1FJCA

Solution structure of nucleolin rbd2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
b'SHMLEDPCTSKKVRAARTLLAKNLSFNITEDELKEVFEDALEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGGTRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOLIN RBD2
publication title Solution structure of the two N-terminal RNA-binding domains of nucleolin and NMR study of the interaction with its RNA target.
pubmed doi rcsb
source organism Mesocricetus auratus
molecule tags Structural protein
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fjcA00
3R27A 2LQ5A 2KRRA 1D8ZA 2VOPA 3S01A 1DBDA 2MQNA 4LIRA 2RS2A 2CPJA 4WIIA 1X5SA 2AYBA 1N54B 2DNZA 2LXIA 3CD6S 1PO6A 3NMRA 3P3DA 5IM0A 2DGTA 5DDOC 1YJWS 2BZ2A 1YIJS 2LCWA 5DDPC 3EGNA 2KU7A 3EX7B 2E5HA 1WG5A 2DGWA 2N3LA 1U1NA 3MD1A 4PRFA 3UCZP 3S6EA 1QM9A 3CC7S 1VBXA 3JB9k 3UD4P 2GO9A 1W2BR 1SJ3P 3MXHP 2L9WA 3MURP 2DNLA 1FNXH 3SXLA 4QU7A 3CCVS 2DGVA 3D2WA 2X1AA 2MKIA 3Q2SC 3V4MA 2DGOA 1FJ7A 1X4CA 5DETA 1OPIA 1X4HA 1WHXA 1SXLA 1H2UX 2XS7A 3L3CA 2EVZA 2MQQA 1JJ4A 2CPEA 3CCUS 2UP1A 3VAFA 3VAGA 2CPIA 2DIUA 4OZ1A 1OIAA 2DH7A 2J76E 3VAJA 2FPHX 2M88A 1IQTA 4PR6A 3UCUP 1FJEB 4IUFA 3PIOQ 1RK8A 1WEZA 2XS5A 2E5IA 5DM7Q 5IQQA 4RU2A 4U67Q 1S79A 2G0CA 4Z2XA 2DNHA 2VOOA 2CPXA 2ZJQQ 3SDEB 3CUNA 3OW2R 3NNCA 2DHXA 2MJNA 1NO8A 2DHSA 4Y0FA 1U6BA 1DHMA 4W90B 1WF2A 2YWKA 2SXLA 1QVGR 2M8DB 3ZZYA 3BS9A 1VQOS 2XNQA 2YTCA 4TLQA 1FO1A 1YWXA 2KFYA 5LJ5Y 4LMZA 2D9PA 2DHGA 1VQ9S 3U1MA 1U1PA 2CQ2A 2NLWA 2MB0B 2X1FA 2CPZA 2PEHA 1UAWA 3Q2TC 4CQ1A 2OSQA 2E5JA 2MGZB 1VQMS 1OO0B 2EK1A 1M90T 3G71S 2MZJA 5JVGQ 1BY9A 1VQ5S 1SJQA 3CCSS 1WWHA 2KG0A 3B4MA 4UY8T 2FHOB 2F9DA 2RQCA 3I55S 5HO4A 2M0GB 3P5TL 3H2VE 1VC5A 2HGNA 1M1KT 1URNA 1WG4A 1DRZA 1VC6A 2A3JA 1X0FA 1D9AA 5D78A 4LJMA 3CMES 3G8SA 2KI2A 1Q82T 1R8PA 2GHPA 1ZZNA 3RW6A 1K8AT 5JVHQ 2CQ1A 3I56S 2DNQA 2KVIA 1WHYA 2M52A 2DO0A 2DK2A 1U1KA 1AUDA 5LSOA 5IM0B 4QQBA 3TYTA 3CC4S 3MUTP 4WCEQ 2U1AA 2RT3A 2CPYA 2MZTA 1WEYA 3CCJS 2CJKA 3CPWR 2E44A 4F26A 1KOHA 3S7RA 1G2EA 4YOEA 2KM8C 3UCGA 3R1HA 1FT8A 2F3JA 3IWNC 2MQPA 5GAHU 3IRWP 1VQLS 2AYMA 3TO8A 1L3KA 4CH0S 3G4SS 1VQ7S 2JVRA 1K73T 4C4WA 4Y00A 2KG1A 3UD3P 1SJ4P 3THPA 4QPTA 5CA5A 2DB1A 3TP2A 1Q86T 2M4MA 1U1LA 4TU9A 4FXVA 5LSLA 1WHVA 1VBYA 2DNMA 2RU3A 1U1OA 2CPHA 2CQCA 1QVFR 1VQNS 3CCLS 1F9FA 2DH8A 2XNRA 4ZKAA 3DLLQ 4P6QA 2DNOA 2KXNB 2B0GA 2OIHA 2DISA 1HD0A 3VF0B 2MKJA 2OJ3A 1U1RA 1R8HA 5HL7Q 3LPYA 4C0OC 2ADCA 2XS2A 2MQOA 1FHTA 1VC0A 1HA1A 2MXYA 2CQGA 2QA4S 1VQ4S 4ERDA 1KQSR 2HVZA 3CXCR 3VAMA 4WKRA 3NNAA 5GADU 1X4BA 1ZZFA 2LA4A 2JX2A 2MJUA 2I38A 3B4DA 2DGSA 2LYVA 3MI7X 5IFMA 2EK6A 2HYIB 2HZCA 2JRSA 3US5A 3VAKA 2N82B 5D77A 1M5VC 3RW7A 5LXYA 1HD1A 3CTRA 4ED5A 3CCQS 2CQIA 1P1TA 2KHCA 5DM6Q 2L41A 4YB1P 5GAEU 3S8SA 1WI6A 1VQKS 1YI2S 2WBRA 2DNYA 2KXHA 1SJFA 3NS5A 2I2YA 1M5OC 2FC9A 2K8GA 2L08A 3MDFA 2ADBA 4WFBQ 1WELA 2RS8A 2Q79A 2MQMA 2BOPA 4C7QA 2CQDA 1CVJA 4A8XA 2DIVA 3G8TA 1FXLA 1X5PA 2ZJRQ 1H6KX 2YH0A 3R1LA 1U1QA 1SJRA 2DNRA 2RUGA 3ZZZA 3J7YU 2CQPA 1U6FA 3VAHA 2CQ0A 3CF5Q 2G1DA 1N88A 2LXUA 4EGLA 2N3OA 1X4AA 2O3DA 4W92B 2G4BA 1JMTA 1RKJA 2CQBA 2DHAA 1WF0A 3CCMS 2X1GA 2X1BA 2RQ4A 5MLCV 2M8HA 2KN4A 1ZH5A 1WF1A 4IOAQ 1UW4A 2MZQA 4UQTA 2KYXA 1O0PA 4WFAQ 2MSSA 3CC2S 2RRAA 2KH9A 2LECA 2M70A 2OSRA 2J8AA 2MKSA 2DNGA 5CYJA 4TU8A 1WHWA 1M5PC 2F9JA 3G96A 1JJ2R 1WEXA 3P6YC 5EN1A 1XN9A 4CIOA 4QU6A 1NJIT 2KXFA 2LMIA 2K3KA 1B7FA 4WFNQ 2MKKA 2LA6A 2QFJA 2CPDA 1U1MA 5LXRA 1A9NB 2MYFA 2DNPA 2ZJPQ 4J5OA 3CULA 4F25A 2V94A 5FJ4A 1KD1T 1N8RT 2M7SA 2JWNA 3MUVP 2DITA 5BJRA 4CH1A 1P27B 2RNEA 3THTA 5GAGU 2HGLA 4PKDB 2CPFA 3U1LA 2QEXS 3NNHA 1VQ6S 3ULHA 5DDQC 2DGXA 1YJNS 2M2BA 1WTBA 3FEYB 3HI9A 3VALA 1UP1A 2FC8A 2CQ3A 2MQLA 3H2UB 2FY1A 4BS2A 3MOJB 2DNNA 3VAIA 2MHNA 1U2FA 3N9UC 3CCRS 1YJ9S 1KC8T 3HHNB 2NZ4A 3DXBA 3G9CA 2XB2D 3MD3A 4FXWA 3NS6A 2M9KA 2MSTA 4TU7A 2KM8B 3LQVA 4V19X 3K0JA 2MKCA 2JVOA 1YTYA 1VQPS 1YITS 2HGMA 2J0QD 2DGQA 3BO2A 2DNKA 3MUMP 2DH9A 3UE2A 1X4GA 2D9OA 2E5GA 2AYEA 3BO3A 2CQHA 1JJHA 2DO4A 3UWTA 1Q7YT 4F02A 2DGUA 2LKZA 1S72S 2RVJA 5LJ3Y 3SDEA 2KT5A 1H2VZ 3FEXB 1WG1A 2N7CA 1M5KC 5CXTA 2MZRA 3BEGB 5H1SV 2J0SD 1UFWA 2U2FA 1HL6A 3J7ZT 4IO9Q 5GVQA 3BO4A 3SMZA 1DZ5A 1WI8A 1VBZA 2VONA 2MMYA 5ITHA 3G6ES 1N52B 2AYGA 2CQ4A 2MY8A 1X5TA 1H2TZ 2MZSA 1Q81T 1NU4A 2MKHA 2MGZA 1A7GE 3CMAS 3CCES 3P49B 1X4FA 2MY7A 2XSFA 4YUDA 2MZ1A 2VODA 5DDRC 2YH1A 4M5DB 2PE8A 2D3OR 1X4EA 2RRBA 4IOCQ 2OTLS 1OWXA 4WF9Q 1PGZA 2YKAA 1FJCA 2KRBA 2ERRA 1K9MT 5GMKa 1VQ8S 2AD9A 1YHQS 1KOOA 1X5OA 2MPUA 3EGZA 2OTJS 2LEAA 4OZ0A 1X4DA 2LEBA 3PIPQ
