NRUA 1VQ8S 2CQIA 1R0BG 4MIAA 2LVWA 2KU7A 1HWJA 3HHDA 2FGOA 2WAQD 2WB1D 5CH7B 5CZXA 5KAKA 3KLGA 4DLGA 2XYGB 3FZBA 2CNNB 4NZ6A 2FVQA 3GSDA 1S0OA 1TKXB 1H3DA 5LMUJ 4P2FA 3BO4A 3SZ2A 2XMAA 1SBRA 3I4PA 3T5JA 1Y7PA 3N5FA 4ZP9A 2OMOA 4BCAA 2BM1A 2W2QP 5CCLA 4B08A 5DQHA 3CDWA 3TAMB 4YB7A 2UUBJ 3TA1A 4YDDB 2LXIA 2ZBPA 3N0VA 1JLBA 1NNDA 4BHQA 2QLXA 2UP1A 3HSJA 5LMNF 2K2PA 2ZH7A 1TL7A 4PG7A 3ZZYA 4ID5B 4WIIA 2MQQA 1Q81T 4ZA1A 2KFYA 4QWBA 1VK3A 3GB0A 2E7XA 2O01C 1NLKL 1U26A 2IM3A 3PW0A 4IDKB 5D4LA 3I56S 2BM0A 3ZC4A 1GT8A 1HI0P 2M70A 4Y2MA 2H54B 3ILIA 5KG3A 1K47A 3BSNA 2B5JA 1EX8A 3OTEA 2XWYA 2DO4A 2YKNB 4WFXA 3WBZA 4LFAJ 4CO0A 4KPYA 2MPUA 2CVEA 5DDRC 4ID8A 4WTOB 2PA3A 1RHJB 3KUHA 2HPUA 1SJ3P 4GO7X 3UN2A 2MZJA 4CO4A 1XIQA 1LWXA 3FKBA 3KJNB 3RBDA 3PKYA 5ETNA 2BE7D 3M1VA 3CULA 1CS4A 1NDCA 2GHPA 2HBYB 2HVEA 1V9OA 4QYZJ 4LIWA 3W62A 4LF6J 1RDRA 4KH1B 3W5XA 4ES2A 1DZ5A 4N47A 1BQMB 1WSRA 3HP6A 1NCLA 1N36J 4CM2A 3N4WA 4Z7CA 1HARA 1XMOJ 1YJUA 2JVOA 4DV2F 2OTLS 1VQOS 2IJNA 1UEKA 2HIYA 2PA8D 3CJ4A 3THTA 5J1PA 3HZGA 3TARA 1KEKA 3J7YU 1JKHA 1ICEB 1EP4B 3BKUA 1RWNB 5E5NA 1GFWB 4ECRA 2GVZA 4OZ3A 3OTCA 1NKBA 1LQ9A 1IM4A 2OPRB 2HAIA 4OLOA 3PRBA 2XSJA 4LRBA 2OHDA 2NUHA 1BWEA 4K59A 2DGQA 4Q0BA 5DRKA 1HWUA 1NK4A 1SI9A 3DM2A 1DTTA 1TUVA 2QA4G 1RT2B 2COLA 2X51A 3GYXB 1S6UA 2IFXA 4WXWA 1KDNA 1AZSA 4U9RA 2NUUG 2ASJA 1Y5NB 4DV1F 1XC9A 2YKOA 2V50A 4J9VA 3QIDA 2N4DA 2BOAA 1XR5A 5IC6B 4B9VA 4UZBA 2IA6A 1MLAA 3ZZZA 4W4MA 2RDIA 1VQ7S 4RW6B 2M8DB 5HBMB 2QRRA 1RK8A 2ZZTA 1BQNA 5HMXA 4LBPA 3TI0A 2HBRB 1VR6A 2IM0A 1YSJA 3OL7A 4ED1A 4KYZA 1RHKB 2R7WA 3GIIA 4ZVQB 3LGNA 1L5UA 4DCOB 3P45B 4ZP7A 5J1EA 2DRDA 1S6QA 3MM9A 3JB9k 5KFUA 2ZFHA 4JBCA 5KFAA 2L9NA 5ETLA 2ATLA 1GXUA 4ECXA 4OX9J 4QR0A 4IH6A 1CULB 4NLQA 2UXBJ 3K7RA 4GKKJ 2RS8A 3K5NA 4DL6A 3DKDA 1S1TB 3G8SA 3GG0A 3D0HE 1NH8A 3G87A 3IR6B 2KM8B 4C8NA 3VGUA 3K5OA 4FYDA 1R3NA 1RTZA 1HQEB 1FDDA 1DLOA 4YFUA 2J9DE 3QAEA 3BR9A 2UUTA 3LPYA 2Z2MA 4X84A 4OHZA 1APSA 3TP2A 1R43A 4HT5A 1VQNS 1J5OB 4B9MA 4P7VA 5C42A 2CNOB 4LF7J 3BN4A 1FI4A 3Q8SB 4O0NA 2VPYB 3QJLA 3A3OB 4CLUA 2J9CA 2GHWA 1NKEA 1HQUB 1FK9B 1HI8A 3K58A 3DMJB 2C3YA 4NLYA 1JLFA 5KFYA 2AKWB 2KRRA 2OI2A 1G1XA 1O0PA 3R2DJ 2ZJQQ 2DEJA 1I51B 3HM9A 2BJEA 3LWMA 3KG0A 3JQJA 4DI6A 4DU8A 3MEDB 3TZXA 5F8JA 1LW0B 1UPMB 5JXSA 3OSPA 3E01A 5KG1A 2E5HA 4M5HA 2GIFA 2L41A 2HS4A 4FYWB 2FC8A 1YRUA 3HDSA 4OMFG 3IP0A 5GMKa 2YNGB 1VRUA 2AIRB 4HTIA 4ZOSA 1VQSA 4DLEA 3DC2A 4JI3F 3OFGA 3CCUS 5KFXA 4MKYA 2BOPA 1IBMF 3TJ8A 1U8WA 1CJTB 1UPPA 3DLKA 3UQSA 4AXJA 1EARA 4GVBB 1UFKA 1RYRA 5D3GB 4IR9A 2DIVA 3HHKA 2NXEA 3OL6A 1IKYA 3QO9B 4U8YA 2VG6A 1FXLA 3RAQA 3PDNA 4KPCA 4DR7F 2Z8QA 4X2BA 4YMEA 4KHPJ 2Y1LB 4E98A 4ED2A 3B54A 5F0WA 1S7HA 2HQIA 4FP9A 4UUXA 3TZWA 2DRBA 4DDFA 4DV7F 3PZPA 1HR0J 3W9HA 4HEA9 3H25A 2CAJA 2W24A 3CCRS 4IRDA 4DR4F 4CTAA 4NLDA 1ZM9A 2HEKA 4WYLA 3P3DA 3B82A 2CQBA 3MF5A 1HBNB 4ANDA 2GO8A 3QSYB 2CUYA 2DHGA 5ETSA 3IM8A 4RX6A 1FVSA 4C98A 3R5CA 1RLDA 3M2UB 4HTJA 1CSJA 2MDAA 3CIMA 4I67A 3DOLA 3PFOA 1GMWD 2WOMA 4U96A 2JZ5A 1UVNA 1BWVA 2CXEA 1S9EB 2I8EA 2XY6A 3UN3A 3OFFA 2V8VA 4I69A 5G0RB 4B9NA 1NK7A 3KJQB 3BGUA 5I3UA 1WG1A 2MKYA 4IYQA 2R2RA 2IJRA 1ZETA 1URNA 3WIVA 2I38A 1U6FA 3FMBA 3IWXA 2V2VA 2J76E 2BE9B 3EGNA 5GVQA 2YQ1A 4DX8H 3K5PA 4ZCKA 2LQ9A 5CA5A 2ASDA 3NS7B 4Y3CA 2RDJA 1L3KA 3IXQA 1NK8A 3J7Z5 2C28A 2CPDA 2MQPA 5A8WA 3PV8A 2ROGA 3CWJA 2NSCA 2MY8A 2ASYA 1JJ4A 3UD5A 3HK2A 5ETOA 1NHVA 1RU1A 4DR5F 1HW9A 1YHQS 3HO1A 2RMLA 1JLAB 2CJKA 2R7XA 5HP1B 1QD1A 3MM7B 4N77A 2HMIB 4F3OA 4MFBA 2ZKTA 1VMBA 1YJRA 4DR2F 4R5PA 4DSIA 1IBLJ 1VLOA 1Y10A 2LCWA 1KLNA 3HJFA 1RP5A 2V4QA 1X0FA 5L38A 4DN0A 2F8MA 4ZN3A 3ETOA 1D8YA 3MCMA 4KY3A 3UVJB 1RTJA 3CCES 3EDRB 5KG7A 2RJZA 5HMWA 3U1LA 3TA2A 1NJXA 3KK2A 3QGIA 3MUMP 4Y28C 3K17A 2L3MA 1WC0A 3PEHA 4KV8A 4J7CA 4OYIA 2KZMA 3BREA 2DHXA 2DK2A 5KG5A 1CQMA 3PW4A 2XGPA 3NBPA 4IOBA 2EFQA 2EEYA 1U1QA 2HZVA 3N79A 1JNRB 3O44A 1UP1A 3V4IB 4BS2A 4WIQA 1SQFA 1JJCB 3NS6A 2FJAB 2GW8A 4CNYA 3N6MA 4OYOA 1GMVA 4DSLA 1HD1A 4OYBA 3VZIA 3CIZA 4KGZB 1OYEA 1YKWA 3BH6B 2JOQA 4WCEQ 1WC6A 2HS0A 2AHOB 3C14A 2Y0BB 1J5EJ 1X4DA 2DRAA 2HS3A 2JDJA 1PILA 1KN6A 2G9OA 1ZM2A 5DM7Q 3GR1A 2XM3A 2E9RX 3KLVA 2VBYA 2JC1A 3VGTA 4DUYJ 3KLFB 1S72S 3W2WB 1HYSA 3WC0A 2RKIA 4J9LA 2IDLA 2AYBA 3FSYA 3D9BA 4DCPB 5E3AA 5IWAJ 3G6XA 1S57A 2RF2B 5E2QA 1N48A 1RTHB 1T9VA 2QA1A 4HH0A 4RO0A 2VG7A 3RB0A 4TY8B 1N5TA 2YX7A 4NASA 1O8BA 2HLUA 4UW2A 2DHHA 1M1KT 2K7KA 2AJQA 4EBDA 4ZN1A 4RW9B 2QL9B 4IO9Q 3CPWR 3AOBA 4B3SJ 1B64A 2CQGA 1TKTB 2MQLA 3O2IA 1EETB 4TYBA 4CLPA 1C0TB 3C6UB 1UVMA 1RWXB 1X8DA 4V19J 4TQRA 4CYUA 2AZ3A 1LW2B 3BKTA 3CD0A 1WACA 1B70B 4ZVHA 4CM0A 3M7VA 3NCPA 4BLGA 3MTJA 1N5SA 1U2RA 2XNRA 1F2HA 3US5A 3GJQB 3KLHB 4ZPTR 5C25B 1NB7A 4F04B 4YR0A 2XMTA 4KC5A 5HO4A 1T0TV 3BR8A 4HL9A 4J9NA 4X65F 2O66A 3TEGA 1ZM4A 2F63A 2VA3A 4RJVA 3UR3C 4CH1A 2R8GA 2DGXA 3JAMU 3SDEB 1HBMA 2LU1A 4O44B 1NJWA 1F9HA 1T94A 2HZCA 4H4OA 3C3LA 4G6VB 1TK5A 2DXFA 2EFGA 4NLWA 2UU9F 4QQBA 1F5CA 2RB7A 1N33J 5LMNJ 4LR9A 3MMBB 2XMJA 1HNIA 1N5QA 1Q5YA 1S6PB 1Y3KA 2J8AA 3R1HA 4JI7F 2EG1A 3IG1A 5CYJA 5A2QY 4ILRA 2HLTA 1CJUB 2RHSB 1JLGB 1VQ9S 1FDNA 2QT7A 3GCWP 3T1HJ 1TKZA 2RQMA 4WBFA 4KKOA 1CLFA 2LKZA 3PY8A 2QLBB 3TANA 2MLZA 2YVSA 1WDDA 2IIHA 1UAWA 1IXKA 3EMTA 