chains in the Genus database with same CATH superfamily
3FZ2A 2GIRA 4OI1A 5EWGA 4I7FA 4PG8A 5K14A 2R7TA 2ZC3A 3R6LB 3BYPA 2FGCA 4KAIA 4DBQA 1NK6A 2KU7A 1RA7A 1RYSA 1VRTA 1NH7A 3MD1A 4IDKB 4YR3A 2Z2YB 2A2CA 1XK8A 3UD4P 4BC9A 4AQYF 1QE1A 2FVPA 1T05A 2Y0SD 4OI3A 2ZE2B 4DJBA 3TA0A 3MMAB 2KYZA 1OIAA 1HHQA 2R8IA 2AGPA 1QDUB 3PIOQ 5KFLA 3K17A 2DPJA 2FLLA 1UCNA 2E7VA 2G0CA 3ILIA 2CPXA 1VRUA 2GNKA 5EWEA 3CUNA 1KVIA 4YP3A 4PWUA 1DHMA 4YB5A 1C1CA 1HYSA 2XNQA 2XMVA 4RW4A 2PN6A 1WNEA 2VBXA 3MEKA 3P45B 2NLWA 3H2LA 2AW0A 2CPZA 3MAAB 3Q2TC 1FX2A 2OSQA 3TZXA 1EZZB 3IBFB 3CDUA 4KGMA 2FHOB 1S1XA 5KFXA 2ROGA 4B9LA 1M1KT 2NSCA 3BGFA 4LRAA 2ZH5A 3BN7A 2MKYA 2OD4A 2HFZA 3LPEA 1S7IA 3PO5A 4NLPA 4MK9A 2W2OP 1H72C 3W1YC 3QRPA 2C3UA 4ZCLA 3CC4S 1S9GA 5T7LB 1RT7A 4OIXA 2CJKA 1KLMB 2WW4A 3LP0B 3TEGA 2YNFB 1I3OB 2HBQB 2MQPA 2QMUB 1RWMB 1DTQB 4J9SA 1SVDA 4DUZJ 4NXMF 2RU3A 3Q8UA 3NRBA 2LXFA 1VC0A 5J2PA 1HA1A 4CO4A 2ZH6A 4ED6A 2C2NA 3D1OA 3CXCR 4B9TA 3IS9B 3T6JA 4DR2F 2NZCA 5L1LA 4X4TA 4KTQA 3T6BA 3HD2A 2CQIA 3JTOA 2OPPA 2PIIA 4Z7CA 1YI2S 1TVRA 2FZKB 3MAHA 3C15A 4B3SJ 2OPQB 2Z2LA 1S97A 4CZCA 2Q79A 3LGNA 5HQ8A 2BOPA 3KJVA 3HVTA 4C3KA 4C97A 3G8TA 1X5PA 3OQ2A 1SJRA 3EE3A 3FJ2A 1Q5YA 4U7UK 2CQBA 4GO5X 3UN2A 3C16B 2YKPA 4GKKJ 4ZIWA 3J7YI 5C42B 2LU1A 2MZQA 4M5DA 4QW9A 2GZOA 4U7UD 3KHGA 3W2WA 1VISA 2QRRA 8ATCB 4HACA 1CS4A 4J91A 2RU9A 3CT9A 3CJ4A 5AT1B 1RABB 5J1EA 2K3KA 4ZVOB 3TZYA 1IKYA 2KDOA 3FCWA 4ZHRA 1HNWF 1IKXB 2DY1A 4QYZK 2CWKA 3NGTA 3N4WA 4MK8A 4DU7A 4FS2A 3VGUA 4BLGA 3ADAC 3MEDB 3UO0A 5GAGU 3QJLA 4QIGA 2V2ZA 3KKFA 4RLEA 3DU5A 4RUCA 2ZD1A 1YJNS 3EPGA 4QOTA 3W5YA 2EC0A 2C2DA 4WFYA 1UPPA 4LF5J 4TU7A 3PW7A 3HHEA 2HGMA 3BDEA 4B9NA 2NS1B 2E5GA 2AYEA 3BO3A 4ZVFA 3VVTA 4MIWA 1REVB 2XMUA 4F02A 2KT5A 5H1SV 1O5JA 2UUWA 3NOGA 1SC1B 2VG7B 2ASJA 1C4AA 2VH7A 5B08A 4JI7J 4PG6A 1UA0A 4M5KA 2CDQA 2A6MA 3MM8A 4LF2A 5EUHA 3QLHB 2BJEA 1FRJA 2C2MB 4M5HA 2W9AA 2WRMA 3J7AN 1B4SA 2R9LA 1X5OA 3GU0A 5F8LA 1BC6A 1YX2A 5ETSA 2HQGA 3KLIA 3AOCA 4JV5J 2ZH8A 2ABYA 2AYBA 1GXTA 1EB0A 3SI8A 2KZMA 1RADB 1JIHA 3T5KA 4ZPDA 1JLGB 4B3TF 1C0UB 2W2NP 3TJ9A 4O23A 4WFZA 3PX0A 1FD2A 2HFVA 2FVSA 4S0MA 4JI2J 4DLEA 2GO9A 5A8RB 1RJJA 3AY0A 1EP4A 1RTIA 4QU7A 3CCVS 3HKZD 4P2XA 3DMJB 5DETA 4JI6F 3DLKA 5H9EJ 1RACB 2F1FA 3RBXA 4URGA 1CPZA 3RTVA 1IVZA 5L1KA 2ZNZA 4M5GA 3HHLA 4LFAF 3WX8A 3B78A 2WVFA 3PTWA 2EFNA 3MCNA 4H4MB 1NO8A 4OV1A 4DQIA 2ZZNA 3X1LB 1UA1A 1YWXA 5LJ5Y 3MM9B 2J9CA 4J7CA 3PW4A 2AJQA 4TNOA 2JZ5A 3DOKA 3KK1A 2AEMA 4UY8T 4A47A 2VU5A 4K4TA 3UPFA 2ZKTA 1N5YB 3QT5A 3U7JA 1XC9A 2N4CA 2JEGA 3HHLC 4PAAA 2B7BB 2HHWA 3D3CJ 4ELVA 5B0BA 1CQNA 1DURA 4USTA 4ATNA 2C2OB 4F67A 1F3VA 5L9NA 4FKYA 5F41A 2WB4A 2J6SA 4E8UA 4IRCA 3H5SA 1R6YA 1GQEA 2H5IB 5CA5A 3HKWA 4N77A 2B43A 3MEGA 4QIFA 1HNZJ 1GAOA 3C8YA 3KLGA 3WIUA 2W24A 2IM3A 3DYAA 2EBEA 1SQGA 1VCTA 1HIYA 3NOCA 2MXYA 2JFKA 2ZBPA 1XJWB 4DI6A 3CWJA 2HBZB 2G1HA 3AQOA 4Q7AA 1DJ0A 1KR4A 3V6HA 4JI8J 2HZCA 4MKYA 3D54A 4N5SA 3MAQA 4DFKA 2C1EB 1D1UA 4RKUC 1HHSA 3I6PA 2QJ3A 2GMHA 4A8QA 4ANDA 3Q83A 4DUTA 4MKAA 5A0YB 1IWGA 2GA7A 2V8VA 1IR0A 3CIMA 2V5HG 3L7PA 2FJBB 4NA3A 3UR3C 2ZZTA 4DSLA 2CQDA 3G6XA 4KHPJ 4TLRA 3R1LA 3RBDA 5KFDA 2KFNA 3VAHA 4P9SA 4GC6A 1N88A 2N3OA 4O44A 4JI1F 4JOUA 1HBOB 1NH8A 4ZCMA 3PRBA 4ZA1A 1LXNA 3GCXP 3E01B 2G13A 4F04B 2AJ2A 3NL0A 4BWMA 1SIWB 2JJ4D 4IH5A 3N0VA 4CO1A 3OHAA 3ENVA 3ETMA 4LVOP 2UXCJ 2ILYA 2XZDB 3P4UB 4OZ5A 4YMEA 1N8RT 2BABA 3BPSP 1GH8A 5CABA 2P5VA 2HGLA 3T1AA 5HN0A 2YWHA 3K59A 1WTBA 2FY1A 2W1BA 1HWKA 2Q3PA 1IBKJ 2YKMB 4DG1A 1HARA 4UOGA 1PC5A 2MKCA 2RUSA 3ETOA 4KFBB 5KT7A 3EVWA 1YITS 3HFKA 2FTRA 4ID8A 3LWLA 4OYMA 3Q86A 3GFYA 1EQMA 5IS2A 1SL2A 2B4VA 1Q16B 1NJWA 3E3XA 2J0SD 4ILRA 1T11A 1PJ7A 1XNQF 4X4QA 2EPIA 1X5TA 1Q81T 2NXEA 1YJVA 4ZJOA 1EETB 2ZH2A 3PO4A 4HR2A 4USWA 1RBAA 4IOCQ 2W9BA 2CAJA 3IO1A 5DG9A 2MPUA 2OI2A 2VQEF 2HFNA 2FJVA 3PIPQ 5LMNJ 2KZZA 2E5LF 1DBDA 3G6YA 4WIIA 1X5SA 3NMAA 3NY0A 2HHXA 5DDOC 3C6TB 4ED0A 4DWIA 2VPZB 3IC1A 1U49A 4HKQA 5ETNA 2CWXA 3CC7S 2P2CB 4CT9A 2ROEA 3ET6A 2NR0A 3NS7B 1RAHB 4OX9F 4NLRA 1MLAA 3RR7A 3CJ5A 2MQQA 3D6MB 1RT6A 1RU1A 1IJFB 4PUOB 4MYTA 4EK2A 1IKWB 5MAOA 4PG7A 4LF4J 1KTQA 1FJEB 4UTGA 3LAKA 4EUVA 4P75A 1F6TA 1TUVA 3VHQA 3P8BB 3OTBA 1RT5A 3R2DJ 1S0OA 3ENAA 3GQCA 5ETOA 2EFQA 1V3RA 3RGIA 4P7TA 1HNVA 3SSSA 3GONA 2XSJA 4CO3A 1L3UA 4OFZA 1Z2LA 2KFYA 3MR2A 1XR5A 2VKZG 2PEHA 2W2MP 2BDPA 4NE9C 2MDAA 1RT4B 4DR7F 1B0TA 2J9EA 1NDKA 1PBUA 2R8KA 1FKAF 2KG0A 2KB2A 4WP3A 3LTOA 2ZOGA 4DV2J 4O0IA 5KFKA 2RF2B 4PYDA 3G8SA 2HHSA 1R8PA 1F2HA 2OKQA 4OX6A 1U1KA 2F4VJ 3SQGB 3CDEA 2PEBA 1DQAA 1CSJA 4DR4F 2E44A 2AZ3A 1KOHA 3S7RA 1TAQA 2AKWB 2EXUA 1JLQB 3OVAA 2DBBA 2VQFJ 3UD3P 4FXVA 1F3FA 3CCLS 2WONB 3GE9A 4P6QA 2DISA 2QMWA 3V6KA 2ADCA 2MQOA 4DEZA 1KNZA 5SUHA 2V4JB 3BQ1A 1KFSA 4IG3A 1OSDA 4FN5A 3VAMA 1R0AB 4PQUB 4CLZA 1YVFA 3GB0A 1M5SA 1E6VB 3OVBA 3UQSA 4Q2LA 5E41A 1S10A 4NPOA 4WK1A 3JYTA 2DNYA 2H5JB 2J0XA 4K50A 3W9IA 1NDCA 1FNOA 2L08A 3PM9A 1SL1A 2B8PA 4NLOA 4NMXA 3H7HB 3MM7B 1KEKA 2CZVC 4FBTA 2DIVA 2HLUA 3BN4A 5HBMA 1U7LA 4HL9A 4CLTA 5IV3A 3BREA 3LF0A 4XTTA 3PXGa 2G1DA 4EGLA 3W65A 3WC0A 4DQSA 1WF0A 3NGDA 2X1BA 4ZDNA 1JK9B 4RW6B 2HRYA 4N56A 4XDDA 1IBMJ 1NKEA 1C1BB 4WFAQ 2XI3A 4G1QA 4ZVQB 4QZVB 4Y2KA 2D69A 5HVHA 4ECYA 4BCAA 5KFGA 4RNNA 1R6VA 4RUBA 4NLTA 4I67A 3KG1A 3DI6A 1NHUA 2R3VA 3W7BA 4R5PB 3A4TA 3I4PA 1XNRJ 4DFMA 2JH3A 4KR0B 2HRTA 3HT3A 1GFWB 4USIA 4DV7F 2FLNA 2A10A 1JB0C 1ZM2A 2DGXA 3C3LA 4FNHA 3VALA 2YNHB 4BS2A 3W5XA 1TKTB 5IT9Y 1KC8T 3HHNB 1SIZA 3G9CA 4B9UA 1JXEA 2VL1A 1B64A 3GFZA 3AJ1A 1T7PA 3GSIA 1YKWA 2IA0A 3MMBB 3HO1A 2CQHA 2VG6A 1IWAA 5DLGA 4CYUA 1PAUB 5LJ3Y 3OUYA 2YPZA 4RW8B 5T41A 1QTMA 3IM8A 3TWZA 1F2GA 1O6XA 2W7AA 4ER8A 2C2EA 3BBBA 5LL6d 2GAGC 4K8RA 4NI2A 4AYBD 1S6OA 3KDOA 2NPFA 4FF2A 3K7RA 4LBHA 1I1GA 9ATCB 2XCPA 3TQEA 3D68A 1RT3B 2ZOFA 4ILLA 1IM6A 5AXNA 1H7XA 2HAIA 2BJ3A 1W7WA 3SSRA 2UXDJ 3TRGA 3TVZA 2GHWA 2CG8A 1ZM9A 4DS5A 2D3ZA 1N6QA 2EBGA 3OR1A 4QR0A 3LOUA 5C24A 2LXIA 3KLEA 3SYZA 1WDDA 2BBEA 2ZH3A 3OFFA 4HEA9 1JLAA 5KG6A 2WZ1A 3CIZA 2N3LA 1KWMA 4WIQA 2CZ9A 3LWMA 3UCZP 1QM9A 2GJFA 4OI6A 2JEFA 2X1AA 3G6VA 2GC8A 3CSKA 1LWEA 4RBVA 2EVZA 2DR7A 3CJTA 3BH6B 2BR0A 3OTEA 3O3LA 1AT1B 3MM5B 3G82B 5L38A 1O8BA 1WC5A 4OZ2A 2FPHX 5ETTA 4I68A 2EFPA 2DRDA 3T1HJ 2RHSB 1FWPA 1X8DA 3LAMA 4KHMA 2GQ2A 2DHXA 2MHEA 2CKWA 2C22A 5H9FJ 5HLFB 1RTHB 1U45A 3MECB 1FFWB 3F56A 4DSKA 1AXQA 4ZITA 3TUZC 2B9YA 1IM4A 3GV7B 1FO1A 2D9PA 2R2SA 4CQ1A 4ZN1A 2HNDB 4PXBA 2XYGB 1S4EA 2Z56B 3CCSS 1WWHA 3L95X 3KFWX 3ZZPA 1VIOA 3P5TL 2B6AB 2YQ1A 4GKJJ 1D9DA 1J5OA 1NNDA 3AXKA 2KI2A 2W7OA 2XMMA 2XHCA 2DK2A 1KN6A 4NLUA 1RWPB 3J81j 4J9VA 4OX7A 2C42A 4FPIA 2JDJA 1CJVB 4LF1A 1R89A 2E7XA 2AYMA 2FVRA 4K2JA 2C3MA 1DTQA 5B0GA 4D3HA 2OELA 1T3OA 1X60A 2YQ3A 2XNRA 2ZBIA 4M5MA 5DQIA 2MKJA 1PYSB 5HL7Q 1HNIA 3LGMA 1S1UB 4CLYA 2HHQA 1WDTA 2QA4S 3OLBA 4DV3J 3RBEA 2UUBJ 1ZZFA 3N28A 1Q95G 2R8HA 1GTHA 3KLHB 3JAMY 2GQQA 2B51A 3L7OA 2VKRA 4MYUA 4I6AA 4DUZF 3AD7C 1KKHA 5AJ3F 4ALZA 3R7NB 2FC9A 1Z4UA 2ADBA 2HHUA 3PX6A 3ILOA 1LOUA 4TQSA 4ES1A 3GIKA 3KG0A 1OYDA 1SC6A 2AP6A 5K8OA 4Y2AA 3GJSB 3EGWB 1FXLA 2E9RX 3QPIA 4DF8A 3I0RB 2BEFA 2WHOA 1UWBB 1NK9A 5CZXA 2AJ4A 2GV1A 2X7IA 2ZH1A 4A8YA 2QX0A 4ECVA 3THVA 4WXWA 2XY7A 1YJRA 5EGYA 1N32J 4IO1A 1Z1ZA 1FKPB 2ASLA 3SCKE 3RJMB 3RR8A 1PC4A 2K7JA 4O3OA 2KYXA 5BYSA 4KB7A 4B3MJ 2LQJA 1SPBP 1YZ6A 1C0TB 1FK9B 1U8SA 4YS2A 3OL9A 2OPSB 3DRSB 5CYJA 2YNGA 3LP2A 2CNKB 1M5PC 3G86A 3VVUA 4U9RA 5K5MA 4OHXA 1WC4A 1NJIT 4B3SF 2BQUA 3PACA 1MROA 2HKEA 2BE9B 3MTJA 3M2VB 3KK3A 1IKXA 4JI5F 3FEZA 1HQUA 4WE1B 3FBBA 4LVNP 3LO3A 3ICLA 2HEKA 4DPUA 4QYZJ 3VZHA 2W4CA 1XBWA 4PKDB 1HQEA 1ZM4A 4IQXA 2BE7D 4OZLA 4ELTA 4Y34A 3N9UC 1N56A 2NZ4A 3DXBA 4ZVTB 2Z2MA 4LSNB 1RA6A 4C8LA 2DO4A 1LW2A 2VPYB 1REVA 1XMOJ 3BGRB 1S59A 4U96A 2A0FB 5CXTA 2ASYA 3BEGB 1I94J 2FHJD 1SC4B 4K4VA 1VBZA 3W62A 3BKUA 4OHYA 3DRXA 4TN2A 3C14A 1N52B 2CVIA 3P49B 2VV5A 2XSFA 5ETLA 2XI2A 1UKUA 4I1TA 1CC8A 2QLBB 2YKAA 2KRBA 4LF5F 3D4JA 4PZVA 2IAJA 2IRXA 3OFGA 3M9MB 5FDLA 3KYLA 1LW0B 