3NGSA 4PUOA 1FFGB 4A8KA 1X4BA 3OLAA 2CQDA 1U02A 4KO0B 4CWBA 2B8QA 1VCTA 1Q7LB 4DV6F 3OTBA 5DLFA 1DFDA 3IRXB 2XCPA 2CQ0A 5F0UA 1KNZA 4USJC 1ACMB 1VLYA 3U02A 4IUFA 4LF1A 4QWCA 2JC0A 1F3VA 2IMWP 5HLFB 3DU6A 1RSCA 5J2MA 2F5GA 4XAKA 1E6VA 4DJBA 1BC6A 2YQ3A 4X4RA 5L1KA 1VOMA 5GAEI 3MGJA 3CC4S 1RABB 3RW6A 3OJUA 2GVDA 1EQMA 2R7OA 5M2UA 2CNLB 4OX7A 3HCXA 4JI8J 2HRUA 2W4PA 5EWEA 2HHSA 2FC9A 1ITPA 4B3OB 3SSSA 1HWKA 4WJBA 2Y1JA 2KRBA 1RCXB 3ETMA 1S9GA 3JAMY 1SKWA 1S5ZA 2V34A 4DV4F 4NCGB 5IV4A 1SKUB 3KYLA 1PAEX 2D3ZA 2PT0A 2ZD1B 1GXTA 1EKSA 1S0NA 1PC5A 5HROA 3LO3A 3DOMA 4IFYA 3BDPA 4NLTA 3CJRA 2X1FA 4ZPAA 2LEPA 2KFZA 1U4BA 2DNGA 2N7YA 1RT7A 4RNFA 3M6UA 4LRCA 2GMJA 3OXGA 2HHWA 2XTJP 2V4RA 2IRUA 3HHLB 2GS8A 2Y8WA 1C0UB 4F0HA 2UVRA 1FCAA 4J9OA 2I2YA 4OI1A 1YJTA 2LA6A 2ALZA 4W98A 2EC0A 3N5BA 4JUZA 1NMEB 2GGPA 3A8EA 3BN7A 4FYVB 1M5OC 4MYTA 4KR0B 3TNVA 1P27B 1T9YA 2VBZA 1MROA 4Y2IA 1TKDA 2MY7A 3NMRA 2JEJA 3W9JA 2DNYA 2RRBA 2RVJA 3TX0A 2UV8A 1S1VA 3W64A 2OD6A 3M30A 3EYZA 5A6PA 2HQCA 4DG1B 1CBKA 4F67A 4R8UA 2E44A 1N5YB 2XYPB 2NCKL 3GFZA 3JYTA 3HULA 4LSLA 1JK9B 1J27A 2Q43A 5A8RB 1N0VC 3SXLA 4PWDB 5IXUA 1U8SA 3TJAA 4I6WA 1JWWA 4URQU 2OH2A 4WTYA 3JSMA 4G1QA 3G96A 4IO1A 2C2KB 3DOKA 3QYYA 4M8LA 1TL5A 3OR2A 2W25A 5IT4A 2RHQB 1NM2A 2VQEF 2AX0A 4OV6A 3BYPA 1U1PA 3P4UB 2XHWA 2DY9A 3T5HA 4QIWD 1TP7A 2XS5A 3DXSX 2I0XA 4J9PA 4CT8A 2ZITA 2JLGA 2ZH2A 4CDIA 1U6ZA 4QJVA 2CPJA 4A8FA 2E5IA 4RPFA 3TZYA 4FYYB 2DGWA 4A8OA 3BBBA 1CJVB 2PI4A 1ZAVA 5GAHI 1QE1B 1WELA 2K3KA 2KVIA 1JX4A 3H42A 4MTPA 2JRSA 3HPOA 1S7IA 3IS9A 2D41A 3T5KA 1TUGB 1Q8IA 4EBEA 3UO0A 1FHTA 1RTDB 3ENWA 3CC7S 1N4LA 2FY8A 3T6BA 2J7WA 2V2KA 3U1MA 3NWGA 3UI3A 4CNZA 1WHYA 3P5TL 4M95A 2D74B 4I0WA 1N32F 1ZAWA 1SV5A 3MEKA 4B3TF 4WU2A 1XWLA 1ULRA 4DV3J 1JB0C 2CKWA 2QSWA 3FGVA 2DB1A 1TU0B 1RT5B 4K4WA 2E1AA 2H3EB 3G82B 4M5KA 4WZQA 2MKSA 4MH8A 3BQ0A 3DRYA 1IBMJ 1YGYA 1K0TA 4ZHRA 1XERA 1UTAA 3O6QA 5E33A 4PABA 3PYFA 1OWXA 2HWIA 4AL5A 1HNVA 3OD2A 5J2QA 4J37A 3ELHA 5K8OA 4B9UA 1T3OA 4OJGA 3PO4A 4W90B 4ALZA 1SQEA 1FNOA 4X4OA 2KVQE 3DDIA 1C1CB 2V67A 4I7FA 2N7CA 4DV0F 4O4GA 1WNEA 2H5JB 3IBWA 3CD6S 1S12A 4WE1B 3V6HA 4FS1A 1IR1A 1MMDA 1OIAA 3Q89A 4ZPDA 4DQSA 5KT5A 1YX2A 4LF4J 5KFTA 4O3RA 3BO2A 3VR1A 3D67A 3N01A 1FD8A 1SIWB 2RNEA 3ZTRA 3I9ZA 1TELA 1SB6A 3D68A 3KWMA 4DOZA 2KT3A 2YKMA 4LBHA 3N28A 2KXHA 1FWLA 1T9TA 3C15A 3PKMA 1MMLA 4K4YA 5F9NA 2FPHX 4JB8B 2DNOA 2RQCA 4ICLA 2ZBIA 1S10A 4IG3B 1MU2A 4JV1A 3UW1A 1OMSA 1WC4A 4RW4A 3G6ES 3W1YC 3CO0P 1GMWA 2PFFB 1FESA 1A9NB 3PIOQ 4NA2A 1U2CA 3AAWB 4WKYA 3ZFVA 4Q2LA 4QIVA 1J2VA 2FHJD 4MKVA 2PD1A 2QZ8A 3R7NB 3UNGC 4H4MB 