4DXLA 2RAQA 3JS9A 3BJYA 4I2PB 2HFSA 2HK3A 5B0FA 3M8PA 1PO6A 2EG1A 3EGNA 5L8RC 1JLGA 5CCLA 2DEIA 3TAMA 1Y11A 1P9QC 4CCHA 3HHLD 2W25A 4DV5J 1FRKA 2XMKA 2CJYB 3IP0A 3D2WA 2JFDA 4G6VB 1LWFA 2IHR1 2DGOA 4ED2A 4JUZA 3DMJA 1H2UX 3DOLB 4MKVA 3Q8VA 3MCOA 3PG9A 2VFSA 1Y5LB 3TZZA 2ZHAA 2QIFA 1T0TV 4EYIB 3N5FA 3OTOJ 2GVDB 2AJ0A 3ZZRA 1RK8A 4JV5F 3RAMA 4HT5A 5IQQA 2DRBA 1FKOA 1M1GA 3NNCA 2MJNA 5IXUA 1DQ9A 3QGHA 5KFJA 4C8NA 1WF2A 2XYPB 3DNCA 2AF6A 4JI2F 5D15A 2XZTB 2MB0B 4E98A 1NHKL 3GJQB 1K1SA 1UL3A 1YBUA 3A3OB 2BXJA 2J7UA 2AZ1A 1QAIA 3MMJA 1LV5A 2G2YA 5KG3A 3IA0A 3KK2B 1DRZA 5D78A 1OY9A 3G8QA 2K1RA 3KOAA 1X0PA 3R2CJ 2XULA 3C2PA 4PCQA 4ZVEA 4DZ6A 4F50A 5CHCB 4RPFA 4IH7A 3CPWR 2F5GA 2R7WA 2ZNYA 3UCGA 2JSXA 4CT8A 2E66A 4KGZB 2EW9A 3GZ7A 2IVFB 1J2VA 1S0MA 4PWDA 1H7WA 3NP5A 1TTHB 2CQCA 1QVFR 3D66A 3DLBA 2PGCA 2ROPA 3DHXA 2GVZA 2R42A 1RWXB 5CYQB 4B17A 1VK8A 4ZVSB 1V5VA 3GPAA 3PNIA 2BQRA 2XGQA 2DR6A 1S4FA 2V2VA 1RT2A 2OP5A 2QYCA 1RTDA 1HW9A 1M5HA 3U27A 2IMWP 3D6TB 5KFNA 2PD1A 3M9OB 3MDFA 3QAUA 4DUYJ 1HNZF 4R8UA 2MQMA 2FJXA 2IM0A 3PX4A 1URRA 3HMJG 4A8KA 4BBYA 2Y1JA 3MEEA 3W8GA 3R5DA 1TL3B 1XTZA 1JMTA 1RKJA 4Y2IA 5J2MA 5HATA 5E3RA 1ZH5A 4OV6A 1UMJA 5HVGA 4J9RA 3BR8A 4N8NA 1L5UA 2P9EA 1Y3JA 2HZVA 3R5AA 5ETMA 4QU6A 1GX5A 1RQ0A 5C25B 3M8WA 4Q8FA 1A9NB 2R2UA 3H90A 1IN0A 1JLFA 3HF5A 1Q4RA 5IT9U 5FJ4A 2HQFA 4K4ZA 2OLWA 2GJIA 1GMVA 3KHHA 5DDQC 3CJSA 4OYIA 4GVBB 1IJEB 2CDRB 4Y65A 5I3UB 1AZSA 3H5YA 2J0QD 2DGQA 1FTCA 1VFJA 3RG6A 4ED8A 3UE2A 2DR8A 2I0XA 3PKYA 4ZPWR 2UXCF 3SDEA 1VK3A 1GMUA 5CD4H 2MZRA 1UFWA 4DR6F 3J7ZT 5GVQA 1OS5A 2Y8YA 4IG0A 2UXBJ 4EZ9A 1H2TZ 2GS8A 2MKHA 1A7GE 3CCES 3K5PA 1TUGB 5EX3A 2MZ1A 1HBNB 2VODA 2YH1A 5C2GA 2LQ9A 2P6TA 2NSBA 2V8DA 2AD9A 1YHQS 1MU2A 1X4DA 1MWYA 2HNYB 4LREA 1TV6B 1FF2A 4NX9A 1CULB 1S49A 3ZFVA 2CPJA 2W8LA 3POTB 2DNZA 3R5JB 2GIFA 2WSFC 3GJRB 1G1XA 3HFZB 2LCWA 2ZHBA 3AXMA 4I69A 4HI1A 4PG4A 4DCPB 2NCKL 4A8WA 3ENWA 4KIAA 1VBXA 3MXHP 2L9WA 4ZP9A 2KJVA 2F8EX 2GCFA 3Q0AA 1WHXA 2WAQD 3IRXB 1R27B 2XS7A 2L9NA 1ACMB 3T5JA 2DIUA 2VA3A 5LMNF 3AHPA 2DPIA 2X3DA 1RCXB 3N5BA 1IQTA 1BHNA 5DM7Q 1RXOB 1IR1A 1BWVA 4KV8B 2J7WA 1U6BA 4RNFA 1D0EA 4X65J 1RHQB 4IFVB 3C6UA 2BW2A 1PYTA 4TXSA 3GFHA 4URSA 2QSWA 2HQ3A 1CJKA 3C66A 3R97A 3IG1B 1SCJB 1IBLF 1SV5B 2F9DA 3I55S 2BMBA 1FDAA 4LF4F 3JSMB 2XG8A 4FF3A 4PG5A 1NLKL 3D5MA 1AUDA 2UVUA 3NGRA 4FYYB 4C48A 1WOPA 2U1AA 2NYHA 3RUBL 1GEHA 1G7CB 1RE1B 2D41A 4FYWB 1JJCB 5J2NB 1VQLS 1L3KA 2BKNA 1VQ7S 5KFTA 4W98A 3DRRB 3CDBA 3I31A 1WHVA 1PYOB 1UVIA 1VQYA 3DM2B 2GO8A 4MFBB 2A2DA 2KXNB 1R8HA 2RILA 5ETKA 4DV2F 2EEYA 4LF9F 3NLCA 4XDCA 4HTIA 5A6WA 3JAMU 1JLEA 1BQNA 2OPRB 1NB2A 2DGSA 2F4VF 2LYVA 2ZWOA 4HVZA 3US5A 1XR6A 2FY8A 4ZIVA 1R8AA 1XIQA 1QSSA 2QV6A 3E51A 2VQFF 2HAFA 1HMVA 1RTJA 5KT6A 3NCQA 4ILMA 2H9ZA 3HVAA 4Q2MA 2K8GA 1Y0HA 3BDPA 3FSYA 1S6QA 5AXMA 1OQ3A 4FVCA 1UJ4A 3R7BB 2PC6A 2JLFA 3MM7A 4C6AA 3V6JA 1H6KX 2YH0A 3AFGA 4GC7A 1N5TA 4F4YA 3OFHA 1N0UA 4W92B 2XLIA 3M2UB 1TUWA 2HBYB 5U47A 4OHZA 3CE8A 4FKXA 2ZUAA 3T5HA 2LQ8A 3KXDA 2F65A 4KQZA 5D3GB 3HK2A 1S9FA 3T9ZA 2H1YA 2V50A 2NYIA 2D7SA 2ZOMA 2LA6A 1S48A 2ZJPQ 5ETQA 2B56A 4NCBA 4DSIA 3CULA 2O1PA 4F3OA 1YSJA 4R5PA 4CNYA 1JXLA 1SUQA 3QGGA 3ITHB 4CH1A 4P52A 1P27B 1YJUA 3ZZUA 1P9YA 2QEXS 2QYGA 4EFAC 5F8JA 1ZAXA 2VG5A 5KG2A 2G2ZA 1IBMF 3D7SB 3FEYB 3EGVA 4RZRA 2WOMB 4ZLJA 4HT7A 1TKTA 1TKXA 2JC1A 3H0PA 3D0IE 3CCRS 4K5SA 4ECTA 3MF5A 3MM6A 2YX4A 1R8BA 4MT1A 1NZAA 4FF1A 1DAXA 3K5NA 1S99A 3BQ2A 4NXNJ 3UWTA 3MR5A 4I2QB 3MMBA 1FXDA 2LKZA 4P71A 4JV0A 4KRWA 4K7QA 4RW8A 2DKOB 3QZ7A 3HX9A 3QO9A 2W9CB 2MMYA 2Z58B 3G6ES 2R7RA 2XZWA 3KMSA 2MZSA 5AXKA 1FDDA 1X4FA 2B5JA 1UEUA 4RBUA 1GT8A 5GMKa 2VICA 1G3OA 1FI4A 4ECRA 1HNXJ 5G0RB 3NGUA 3ZZ0A 2QMXA 3KUHA 3CCTA 4Q45A 1E6YB 1N54B 1RB0A 1NUEA 1NSPA 1N5VA 4O3SA 2OGUA 2CG4A 1RISA 1FWLA 1KHVA 4RW7A 3EVOA 2POKA 2Y1IA 2QG9B 4IQMA 2QLXA 2DXFA 1AUSL 2O67A 2FDNA 1HHTP 4PPDA 1I5OB 2Z30B 4NYOA 1H3DA 1OSCA 2GGPA 2PA8D 2UXDF 3DLGB 2CPEA 2UP1A 3KNAA 3M1VA 3SIPB 3MZIA 1GXUA 2CJXB 1XR7A 2IM2A 3ISNC 3EYZA 1WEZA 3NAIA 5KFEA 4U67Q 1T3NA 3VR1A 4PXDA 3M8SA 4F4AA 2HFOA 1RUSA 2A18A 4P2FA 2ATLA 1F1BB 2B7CB 3M30B 1EQ0A 1RTHA 3ZZYA 2OO4A 2CFXA 4H4OB 4IR9A 1CQMA 