3DGPB 4BBYA 1WHVA 5BYRA 5HMZA 2VHGA 2HNZA 4MYUA 5F8IA 1NB2A 1UWBA 1XNQF 4ZMMA 3DYAA 1Z1ZA 4DR5J 1FO1A 2GMHA 4QWDA 3CSKA 2RSQA 1M5KC 1NPPA 3W2VA 3DRXA 3GV8B 4ZVPB 3DLGA 1HBOA 4DR2J 2YNIB 1FRLA 3MR5A 5SUHA 2A0FB 4F3MA 4C11A 3CCQS 1YJVA 2BE2B 5KFVA 3H5SA 3DNCA 1DTQA 3OXLA 1PKUA 4GC7A 2O1PA 3CCZA 4YB1P 5LOQA 3HSZA 2IAJA 1UA1A 3GFHA 2D69A 1HNZF 3UCGA 2GIQA 3D2WA 3H2VE 3ISND 2PEBA 4X66J 2EFVA 4OIXA 2FLOA 1RT3A 1M5VC 2VKRA 2AEJA 2R7RA 2GMLA 3SCKE 1WG5A 2HK3A 2F9JA 1S97A 4RUHA 2V9WA 1NSPA 3SV4A 1KVIA 2EFOA 4TKTA 1FT8A 4ZVEA 4J9SA 5DZ7A 5H1SV 5KOWA 2EBGA 4OX6A 1MSWD 1T03A 2O67A 4HDGA 1NDPA 2OMLA 2XLIA 4KGXB 4OYMA 3M2VB 4HI2A 2W9CA 2CADA 2QEXS 3ZTQA 3R7SB 2N3LA 4DSKA 3HFVA 3M2RB 5GAGI 3AA8A 2UXCJ 1QAXA 3MD1A 3VQSA 1RTIB 2XS2A 4EZ9A 2QC3A 2BBEA 3BPSP 4M5LA 3T19A 4L73A 2BKOA 2ACMA 5M2PA 5IM0A 3OLBA 4USIA 5B0DA 1TAQA 3RJMB 2LEBA 4AL7A 7AT1B 1RAEB 2FVPA 2HVHA 3CF5Q 5HVFA 3I0SB 2UUBF 5LSOA 4B3RJ 3PEJA 5CYMB 3MM5B 3S6EA 4O4RA 4DPXA 2Y1IA 3R8YA 4ZCIA 2E5LF 2YNHB 2HGLA 4U8VA 5KFBA 2KTQA 4B17A 3DRRB 1KR4A 4XTTA 2QFIA 2P6TA 1V3ZA 1K73T 2K8GA 2VG5B 3L7UA 4ZVGA 1G6BA 1ZA2B 3J81j 4F36A 3MMCB 4N8NA 2CZVC 4RUCA 1NSKL 1QJHA 4NLXA 4AUKA 5HL7Q 5L9XA 4F25A 2ZH9A 4HACA 5B0CA 1X9SA 3A1YG 4WPAA 4DU7A 4P2XA 3MR7A 4DS4A 2WSCC 1IKXA 3THVA 2DT9A 3FBFA 3OV7A 4LF8F 2QYCA 1Q53A 1VQKS 1X4CA 1Q8LA 3RRHA 4K5RA 4LF2A 4FVMA 5M2RA 4ECZA 3VTIA 3PJXA 3JTPA 2W7PA 4YHHF 5I42B 4NZ7A 1IKVA 2QG9B 4URGA 3NMAA 4JI5J 2CDQA 3UWTA 1N8RT 1BE4A 1TL3A 3ZZ0A 5B7WA 2ACYA 1KLMA 3OBIA 4LMZA 1FKOA 2MTLA 4MK9A 2V0NA 3CD7A 1EIYB 1T11A 4X65J 2CWXA 1N36F 5IC4B 4KB7A 3OPKA 4OHXA 3KLGB 3RRGA 4Q8FA 4FKYA 3G9CA 3GILA 3MD3A 1U0SA 1FKAF 2JEGA 4EEYA 1QVFR 3KNGA 2MKHA 4NYPA 1HQ2A 3SBMA 1OY8A 3H5UA 3R5AA 4OL8A 3HX9A 2RRAA 4NYOA 2FUG9 1RACB 3OSNA 3MR3A 1TV6A 2BJ7A 3D4JA 2NSBA 4JI7J 3BGLA 4DV5F 1JLBB 1SL2A 3TJ9A 2DO0A 2VPXB 2EPIA 3MPDA 1RAGB 2G4BA 1TL7B 1S1UA 5H9FJ 2DGUA 3KMQA 3KKFA 3W61A 4KRWA 4MMOA 5C24A 3I82A 3UD4P 4I6YA 4P6QA 2ILZA 2DNRA 1KWMA 1GX5A 2WSFC 3LAKA 2JWNA 2HWHA 2MGZA 1EAYC 3CMES 4NMXA 2YNFA 4P7TA 2XULA 1OYDA 1TL1B 3R3TA 2XMKA 4DV6J 1R6VA 2B5JB 3VGVA 1YVFA 2PN6A 2V2QA 4PG5A 4K2XA 1RCOB 4C9DA 3HLUA 2R8JA 4TVAB 3JSRA 3KHLA 1UL3A 2DCUB 4FF1A 3DCAA 3WZ0A 4J9UE 1JXEA 2QTWA 2DGVA 4RBVA 2MZQA 3M1VB 1YIJS 1CS4B 1OSCA 4Z7YA 1IBKJ 1IR0A 1RAIB 1GTEA 2V4JA 1V3SA 2MZRA 2DR6A 5CQGA 4Y2KA 3DGVA 5GADI 1NXIA 1NH7A 2ZC4A 3NGDA 3HF5A 1PJ7A 1S6OA 2HHHF 1QUPA 4Q44A 3R6LB 1WDTA 2H48B 4KHMA 2IRYA 4C8YA 1Q8BA 2CPEA 3IRWP 1X4AA 3QLHA 2K1RA 4DV4J 2Y3YA 3CO9A 1UVKA 1O5JA 3W8PA 1LXNA 2ZBQA 2C2MB 2MB0B 3V2UC 5A76A 4ITSA 4OYZA 4A46A 4OI6A 3N6NA 4PPZA 1JKHB 1DQ8A 2EK1A 1E6YA 5L39A 2R2TA 1BGXT 4ETXA 1WOPA 5D77A 3T6JA 3SSRA 2GVZB 1IR2A 3L9ZA 3ISZA 4O3NA 2XSJB 2GNKA 1SKRA 1UW9A 2KL8A 4Q0BB 1LFPA 1DRZA 3DM2B 1DTTB 3S01A 2Z0GA 2JSXA 4N7TA 2W4DA 4C8OA 3LALA 1HPZA 3L7PA 1Q79A 3WX8A 5KT6A 1AZSB 1FJEB 3AQOA 2GAHC 1JXVA 2UVUA 1VQPS 2J6TA 1KBRA 4UZCA 1OSDA 3ITHA 4RNNA 3K5LA 4OI3A 2E1CA 1H38A 1DJ0A 2CZ9A 2DBBA 1RGVA 3DFEA 3VF0B 2FJWA 1GXLA 2YXLA 2N82B 4ED0A 1BQNB 3RRKA 1X4EA 3K8VA 2FGCA 1SC1B 4CO5A 5J1EB 3IWLA 1S6QB 3MM9B 1P9QC 5CYQA 4LT6A 1N34J 1YWXA 2IVMA 3HFKA 1RKJA 2OPPA 4C8MA 5HQMA 2M4MA 1VC5A 1FE0A 1R0AA 2VQEJ 2UXDF 3VHQA 3I5CA 3DHXA 3I5AA 1A6LA 4KHPF 2EKNA 1R27B 1L3TA 4ILMA 3PR4A 3C16A 3FZ2A 2GIRA 3MEEA 4J91A 1RE1B 3P5BP 2FZKB 4NI2B 3VGSA 1H2TZ 4K4ZA 4OI0A 3DRSA 2LDYA 2EXUA 3MUTP 1DLOB 1U1KA 3Q86A 4USHA 4DF4A 3ENAA 2KT5A 3V4MA 1SCJB 4LFCF 1JLCA 3AOCA 1M90T 4WFZA 2CJYB 1CJTA 2D9OA 3LPEA 2E1MC 2HK2A 3HT3A 3ZNJ1 1PYOB 3G4SS 5C42B 2DYAA 1KS2A 3VAMA 2C2ZB 5D78A 2SXLA 3CCTA 1VJQA 4O23A 1UEVA 2X1BA 2CVIA 3MZIA 3LANA 2EWHA 3BYRA 5B08A 3UDVA 3CB4A 2X1GA 2VFVA 1N6QA 1N32J 2DNKA 1H7WA 1MG7A 4B3TJ 1LOUA 2PMWA 1JLFB 5F8GA 2R7QA 4MAKA 3TVYA 3AY0A 2E1RA 1GNKA 1FRKA 2YX4A 3FNNA 4ZJLA 3HT0A 4AE5A 1GK8A 4NZ0A 3HVTA 2OJ3A 5EDWA 1RKIA 5CD4A 3E01B 4H54A 2DNNA 3FBEA 1K8AT 5B0EA 5KT3A 3UE2A 3GWCA 1VRQC 2ADCA 1RWUA 1VRUB 3BSCA 2EFNA 3BZQA 3CJ3A 2NXUA 1ZTWA 4OZNA 4QW8A 4KH0B 4KSEB 3DLKB 1LK5A 2CQ1A 3NY0A 3G86A 3OW2R 2RH3A 3UDCA 1VRTA 2CQHA 4C3LA 1IKYB 2V8HA 3R1LA 1YTYA 2VG6B 3LP1A 3CCMS 4UUWA 2C2RA 4CH7A 2HFNA 2V8DA 2VJVA 3LP2A 1IBLF 3LTOA 2Z2LA 2XB2D 1VBZA 1RAOA 3IBFB 3NS5A 3M8YA 4PXEA 4PPDA 3Q2SC 5K9FA 4CTAB 3AXKA 4QYRA 3TA0A 5A6WA 2J0SD 1X5SA 1TFYA 4P74A 3A8KA 4C0OC 4WK1A 3G8TA 4QBUA 2D3UA 3PYGA 3TRGA 1V6HA 4RBTA 3HSGA 2IJFA 8AT1B 3PYEA 1UFWA 3MM8A 3TYTA 4ED7A 1RT6A 4HKQA 4A8WA 3CMQA 3DOLB 4A47A 3GZ7A 1PYSB 2WOMB 3U7JA 3MMJA 4ER8A 4CH0S 2MKJA 1XR6A 1FX4A 5KFPA 4JV5J 1IQZA 4CO2A 3OJSA 1RHUB 3G2XA 1XTZA 1W7WA 4HHJA 3RG6A 5I3UB 1PIEA 2EI5A 1KFSA 4OV1A 3L95X 2C1EB 1Y11A 1U6BA 5JJBA 1F1BB 4ELTA 1PCAA 3ZZPA 2NLWA 4NLOA 4A8YA 1J5EF 1S48A 2HW3A 5LM7E 1AYEA 1NJIT 4QYZK 4WFBQ 4YQWA 5HJYA 4QW9A 5AXLA 1NSAA 5A8WB 2B3TB 1SIZA 4AXIA 1YLXA 4DUYF 1WKLA 4DSEA 2F40A 3T1AA 3A3NB 2KKHA 4CRJA 4WXOA 1VDHA 1Q1KA 5HJXA 1VFJA 2C3MA 3J80U 4MFBB 5KFRA 5ETTA 3KDOA 4LFBJ 4PYDA 5AE3A 1R8BA 5JVHQ 1HNZJ 4I64A 1VQLS 2V68A 5F8NA 4R5PB 3LOUA 3CDBA 3ZO7A 1RHQB 2DNQA 1OQ3A 2QLFB 4EGLA 2OSRA 3M8QA 4DQRA 1KQSR 2MZTA 4NWBA 1UVJA 5IV3A 3X3UA 2XO6A 4EFAC 1KOOA 3EPIA 3BS9A 4Y65A 1WJ9A 3CDEA 2LDIA 2AEMA 4C3KA 3OVSA 5IT9U 2WBMA 2VJUA 1RTJB 2DH9A 3D54A 4NE9C 1L3SA 4P9SA 1AXQA 2UUWA 5AXNA 