4LSLB 1NJYA 3QRRA 2V68A 1HWJA 3L4BC 5BXIA 3B4MA 2BKOA 2GIQA 1ZAVA 4G1PA 2RH3A 4X62J 3DFEA 1PBAA 3EICA 4K5RA 4WFXA 2I1RA 4I7FB 4OHWA 2VDHA 1TKZA 1NCLA 3V4IA 5IOLA 3FFIA 3HSJA 1KFDA 3SCIE 1KTVA 1VRTB 3NBPA 4JB8B 2ZKUA 3LW5C 3FQKA 4G1IA 3TO8A 4V19J 2JVRA 5CZVA 4FYXB 5F8GA 4OI0A 5J2QA 1CC7A 4PXEA 1HWLA 4K0KF 3CJQA 2VB6A 2PT0A 1T05B 3OR2A 3DLLQ 3C46A 3KHLA 4C0OC 4GKJF 1FHTA 1QUVA 1U8WA 4HI2A 4ZPBA 2BE2A 3GCWP 2KFZA 5A8KA 1X4BA 1RHMB 4JI3F 3MI7X 1VRUB 2N82B 3H42A 4A48A 2BOAA 4KO0A 1BMQB 2ZHOA 4AL5A 2BV3A 1C1CB 1HYSB 4TY9A 4ZLLA 1OJ4A 2L41A 4RW4B 3M4XA 1VQKS 1ELOA 4JV1A 2KXHA 3NS5A 1HI0P 1I6JA 5M2UA 4F3MA 5DGAA 2PFDA 5DZ6A 4OYWA 1AYEA 4C7QA 4NCGA 4YR0A 4DPXA 4A8XA 1S1XB 3IXQA 3PW5A 2PFFB 5KFFA 2W4PA 1KRPA 2CQPA 4DV3F 3PCOB 2AMCB 3BSAA 4NEZA 2UUBF 1NPKA 2G9OA 3TAPA 4DV6J 2RDIA 1LXJA 2YPYA 4KH1B 1NPRA 1FRMA 1S9GB 4DR2J 1RT7B 4CLSA 2AV5A 3R6GB 3M2RB 3V81A 4WZMA 3IR6B 4TU8A 2OPSA 4N76A 1RWVB 4J90A 3D0GE 2MKKA 4DR1J 5LXRA 1EARA 3M2VA 1TK0A 2XGPA 1Q53A 1VQSA 3BQ0A 5J2PB 2JWNA 2QL5B 2YKOA 3UVJA 4C3MA 2MEWA 2CPFA 1NKCA 3UR0A 4WJBA 2VF3A 4KHRA 2KO1A 3S1TA 4BC7A 1RTZA 3EDQB 3DGPA 4KKOA 2F63A 2CQ3A 1OMSA 5KG5A 2HWHA 4B3MF 4ZJQA 3M8QA 3FRZA 5GAGI 1IKVA 2OPPB 4L74A 3DOMA 2MSTA 4TY8A 3LQVA 1U26A 2GJ2A 2HS0A 3IFEA 4B02A 4X64F 5DGBA 3P96A 2DH9A 3C15B 2Y1LB 5AE3A 2ZZMA 5D8HB 3G2XA 3GLJA 3KJVB 2RVJA 3AD9C 3HVTB 4ENOA 4F4KA 2N7CA 4WK3A 1HNWJ 3CJ3A 4NL5A 2OMOA 2YX7A 2YWFA 4MAKA 2HQIA 2XMAA 1S1TA 2RB7A 2MGZA 1P1LA 4YUDA 4I6YA 4M5DB 5KFAA 1UVLA 5KFRA 1KLNA 3W2WB 3AJDA 1K9MT 1CS4B 4G65A 4L6V3 4JV2A 3V6DA 2B3TB 5J1EB 4DLGA 4LIRA 1FRXA 1IKYB 1QAXA 5KFSA 1LW0A 4ZHRB 3NMRA 4I2PA 2UVRA 2WW8A 2HK2A 4ZCIA 1WACA 2EI5A 5DDPC 1I94F 3NCRA 5L1IA 3AD8C 5E3CA 4UUXA 5KFOA 3ILLA 5HMYA 2DNLA 1T8EA 3K89A 2HFUA 1N4LA 2ZD1B 3Q2SC 2OAUA 2PI4A 1N5SA 1PAEX 2J6UA 1U24A 1X4HA 4KJIA 1SXLA 3UDVA 4H4KA 2ACMA 1ZA1B 2M88A 3UCUP 4IUFA 4HH0A 4QWCA 1WKLA 4ZVHA 3IR5B 3TQ1A 7AT1B 2DNHA 2W2PP 2ZJQQ 3Q8RB 5E2QA 2OEKA 2HHTA 3ZZTA 1F5CA 2YTCA 4OJ1A 1BXNA 3AQPA 4DV5F 4LFCJ 1UAWA 5A8WA 4WYLA 3PJWA 2YKQA 3MM8B 2YNIA 4RWWA 1MG7A 1SJQA 1VDHA 1JQGA 1D8YA 4DR3F 1RBOB 4WTYA 3NAHA 4JI6J 1URNA 4RNMA 3OTOF 1RT1A 3KK2A 3CMES 4DL4A 3KLIB 5HAOA 4DV1J 3QGIA 2VFRA 3I56S 2KVIA 4ANEA 2WVBA 1WSVA 2QLFB 2D74B 4DCOB 2BVZA 3RYLA 3W61A 3DDNA 2Y3YA 3K8WA 1FT8A 3KJQB 4UY85 3CDAA 3G4SS 3ZC4A 4Y00A 1SJ4P 1MMDA 1EP4B 2W4DA 1RTIB 3CD7A 4EZ6A 2OIHA 2XHWA 4L75A 3LPYA 4B3RJ 2PMZD 4PEOA 2E9TA 1NJXA 3HHLB 2RRNA 2MJUA 4PYAA 3HZEA 1V3ZA 2UU9J 1OYEA 2YXLA 2X3GA 4FVMA 1AFJA 1VBKA 4DSFA 2EKNA 4AT1B 3ISZA 4E0DA 4YB1P 5GAEU 3GMGA 2QGFB 1DLOB 2DXEA 4O3NA 4KGXB 1X9WA 3QATA 1KVKA 1Y00A 3OL7A 4WFBQ 2BANA 3N6LA 3RB4A 2HLTA 1YDLA 3DOKB 1U0HA 2H3EB 4ETZA 3HSDA 4I56A 4OI2A 5DG7A 1KHWA 3T19A 4GMKA 3A3PB 4N41A 3SFGA 1GX6A 1JLBA 4LFBJ 3RB3A 2DHAA 4KT0C 1TL4A 3CCMS 5KT5A 1HW8A 2AJFE 1PJ5A 3QFWA 4UW2A 5D0EA 4WP8A 3B82A 3ZXWA 2M70A 2E1AA 4F0HA 3PRVA 5EN1A 4ZPTR 2LMIA 4FP9A 4FYDA 4DUYF 2QFJA 2CPDA 1SKWA 3MEGB 2CADA 5HJXA 4RW9A 3QT7A 3KLGB 2VJVA 4YN3B 3D28A 1NDLA 3A3NB 2NXCA 3DYAB 3PEJA 2IJFA 1EAYC 5B0EA 3QYYA 4DX8H 2HMIB 4WYWA 2VBYA 2VHGA 2PA3A 3TEHB 1NK0A 2FLPA 1ZA2B 2QZ8A 2FC8A 2XLKA 3O1LA 2ACYA 3D3BJ 4GVBA 4ECQA 3EUNA 4LF7F 5EX0A 4QIEA 3TR5A 4ECXA 4IRDA 4CNZA 4K4SA 1NSAA 3A8IA 3ELHA 3FBEA 3BBFA 1BQXA 5B7WA 3QIPA 1YRXA 3KMQA 2G0IA 4QR1A 1H2VZ 1S76D 4X4VA 1TQLA 4OHVA 3BO4A 1QAYA 2B8QA 1S9EA 3AB2B 3H5UA 1NK4A 4ZCKA 2CQ4A 4O44B 4NLSA 3TW0A 5HP1A 4DR5J 3OBIA 1NHVA 2AWZA 5E7OB 2MLXA 3CD5A 2D3OR 3QNWB 1HBNA 3IR7B 4NWBA 1GTEA 1FRLA 2DT9A 4X4NA 1Y7PA 2WBMA 1G4CA 5EWFA 2ERRA 3HSZA 4FNIA 2ZH4A 2HPUA 2OTJS 2HNZA 5D4OA 2R7VA 3BGUA 3KLFB 4DL3A 5B0DA 1S12A 2VIHA 3PJ9A 4KGVB 5IM0A 1FEEA 2BZ2A 1YIJS 3I5BA 3EX7B 3PKMA 4W4MA 1WG5A 2KKHA 4MKBA 4LRCA 3JQMA 2UXBF 1Q1KA 3N01A 2GAHC 1FFSB 3MWBA 2DCLA 4NASA 4AUKA 2OD6A 2VJUA 2RSQA 2R8GA 3K8VA 3EJMA 4DG1B 3IN5A 4Y28C 1KBRA 1U4BA 3CCUS 2Z8QA 3AA8A 1KQGB 4OYOA 5JJBA 4P2MA 3UNGC 5A2QY 2R7XA 1JXVA 4CDIA 3ZTRA 2BJ8A 2VOOA 5CH7B 5RUBA 4K4WA 4YY3F 3D9BA 1VQOS 1ZETA 4RWXA 4IFVA 3TJAA 1F9EB 4YB6A 3O5TB 1VQMS 3GV8B 1AROP 4K4XA 1OO0B 1BY9A 1VQ5S 1S1WA 2DEJA 2W9BB 1AA1B 3IG1A 5KFBA 3DRPA 3L09A 4B3OA 2HVHA 1TL5A 1BUXA 4IH6A 2M0GB 3HXMA 