3M9OB 2GX8A 5D0RA 1SPBP 2UVWA 4KV8B 2J5AA 2A10A 2B7CB 2OEKA 2DISA 3ZXWA 1X5OA 2F8HA 1EJ7L 4HLBA 4TYAA 2W4CA 3ICLA 1S59A 2R42A 4IG0A 5KG4A 3MAHA 4RUAA 4XIUA 3KXDA 3NBPB 3C6TA 2WSEC 4FPIA 3TOQA 4ZKAA 3AD8C 1RU2A 3QRPA 5KFFA 1WC5A 1C1BA 3HHEA 1YG0A 5DS7A 2AZ1A 3GG1A 3HSDA 1X4HA 1VISA 3HZEA 2CNKB 2DHAA 4OZ1A 3OTOJ 2J0XA 2YBVA 1NBEB 2DVIA 1M5HA 1N33F 2E5LJ 1EETA 2Y8YA 2C22A 5FDLA 2H9ZA 1WEZA 3M6VA 2ADBA 3RBXA 3C14B 2CPZA 1YJNS 2HBQB 4CLLA 2N4CA 3UDEA 1U1LA 3CMAS 2B7BB 1C4CA 2R8HA 4BWJA 3C19A 2ZH5A 3K89A 1XMQJ 1WHWA 4CP5A 3F56A 1HYSB 2RKIB 3NXZA 2IM2A 5KFJA 1TK8A 2CYYA 2BKNA 4BWMA 2VBWA 4GO5X 4KGVB 2XY7A 4ZVOB 4IRCA 2A18A 2GJ2A 2MLXA 3SFUA 3T1HF 4USKA 2RIJA 2NXJA 3QBCA 4G1IA 1YJWS 3J80Y 4LF8J 2VG7B 2LMIA 3GJSB 4YUDA 3SEOA 3V6JA 1Y0HA 4M5DA 1I1GA 2ZOFA 4YHHJ 3O1LA 2P9CA 1RWMB 2Z2YB 4Q45A 5HI7A 3ILJA 2Q3PA 3DLHA 4YN3B 2GA7A 4FVCA 4RW8A 2RUGA 1WKJA 4M5JA 4N8OA 3CDUA 3CNQP 1F0XA 2AYEA 3CJ2A 2K06A 4QR1A 1KSPA 2LYVA 4CYUB 2BACA 1HWLA 2BUNA 2P8IA 1Q86T 1A0OB 3L3CA 1X4FA 2J7UA 3OR1A 4CT9A 4DQPA 1SUQA 3KFWX 1G2EA 3TW0A 4WFNQ 4PWUA 4LREA 1TZ0A 1IM6A 4LF5F 2R9LA 5E3QA 4JI8F 3QGGA 3UFCX 4UF4A 2WW8A 1IKWA 4LQ3A 4YP3A 1S0VA 3EX7B 3D3BJ 4OYPA 3DLEA 5ETQA 5KFSA 2QA2A 4RKUC 4W92B 5DGBA 1HBMB 2NXNA 4PG8A 4H4OB 4DV5J 5IOLA 3KJVA 2IY5B 5AXMA 3W60A 1I3OB 3KNAA 1LWCA 1QM9A 3QWUA 3I96A 1P6TA 1HNIB 2AP6A 3KHHA 3VCDA 2BRKA 2NR0A 1TR0A 1PG5B 1AB8A 5FIIA 2C3OA 2GJFA 2FYXA 4ZPBA 5HQLA 1WG4A 3IG1B 1CJKA 3P96A 2LECA 4ED3A 5LJ3Y 1CPZA 1M5PC 3C8YA 1NK5A 2O5DA 4DPOA 1AUSL 1RBOB 4ZLJA 4A48A 4KGMA 1MMNA 2ZEJA 2ZBRA 1TKZB 5K14A 4ED5A 2OEJA 2CDRB 3KTQA 4A8SA 3PYDA 4N76A 2NZCA 2FZGB 3JS9A 4LVNP 4I2QA 3CW2C 4PUOB 2E5JA 4LSNA 4P75A 1KVJA 3V5RA 5EX0A 5HVGA 2DNPA 3HVAA 2K3IA 1T05A 2BZ2A 3ZTPA 3MEGA 4ZVRB 4UY8T 4NLRA 3RYLA 3W9IA 4NRTA 2MJNA 2Y9HA 5J2MB 2JX2A 1E6VB 3GR0A 4P71A 3M9NB 4YY3J 5CCMA 4M94A 3RTVA 3H0PA 2HHHJ 2AMCB 3OL8A 1B0TA 4YDXA 5J1NA 3SQGA 3BPDA 2GVDB 5F8LA 2CPFA 2Z58B 1KQFB 1X5TA 1UJ6A 5KOXA 1XNRF 4IH5A 2BANA 5C5JA 2HSEB 3I4HX 5KT4A 4PQUA 3OHAA 4K4TA 2AF6A 4B9SA 2FVSA 2UUAJ 1YBAA 4QIEA 1KTVA 4DR1J 4DR6J 4KFBA 5FLXU 3DU5A 1S9GB 4FXDA 2AJ4A 1S1XA 1NK9A 1ZOTA 1NJYA 4N41A 4EO6A 5HROB 2QN6B 4IFVA 3DOMB 1H98A 4IFYB 4ZVFA 3TR5A 3M05A 1LK7A 2X7IA 4DS5A 2KFNA 3V6DA 3Q22A 1Q0NA 1KRPA 3W66A 2VDHA 1RT7B 2XMUA 3MWBA 3FVYA 1S4EA 4LF9F 3UN5A 2VASA 3Q23A 2F3JA 3MAAA 2KXFA 1JLQA 2PIIA 2V8GA 2HWTA 4U7UD 4QWAA 4RWWA 5I4MA 4LR7A 2YWHA 5KG6A 3DI6A 3ILLA 3W5ZA 3DLJA 4UOHA 2MKIA 2Q1LA 2GGPB 4C0BA 2OIHA 1MROB 1WI6A 4DV3F 5C2CA 3BGRA 3FQKA 2DNLA 4EO8A 2CG4A 3B8HA 4DX5A 3VAGA 2VPZB 2P9GA 1S1VB 2JFKA 2RE1A 2VU5A 2CFXA 3OVAA 4JI1F 