1WOOA 1VC6A 3WBZA 2R2TA 4OYPA 2F4FA 3HHKA 4DFJA 1BE4A 3D1QA 3MHYA 3TYTA 1KDNA 3I32A 2DRAA 4DV0J 2XWXA 2CPYA 2IC3A 3QQCD 3BPDA 4YOEA 3I87A 4X65F 1WD6A 2V34A 5GAHU 1C4CA 3DHWC 2R7QA 2FJWA 2IVMA 4KSEB 2M5YA 3ET6B 2XO6A 1F9FA 2DNOA 3BH7B 2OJ3A 1GNKA 4C8ZA 5F8NA 5LM7E 4EO8A 2K06A 2CQGA 2HVEA 4QBUA 3D67A 2WCXA 3OPKA 1RT5B 2V0NA 3E8OA 3QZ8A 2JRSA 5D77A 4BHQA 4NLXA 1S0NA 1QJHA 1HNVB 1P1TA 5CYMA 4OL8A 3O2IA 1FDBA 4DPWA 1EIYB 1S6PA 4N8OA 3M32A 4NLWA 3FVYA 3OLAA 1T9UA 2HURA 2D3UA 1ZTWA 4F36A 2KT3A 4OYAA 2NUUG 3BKFA 1WKJA 4DCJB 5MLCV 2HIQA 2KN4A 3MMCA 3LP1A 4NLDA 1LFWA 3PHEA 2R4FA 4NYZA 1YQHA 1HBMB 3HVWA 3R3TA 4Q5VA 3OTCA 3GIRA 2AU0A 1B7FA 3FBFA 4PPZA 2UVWA 3H4BA 1DTTA 2DD8S 3J80Y 1CG2A 1LWCA 5DO2A 4ZPVR 2UUCJ 3KG4A 4Q0BA 1SKSA 5BYQA 3ZNJ1 4IG3B 4NMLA 3W5ZA 2GX8A 2FGOA 2JHEA 2JNJA 2J8SA 2L48A 1Y5IB 3WHIA 3CJ8A 1SB6A 2I5JA 1PILA 2LDIA 2FJDB 3OTDA 4IRKA 1RDRA 2NQPA 4IYQA 3NS6A 3W64A 3JYTB 4WWSA 3NCPA 1MMNA 2AIRB 1B3TA 4NLYA 1IQZA 1H0HB 2FZCB 3Q8QB 4KC5A 2EWHA 2B9WA 1X7VA 1PSDA 4WKYA 1TL1B 1TK8A 3RRKA 3AAWB 1GMWA 3BBCA 2DR5A 5AXLA 3IAS9 5HBMB 2ZBCA 3LALA 2VFUA 2LQBA 2J7KA 5T14A 2MY8A 4ZMMA 1J5EF 1NU4A 4PXCA 1VR6A 4DV7J 4AXIA 3HULA 3RRGA 1W25A 3GYXB 4X4RA 3BSNA 5DDRC 4I0WA 2E9ZA 1X4EA 1L3VA 4WF9Q 4G1QB 1YRTA 3DLEA 3BM7A 1SI9A 1MNEA 2AHOB 4ZOSA 3GJTB 1HWUA 5J1PA 1RWOB 2LEAA 2CRLA 4Q8EA 2JEJA 4NXNF 4HH1A 2OH2A 3GV5B 2Y9HA 2Z57B 3DI6B 3DN9A 3EZUA 4JYAF 2E5HA 5HROA 2YBVA 2HHHF 3J7A1 3HJVA 5F3TA 3I0SB 4C11A 4OJGA 4PRFA 4RJVA 3CVKA 3VQSA 1TMMA 2DGVA 1X4CA 4HHHA 5LOQA 5HVFA 3VGVA 3T1YJ 4LQ9A 1Q8IA 4M95A 4AFFA 4YR2A 1HNXF 1IR2A 2N4DA 3V2UC 4O4GA 1NRKA 2HVDA 1SQFA 1DY3A 4B9VA 3H25A 2A1BA 4UT4A 1ROFA 1HBUA 2OEJA 4AE5A 2VG6B 1Q5VA 1RSCA 1T03A 3OXLA 4CYUB 1V5IB 1EKRA 3OUYB 1Y3KA 4RBTA 2B9XA 4XAKA 2VBZA 2JLEA 2M8DB 5A6PA 1XQIA 3ZTSA 3ZTQA 2AGOA 1T95A 2JOQA 2DHGA 4NRTA 4ZK7M 2XY6A 4NI2B 1FD8A 3D6FB 4P72A 4AL7A 1M90T 2E1PA 4QIWD 3PYDA 4O3RA 3W2VB 3GIIA 4F4WA 2ILZA 3K57A 2VBWA 1D9AA 4LJMA 5B0AA 1N6QB 3OR1B 3CJKA 1FVSA 1N36J 5C24B 1VMBA 2X51A 1BD6A 3KLEB 4CLKA 2XO7A 4UQGA 4BDPA 3OSPA 1WEYA 1JLAB 3NGSA 3R1HA 4TQRA 4DPYA 5KT3A 4B9MA 1RP5A 1Q79A 2F3JA 4C4WA 3R5CA 3HM9A 2V63A 3GSDA 2DB1A 4UOFA 4I4BA 1Q86T 1U1LA 4RUAA 2BJ7A 1VQNS 1Q0NA 2DH8A 1LWEB 2ALZA 4X62F 1TL7A 3UD5A 3AODA 1FX4A 1QUPA 1XMQJ 1HR0J 3AOAA 3IWLA 3NNAA 5GADU 2JX2A 5H9FK 3PFOA 1SBRA 2XMTA 3MPYA 4KE5A 5IV4A 3FSIA 1U6ZA 3H40A 1BLUA 1P8GA 3MPVA 2J5AA 1S7HA 2CIMA 1FRIA 1TELA 1K47A 2J0WA 1MMLA 2KTQA 4U95A 3TZWA 1FFGB 1RAJA 4NYPA 3BR9A 5IC6B 1J5OB 2AEJA 4J9QA 4BWJA 2G4BA 2EKYA 5DLFA 2N7YA 5JUMA 1EKSA 4NCAA 1HPZA 3WC2A 1WC6A 1WF1A 2FVCA 1RBLA 5F9LA 1HKAA 1UW4A 3NGKA 1NAQA 1AFIA 3TVYA 1VOMA 4A8FA 3PFEA 4IKAA 1JKHA 3M2RA 2Q6BA 4JP8A 4Y2CA 2BM0A 2YWEA 3VGTA 2JC0A 3Q22A 2BRLA 4LF8J 5AJ3J 1CJUB 2DNPA 5F0UA 1FDNA 3GR0A 2KJWA 3PV8A 1HNIB 5ADZA 2H51B 4J5OA 4F0MA 3V5RA 5HMWA 1KD1T 4DFPA 4IDKA 4F2RA 2D3O1 5D0GA 5DQHA 4HDHA 5BJRA 2P9CA 2P8IA 2MLZA 4DV6F 3TUJC 3P5BP 3ULHA 3KUEA 2DHHA 1UP1A 3H2UB 1TMJA 2ZWPA 2ZE2A 1CEZA 2QT7A 2CJ9A 1U2FA 1ZAWA 3BKTA 2YKNB 2XYHB 3MMAA 2M9KA 3Q89A 5KFZA 2JVOA 3MPDA 2VD3A 5FD1A 1RHRB 4DV4J 4DR1F 2D9OA 1NMEB 3GYGA 3RU0A 2BJ1A 4C0BA 2FJAB 2ZBRA 2W7PA 2W01A 5K8PA 4UOHA 2U2FA 1HL6A 4JI5J 4NLQA 1WOSA 5ITHA 2AYGA 1SKUB 1XEZA 3MAAA 4U8VA 3PRDA 3PYFA 5I3QA 3LGHA 4EBDA 2RRBA 4GO7X 3QGPA 2W8KA 4CO5A 4CLLA 2QA2A 2CNNB 2V2QA 4L3NA 2RJZA 1KOOA 3EGZA 2YY3A 2YNGB 1X9MA 3LP2B 1OPZA 3HP6A 4NA1A 1ZPVA 4I64A 1MROB 5KFIA 4F8RA 2LEPA 4R25A 4J9MA 5M2RA 3KK3B 2NXNA 5T7LA 3FRYA 1HQUB 4ZLPA 1KLMA 2LVWA 3LP0A 2VASA 1YRUA 2YNFA 1YG0A 2ZVSA 2FJEB 1HQEB 3MURP 3VCDA 1UJ5A 5A2QU 1RAFB 3GG0A 3JSBA 1T94A 2AGQA 2L9DA 3Q8YA 1JJ4A 2HSEB 3OXGA 4F2SA 3RB6A 4LT6A 5E0OA 1WUUA 3Q23A 5KFWA 2O01C 3IS9A 4LRBA 4YQWA 1SH2A 4DN9A 1LW2B 1R0BG 1ZOTA 5I4MA 3QT6A 1ZTTA 3OW2R 3Q8SB 5B09A 1S5ZA 3ZZOA 4W90B 1SL0A 3QIDA 3C14B 3U1MA 3SV4A 1FE0A 3X3UA 4LQ3A 2WVEA 2BJ9A 2E5JA 2P6SA 1FCAA 3TX8A 2OPQA 5JVGQ 2H54B 3W60A 3TARA 3N6MA 2R7OA 3CMQA 2RQCA 3K5MA 2CZ4A 3TJ8A 3IBCB 3DKDA 2FHJA 2FLOA 2IAJB 3M6WA 2V8PA 2PSZA 3TI0A 2GHVC 5FDLB 5JVHQ 4J9UE 3C16A 3EZ5A 3M8PB 3JSYA 1Q8BA 4ZVUB 5C42A 1WKKA 2FB0A 2MZTA 2VC1A 2IM1A 2FIUA 3AB4B 3M8YA 3TAMB 2CJQA 