3M30B 4FXWA 2F9DA 3Q24A 5ADZA 2J6SA 4IH7A 4R8UB 1LV5A 2GCFA 2BJ8A 3OFEA 3JYTB 4PZVA 3RUBL 1FRHA 4LSLB 4B3MJ 3Q2TC 3R27A 5CABA 2IC3A 3M8WA 4MIWA 4DF8A 3PXGa 3TAQA 3CCJS 3MCNA 1FKPA 1KHWA 2MLYA 2FTRA 1U7LA 2UXDJ 4X4NA 4FNHA 4G1QB 2VUGA 1Y9OA 2MYFA 2RDDA 1HBUA 3FRYA 5AE2A 3BQ1A 2HHUA 2F65A 2EW9A 1ZPVA 3WHIA 3DOKB 1AA1B 2YWKA 3OR2B 1VJWA 3AXMA 1H0HB 1TK0A 1ZBTA 3OL9A 4LFCJ 5HANA 3LF0A 4LF4F 4DL0C 5FLXY 3CXCR 3H5XA 2M88A 3MPVA 4ES1A 4Y00A 4M5GA 3QWPA 4DPTA 2WBRA 3W5YA 3MFHA 4QR2A 3FJ2A 5E41A 2OUGA 2RU3A 3DHWC
chains in the Genus database with same CATH topology
3UCGA 2ABYA 4C0HA 2GIQA 4QWBA 2XEXA 4RNMA 3D2WA 3H2VE 2PEHA 3TX8A 1VK3A 3GB0A 4I2QB 1BD6A 3ISND 4YOEA 2E7XA 2O01C 2EFVA 3SI8A 4OIXA 1U26A 1U47A 2FLOA 1RT3A 1M0SA 2IM3A 2AJ0A 3PW0A 1M5VC 2VKRA 2R7RA 4IDKB 5D4LA 3I56S 4LSNB 2XO7A 2GMLA 3SCKE 2BM0A 4NXNF 1WG5A 3LP0A 2F9JA 1S97A 4RUHA 3IS9B 2V9WA 4QWEA 3ZC4A 3SV4A 1KVIA 1GT8A 1HI0P 5CXTA 1J5OA 2EFOA 2M70A 4Y2MA 3D28A 1CG2A 1T05B 4TKTA 5D4NA 1R8HA 5KG3A 3BSNA 1FT8A 1UJ5A 2B5JA 3MEGB 4ZVEA 3MOZA 4J9SA 4I2PA 4WFYA 5H1SV 5KOWA 2DNMA 2EBGA 1N0UA 2N3OA 4OX6A 1FNXH 4LQ9A 1MSWD 3OTEA 2XWYA 3G8QA 3VAIA 1T03A 2DO4A 2YKNB 2O67A 4HDGA 3M8RA 1SL1A 2OMLA 4WFXA 3WBZA 2XLIA 1SV5B 4CO0A 2MPUA 4KPYA 3M2VB 2CVEA 4HI2A 1WI8A 5DDRC 4B3MF 4ID8A 2W9CA 4F4YA 2PA3A 1Y4ZB 1HQUA 1FK9A 2QEXS 3DMJA 4XDCA 2GFFA 1PC4A 2HPUA 1SJ3P 4GO7X 2N3LA 4DSKA 3M2RB 2MZJA 4CO4A 1SJ1A 2IYGA 5GAGI 1A7GE 4G3IA 4OLPA 3AA8A 3RBDA 4DFMA 1QAXA 1WTFA 3PKYA 3M1VA 4MKAA 3MR2A 3CULA 3SQGB 3MD1A 5A0YA 3F41A 5HN0A 1KHVA 3VQSA 1RTIB 4XPEA 1RAJA 2XS2A 2GHPA 4Q5VA 4EZ9A 4ZHRB 5DDPC 2BBEA 3LQVA 2P5VA 3MECA 1V9OA 7FD1A 1VC6A 3RW7A 2BANB 4QYZJ 1X9WA 4LIWA 3T19A 3TVKA 2DCLA 4PQUB 3MEDA 1RDRA 5M2PA 1LW0A 1N5VA 2BVZA 5IM0A 1VK8A 3OLBA 4DL3A 4ES2A 1HNVB 5J2QB 4USIA 2B9XA 5B0DA 4N47A 1DZ5A 1BQMB 1TAQA 2LEBA 3HP6A 1S4FA 2FVRA 3U1NA 4NLVA 4AL7A 3NAIA 4IRKA 3N4WA 2B4PA 4KFBB 2FVPA 2HVHA 1HARA 2YNGA 3AHPA 3KLIA 5BYQA 1YJUA 2ZJPQ 3CF5Q 2HRYA 3I0SB 1P1LA 2UUBF 4BDPA 5LSOA 2KG1A 3PEJA 1RA6A 5CYMB 2JVOA 1T7PA 2FJVA 1RA7A 3MM5B 3S6EA 4O4RA 4DV2F 1G7CB 2Y1IA 2OTLS 3HVRA 4ZCIA 2E5LF 1VQOS 2OPSA 1S1XB 2IJNA 4I7FB 2YNHB 3MUVP 2HGLA 4Q7AA 4NLGA 1JIHA 3HHNB 2F7VA 2MSSA 5KFBA 3H2UB 5D3GA 2KTQA 2FDNA 4IFVB 4O4GB 2WONA 4B17A 1X5PA 3DRRB 1KR4A 3TUZC 3J7A1 2PA8D 2B4VA 2IRXA 4EBCA 2P6TA 5EWFA 1V3ZA 1K73T 2K8GA 4Q8EA 1R8PA 2VG5B 5KFKA 3QO9A 1GH8A 4ZVGA 1G6BA 2NS1B 3CJ4A 3THTA 4GKJF 2VFRA 3V6DB 5J1PA 1NEEA 4X66F 5E3PA 3MMCB 3HZGA 3GV5B 1KEKA 4DL7A 3TARA 4N8NA 2CZVC 3J7YU 4U6PA 3RAXA 4RUCA 4DL2A 1JKHA 1QJHA 4NLXA 4AUKA 5HL7Q 1EP4B 5L9XA 2BJDA 5EX3A 4FF3A 