4LFCF 4UZCA 2KG1A 2BM1A 4NZ0A 3TP2A 2XTJP 1RAOA 1LWFB 3PW2A 2V69A 3EZOA 2B0GA 4XPCA 1QLNA 4JI0J 4WTOB 4P7VA 4NOHA 1M0SA 3NXZA 3B6BA 2NPIA 6AT1B 3LANA 3O44A 5KFYA 3MEDA 2PDAA 4DV1F 4GKKF 3CEDA 5GMEA 4DL6A 4D3GA 1KQFB 1FKOB 4CLPA 1GK8A 4IFYB 3VAKA 2IPOB 3O8WA 2R8JA 3RW7A 2CYYA 3MR3A 1P6TA 1T9WA 4ED4A 2K2PA 2O5DA 4NA2A 2DJWA 3PJXA 1DLOA 5KG1A 1FE4A 3HJFA 3FGVA 2ZEJA 4B3RF 2HS4A 3H59A 4M1KA 4H54A 2VG7A 4WXOA 3ZZZA 3J7YU 2RQKA 3VWSA 3BSCA 1MN9A 2LXUA 2K1RB 3D1HA 4L3KA 2VFVA 2UU9F 1JNZB 3QLHA 2I8EA 2V9WA 4M5NA 3J80U 3EDRB 4DPOA 2KH9A 4RU9A 3NWGA 1LFPA 2DNGA 4FS1A 3C19A 4PWDB 4QYRA 2KVQE 3SFUA 3CB4A 2MYFA 1F5BA 1RZMA 2GVZB 4JI4J 3PYEA 3I96A 3IAM9 3GR1A 5K8NA 1C0UA 5L9XA 3SBMA 5D6GA 4IOBA 1DQ8A 1K0VA 4Z7YA 4MMOA 4JI7F 4LFBF 1JNRB 5KT2A 2HMIA 1L3TA 3M8ZA 5A8RA 2IA6A 3NWRA 1UW9A 2IVYA 1V9OA 3B54A 3MOJB 4HTJA 3H98A 2MHNA 1RT2B 3EXYA 1RTDB 3N6NA 1SC3B 3K0JA 4HDGA 2CVEA 4KGKA 4USHA 2FVQA 4M94A 2DNKA 3MUMP 2AQ4A 4XO0A 1Q7YT 4ED7A 3AOBA 4ECSA 4R8UB 3H4DA 4ECWA 2HS3A 4H4MA 4TYAA 4G3IA 4YFUA 3FEXB 3MFIA 2RIJA 3EM1A 4WBFA 3MEEB 2EFOA 1DZ5A 5IC4B 1CJTB 3WIVA 4OYBA 1SH3A 3MM9A 3DU6A 3DLJA 4XIUA 2PMWA 4MK7A 4C98A 5J2MB 2LDYA 1IBCB 1RWUA 4QWBA 5CAAA 2MLYA 4TVAB 4J9LA 1OWXA 1FJCA 1VQ8S 4PABA 1S1VB 3I5AA 3QSYB 2LQ5A 1N5YA 2KRRA 3J7Z5 2QTWA 5KG0A 3KLFA 4LSZB 5I42B 1JLFB 2QA1A 4FZVA 2DGWA 5KOWA 4WP9A 4WPAA 3UFCX 3UN5A 1JWWA 1Y9OA 4DR6J 5HMXA 1SJ3P 4DR5F 4LBPA 4OZJA 4L73A 2MKIA 3A1YG 1UVKA 5F8HA 3BYRA 2IBOA 3T3FA 2GFFA 1A0OB 1AZSB 2E5IA 2OEMA 4Z2XA 2GW8A 5KFMA 2BUNA 1HLWA 2FZGB 3SDEB 3RB0A 4Y0FA 2IYIA 3U1NA 3PR5B 1QVGR 1B70B 4TLQA 1RAEB 1FJGJ 4IG0B 4LMZA 3CJ2A 3R9LA 5A0YA 1PIEA 1S77D 3AH6A 2EK1A 1H38A 1BQMB 2COLA 4CLWA 2FQQB 2ZITA 1VC5A 2HGNA 1MU2B 2B4OA 2QN6B 5M2PA 3GWCA 1R0CB 5DS7A 4JI8F 4QPXA 3RW6A 1K8AT 2K7KA 3F44A 1FWKA 2M52A 1NB7A 1HBOA 5CD4A 3GILA 3E01A 3UI3A 3FDSA 1NZ8A 2QSFA 1HQ2A 3VV2B 3IWNC 5LT5A 4L76A 3TOQA 3SCJE 1VBYA 4KHPF 4A4JA 4CI0B 4ZKAA 1HD0A 1IBLJ 5ETVA 4IR1A 1RWWB 4ERDA 3U02A 3L9ZA 4NLGA 4WKRA 3FNNA 5AE1A 1UVNA 1QD1A 3UW1A 4O0NA 4DV0F 1O51A 2XLJA 4Z37A 1M5VC 1UEVA 4X66J 2G0JA 2YKMA 3TANA 3KHRA 4F4ZA 2QL7B 2HQDA 3C6UB 3S8SA 2Z0GA 4KFBA 1WC3A 1R7IA 3W3SA 3ILJA 3MFHA 4EU0A 3TA1A 4N47A 1PCAA 1CJKB 1D9FA 1CVJA 3R7SB 2OHDA 3CO0P 8RUCA 5HI7A 5IWAJ 2LFVA 4LF9J 4ID5B 1EETA 2V8GA 2E1RA 2VDIA 1IBKF 1ZM3A 3DC2A 5D4LA 2BQ3A 1XWLA 3Q8PB 5CQGA 2MSSA 1YBTA 4OX8A 4QW8A 2LECA 2OSRA 1JLCB 2E1CA 2J8AA 2MKSA 1WHWA 3LUYA 1HBMA 3G96A 4CIOA 3J81Y 4EWTA 2YWWA 4X4OA 1N34J 5E3PA 2EG2A 3T5LA 2Z2ZA 6FDRA 3OT9A 4C9DA 2BJDA 3C6TA 3AJ2A 1N33J 1JLEB 4MJKA 2RNEA 1VGYA 4AXJA 3HFVA 1BQNB 3U1LA 2G2OA 1PKUA 3UNYA 3QWPA 1GMWD 3BZQA 1Y10A 2HWTA 2GQCA 3K5OA 2HQCA 2QE5A 4FXWA 4PUOA 1IKWA 1YTYA 2HG4A 2Y8WA 3T41A 1HMVB 1RTJB 1QSYA 1LWXA 2UVVA 1UFLA 1S6QB 2VC0A 4USJC 3KJNB 1F5AA 5HSPA 1TL1A 4Y3CA 2VZ9A 1AW0A 2UUCF 2CNLB 5KOXA 1WI8A 2VONA 1A6LA 1PJ6A 1UJ6A 3EVMA 4N7TA 1UVMA 4AL6A 1RT4A 1FXRA 4P2SA 1VIXA 4ICLB 2OTLS 2LU2A 2V2KA 3L7UA 2CJBA 3PDNA 2NREA 2LEBA 5HQMA 3R27A 2RF2A 3HSGA 3G87A 3FMBA 4QWAA 2MQNA 5BR8J 2RS2A 3MTKA 4DZDA 3CD6S 3SQGA 3P3DA 3NKYA 3GYNA 1YJWS 1VRQC 4C3LA 4DMZA 4Y6IA 5L46A 2H4YB 1SUQB 1JLQA 2KL8A 4HHUA 3I0SA 1FNXH 2VG5B 2OMLA 4DQQA 3KLVA 1X31C 2WONA 3GG1A 1TKXB 4TKTA 1NSQA 1MSWD 1TFWA 3VAFA 1NEEA 3MM6B 2V4JA 2DH7A 3VAJA 2P9GA 1MW7A 2C2KB 4PR6A 1R0AA 4PQUA 3DCAA 1SQEA 1RGVA 1E6VA 4YEAA 2EC2A 1TP7A 4CTAB 4Y2MA 4OYZA 3BS9A 1L3SA 3QO9B 3I5CA 3JTPA 2BACA 5SZTA 4YDXA 3PR4A 1KP6A 1UETA 2CQ2A 1QTNB 5FLXY 2B5JB 3CCWA 3T1YF 3H8YA 1UZDA 2H4WB 3W2VA 3OXFA 1VJWA 1WG4A 1Y5NB 3TX0A 3VZIA 3M8RA 2RE1A 3CJRA 4ES3A 2E7WA 3M7VA 1VYAA 2GHPA 2DXDA 3KNGA 2YX1A 4RW6A 2K3IA 4LF6J 4QQBA 3CD0A 1C1BA 2BA9A 2RT3A 4J9PA 4RW7B 4LIWA 3I9ZA 1H98A 8AT1B 4CH0S 1K73T 5DRKA 1BWEA 1KSPA 3MPWA 2XQCA 3CGIA 2H48B 5CCMA 2HWIA 3QT8A 5LSLA 3LH2S 4UZBA 4ETXA 4K4YA 3H5XA 2GGPB 4EBEA 1U1RA 3B8HA 5KFQA 4TYBA 1SH0A 3M1VB 3KJFB 4ZPCA 1ZYQA 1VQ4S 1WSRA 1KQKA 2HVZA 2RKIB 4ZPAA 1N36F 4ZP6A 4M5LA 3B4DA 3OL8A 2DYAA 5HMZA 5IFMA 2IRYA 3BGLA 4FBUA 2YNHA 1REGX 3CTRA 3NG8A 4YHHJ 5D4PA 3HVRA 1VJQA 2J9DE 5DM6Q 5L1JA 1HI1A 3FUYA 1RWNB 1UPMB 1FTRA 1M5OC 4R0EA 3FBCA 2WVDA 4K0KJ 2UUAJ 1RLDA 4X4SA 2Y1RI 1WORA 2E29A 1XNRF 