4JI4F 2MXYA 2QMXA 4F25A 2RQKA 1O51A 1JLQB 3IFEA 5E5NA 2ZH9A 1QSSA 4NL5A 5KG0A 3I0RA 5KFDA 4ECRA 1AFIA 5B0CA 3FFIA 1FEEA 1GX6A 2FIUA 3A1YG 1X9SA 4O3SA 4ZP6A 4FF2A 3IR7B 3OTCA 2JLFA 1NKBA 1LQ9A 1IM4A 2OPRB 4DN9A 2HYIB 3DI6B 2HAIA 1S79A 4OLOA 4DS4A 3PRBA 2WSCC 2XSJA 1IKXA 3THVA 1ROFA 1SC6A 2DT9A 2YKMB 3MR6A 3TUIC 1T8EA 2NUHA 3OV7A 4LF8F 1BWEA 2QYCA 4K59A 2DGQA 4Q0BA 4K4UA 1Q53A 5DRKA 1VQKS 1HWUA 1H7XA 1NK4A 1X4CA 1SI9A 3DM2A 1U1RA 1DTTA 1IJFB 1TUVA 4WK3A 2QA4G 1RT2B 2COLA 1Q8LA 2X51A 4J9RA 4K5RA 3GYXB 1S6UA 4FVMA 2IFXA 5M2RA 3NP5A 2J9EA 2DGOA 3VALA 2VD3A 3VTIA 3E51A 4ECZA 2C2EA 3PJXA 2FD2A 4WXWA 5DM6Q 1HBNA 2JLEA 3JTPA 2W7PA 4YHHF 3BGRB 1Q78A 4ICLB 6FDRA 4ELUA 5I42B 1HW8A 2Y1RI 5MAOA 1IUJA 1MU2B 4L72B 4U9RA 2NUUG 2ASJA 1Y5NB 3EGZA 2UXCF 4IOAQ 4NZ7A 4RW4B 4DV1F 1XC9A 3M2UA 2YKOA 4A8QA 1IKVA 2WHOA 5DJBA 4URGA 3NMAA 2CDQA 3U27A 5IS2A 3UWTA 3WX4A 5E0OA 1N8RT 4J9QA 1F2GA 2KH9A 3MDFA 4QCLA 1OS5A 2MKCA 2N4DA 3QIDA 1TL3A 2YX1A 3ZZ0A 2YH1A 4FXVA 5B7WA 2ACYA 1KLMA 3OBIA 4LMZA 3DLLQ 4LIRA 4Z37A 4X62F 1FKOA 4DR3F 4J5OA 3HKWA 1IJEB 1XR5A 2AD9A 2BW2A 4B9VA 4MK9A 2ZOMA 5JVGQ 1S9EA 2F8EX 2IC3B 2MJUA 2V0NA 3CD7A 1JXLA 3GFXA 2IA6A 1UVIA 2POKA 3KLEA 3ZZZA 2RDIA 1U25A 3PX4A 1VQ7S 2VOOA 2FLPA 1FKPB 4RW6B 1N36F 2M8DB 4KB7A 4KE5A 4EU0A 5HBMB 2HVZA 3LGMA 3OPKA 2QRRA 1RK8A 5G0RA 4MIBA 3NG8A 1SJFA 3ONQA 4OHXA 1BQNA 3KLGB 5HMXA 3RRGA 4Q8FA 3TI0A 4B3RF 3G9CA 3KG1A 3GILA 3MD3A 4DBQA 2IM0A 1YSJA 1FJ7A 1UWBB 3JTNA 1X9MA 3VAJA 3OL7A 4ED1A 1FKAF 2R7WA 2JEGA 1HBUB 3GIIA 4EEYA 1QVFR 3DYAB 3KNGA 3LGNA 1H2VZ 2MKHA 1L5UA 3H5YA 3VWSA 4ZP7A 5J1EA 4OX8A 4NYPA 2G0CA 4KQZA 1S6QA 2CPXA 3MM9A 3IO1A 3JB9k 2DH8A 2GJIA 4NA3A 3H5UA 5KFUA 2ZFHA 3D0IE 3H2LA 3W2VB 3R5AA 4OL8A 4JBCA 3HX9A 4RZRA 2RRAA 5KFAA 3DN9A 3EXYA 2CPHA 3DLGB 2L9NA 1FA0A 1HBOB 3M2RA 4NYOA 2ATLA 2FUG9 4IQMA 2HFZA 3OSNA 3KHGA 3MR3A 1GXUA 4ECXA 1TV6A 3MPWA 2NSBA 1FE4A 3UCUP 4C11B 4QR0A 3BGLA 4IH6A 2IBKA 3MPYA 4DV5F 1OPZA 4NLQA 4PCQA 1JLBB 1SL2A 1FJGF 2U1AA 2VOPA 1RTIA 1Z4UA 2DO0A 3H98A 3K7RA 2VPXB 2EPIA 2RS8A 3K5NA 2R7SA 1VS3A 4DL6A 1DTQB 1QSYA 2UUCF 1S1TB 3G8SA 3GG0A 3D0HE 2G4BA 1FXRA 1S1UA 1NH8A 2NYIA 5H9FJ 5LSLA 2DGUA 2DH7A 2FHKA 3KMQA 3IR6B 2KM8B 3KKFA 4QPTA 1JLAA 2MZSA 1QTMA 4KRWA 4C8NA 2IAJB 2PMHA 4MMOA 5C24A 4IQXA 3I82A 3K5OA 4FYDA 4DSJA 5HP1A 3NCQA 1R3NA 2KM8C 3MM7A 2HMIA 2B51A 3UD4P 1HQEB 1FDDA 4I6YA 3ZZOA 2VFUA 1DLOA 4CZCA 1P8GA 4YFUA 2J9DE 4P6QA 2ILZA 2DNRA 3QAEA 5KFGA 2KG0A 2W7AA 4F4WA 3I5BA 1GX5A 2ILYA 2ZJRQ 3BJYA 3BR9A 2WSFC 5FD1A 2UUTA 1FVQA 3LPYA 3LAKA 3Q8RB 3NNAA 1RT3B 2JWNA 2HWHA 3OHBA 2MGZA 2FLLA 5L8RC 2Z2MA 3CMES 1MWYA 5T41A 4X84A