3IBWA 3WDOA 2RUGA 5HANA 1Q78A 3A8JA 3WQPA 1U6FA 1XMQF 1H73A 3VGSA 1HR0F 1XERA 4ES2A 5LMUJ 3TA2A 4P74A 1K44A 3M6XA 2X1GA 3JQJA 4LUBA 1TKZB 1S0VA 3V4IB 4JI3J 4C8KA 3FFIB 1O0PA 1RT3A 3AT1B 3DDIA 1JX4A 5KFVA 1R3NA 2RRAA 4CM2A 3NBPB 4EYHB 4DX6A 2YQ0A 1MWQA 3SZ2A 1JJ2R 1WEXA 2Y0BB 5J2QB 2I6WA 4OQJA 2KXFA 3ZO7A 3QJPA 4P73A 3LA0A 1RAIB 3QWUA 3OR2B 4DL5A 4RO0A 1CJUA 1PG5B 3DDKA 1J27A 3MPUB 4XPEA 4J9KA 4RNHA 2BE2B 1YGYA 4C2MA 1D3WA 3THTA 5A8KB 1VQ6S 2HBRB 4M63A 2ATCB 1LNQA 1H74A 2KT2A 1VHFA 4KO0B 2DNNA 2ZH7A 1NSKL 5J1NA 2NUHA 3F0NA 4OYXA 5F9NA 3MM5A 3G82A 2ZM6J 4V19X 2EFVA 2YKNA 4CM0A 1VQPS 3SEOA 5E3AA 3BO2A 1U48A 1B7YB 4LF8F 4OLOA 2NXJA 1JJHA 1YZ7A 2Q1LA 4NCGB 5D0RA 3RAQA 2GMLA 1UWAA 4CLFA 5HLFA 1YBAA 3MECA 2GMJA 1T9YA 3ZTPA 2IRUA 4E2FB 4AQYJ 4DL0C 3CMAS 3R5GA 2HNDA 3TUIC 1N48A 1PGZA 4K4UA 3A8KA 2B6AA 3V81B 2C28A 2QLJB 4UF4A 3T1HF 1ZBTA 1D8ZA 4DV4F 2VOPA 3S01A 3K5LA 1W26A 5K14B 4X64J 3EPIA 4X2BA 4USVA 3GP9A 2Q6CA 5KFCA 2VA2A 4M8LA 2IIHA 1K1QA 1U1NA 1MN7A 1CJVA 3UVJB 2XCAA 1QE1B 3R5BA 3PY8A 3V4MA 1DARA 2BRKA 2BX6A 3DGPB 4KKOB 3OVSA 4A8SA 2DR9A 3MR6A 3M8QB 4C8MA 1IKVB 2DCUB 3DOMB 4TY8B 2MQ8A 4DX7A 4OZ1A 1QAJA 1S1UA 2IYGA 2XEXA 2QL9B 3FCHA 1UFKA 1YJTA 2DHSA 3KLHA 1MWZA 4U7CA 4ZS6A 4KYZA 3QRQA 5K20B 2X1FA 4DSJA 1S1TB 4A46A 4EEYA 3JTNA 3HPOA 2MGZB 2IDLA 3UDLA 4NXMJ 3PYGA 3EMTA 4KY3A 3BV8A 4OMFG 2AEFA 2FHKA 3I0RA 3I9V9 5HO4A 1B99A 1UWBA 3V6DB 5E33A 4V1Ak 2RDDA 2R2RA 1FVQA 2DNQA 2CJAA 4CLUA 5KAKA 1FKPA 3MUTP 1UEKA 4WZQA 4WCEQ 4NZ6A 3IMQJ 2IJNA 3CCJS 1NPPA 2O66A 2DTJA 1G2EA 3SV3A 3DLHA 1C0TA 1FK9A 4QWDA 3DRSA 3IRWP 1TR0A 3THPA 4DX5A 1ITPA 3JQKA 2M4MA 1Z2ZA 1HI8A 4ECZA 4C8OA 3M6UA 4DQRA 1UZHA 3VF0B 5KG4A 1TZ0A 3A8EA 4PWWA 2VUGA 1QSLA 4DR3J 4WE1A 2XS2A 3QFHA 1NXIA 3BSOA 4QJVA 4I6WA 4CRJA 3GIJA 1N32F 2C3OA 4HYKA 5AE2A 2I38A 4IFYA 1LEOA 5LXYA 1VS3A 4DL2A 5LSRA 2V6AA 1C2PA 1TVRB 4LSNA 1WC1A 2JEIA 1WI6A 2B9EA 2WBRA 1SJFA 5A8WB 1Q8LA 4DN0A 5F8MA 4OI4A 2YNIB 5C5JA 1YK9A 3RAXA 4Q44A 3D6HB 1KVJA 2RQMA 4JI0F 5GAEI 3TUPA 5K9FA 1TAUA 3BGRA 2XMJA 2CQ0A 1RT1B 3CF5Q 5HK4A 4LR8A 1YLXA 4ZN3A 1X4AA 4O3QA 1U0SA 5JMNA 2M8HA 1BGXT 3J81U 2ZC4A 4ZP7A 1RWKB 1I51B 4UQTA 4GVLA 4HACB 4X4PA 3F41A 2LP4A 4CO0A 3HCXA 3ONQA 1R43A 4EO6A 4HLBA 1XN9A 3PHTA 2CA9A 2M3DA 2Q66A 1U2RA 4QR2A 1U1MA 1XMOF 4KPCA 1WC0A 4CO2A 4YB7A 5C7PA 2L3MA 2M7SA 2DITA 1X9SA 4AD6A 1VHIA 3MCMA 3FZBA 3M05A 4RL1A 1APSA 2M2BA 3HI9A 2MQLA 3VAIA 3OJSA 4USKA 1S57A 2HIYA 3DOLA 2ASDA 4ZLNA 4DSEA 2XB2D 2VFTA 3MD3A 4EMDA 1QY7A 3O6QA 3FMWA 2GVDA 3I4HX 2ZH9A 4DOZA 1X4GA 4FYVB 2BANB 3CO9A 5G4DA 1R31A 1U0HB 4JI4F 1S72S 3HZGA 5BYRA 4MH8A 4B3TJ 4DU8A 4IO9Q 2J9DA 3EWGA 2B4UA 1JLBB 1N5QA 1CJTA 2JLGA 1KS2A 1NM2A 3KWMA 2WTFA 4K59A 1DFDA 4H4KC 1FEHA 4ZP8A 4LF7J 4X84A 5HQLA 1NKBA 4OZ0A 5KFUA 1S1VA 5F0WA 3FK4A 4LFAJ 4RW9B 2D1CA 2OUGA 2DGTA 5I42A 1W2IA 1U02A 3W63A 4DDFA 3S6EA 2WVCA 2IDEA 3JB9k 1W2BR 5H9EK 4A8OA 2HHVA 1U2CA 3SXLA 4NEYA 1VLOA 3DLKB 1OPIA 3RZAA 3OSNA 1LK5A 5CYQA 1EJ7L 3VAGA 2QC3A 5F8IA 4ELUA 3QIPB 1F0XA 5DG8A 3A13A 5FLXU 2HZAA 3QSIA 5F3ZA 3K2YA 5KT4A 2YWKA 2SXLA 2UV8G 3A12A 1S9EB 5HP1B 1Q8KA 3M9NB 3RBZA 4C0HA 3G71S 2MZJA 3KK1B 3TVKA 4QCLA 1BQMA 1RCOB 2AX1A 1K0TA 1LQ9A 1FRHA 2HNZB 2BYCA 1TL3A 1X0FA 3CJ0A 5FIIA 1F9HA 3GTYX 1Q82T 1ZZNA 4U8YA 1TU0B 2CQ1A 3FCVA 3GIMA 1WHYA 2DO0A 5B0CA 2F8HA 2DVIA 5IM0B 3PEHA 5A76A 4RNOA 4OJHA 3SCLE 3FC9A 4ANCA 2UV8A 1FJGF 1NK8A 4YY3J 4CWBA 2CUYA 6FD1A 5C25A 2DNMA 3CNQP 1HWIA 4QWEA 3IM9A 1WTFA 3FSXA 1RHUB 5GAHI 1T9TA 2ZUGA 4KPYA 1FNMA 2LA4A 1VLYA 1EX8A 4JI1J 4X4UA 2HYIB 4ED3A 3FQLA 4ZVRB 2OFGX 3IGVA 3CCQS 2XMWA 3EXCX 3RRHA 3OFEA 2KHCA 4R0JA 4F7VA 1YJ7A 2C2RA 5I3UA 1M1HA 2FYXA 2ZDOA 4A8MP 4C8YA 2I2YA 3QMQA 1WELA 3ENQA 2RS8A 2IBKA 1S1WB 3DGVA 3UDCA 2OFHX 4HHJA 3DRPB 2QFIA 4LR7A 4B3OB 2ZJRQ 2XM3A 4UOCA 2BKPA 2XBPA 3W9JA 2DNRA 1AB8A 2O3DA 1RLCL 1VI7A 4EI2A 1U09A 5KTQA 4ID5A 2WB1D 4X66F 3QBCA 2UZAA 2IC3B 3BF4A 3DXSX 3WX4A 3R8YA 1JLCA 2HNYA 2F9JA 1TV6A 1CULA 3IGNA 1B0VA 3POTA 1TK5A 3KDNA 1RU2A 1UTAA 3KTQA 3N79A 4F25A 2WSEC 2V94A 4DPTA 3HHDA 5IWAF 1XNQJ 4GRSA 4FPRA 3BGOP 5DJBA 4RX6A 2NXUA 4OJ3A 3NNHA 3W8PA 4ZVPB 4CH7A 1NDPA 3IRXA 4F0KA 1YJ9S 1ICEB 5CYMB 2KM8B 1F60B 3HLUA 4LRFA 2VQEJ 1R8CA 2PMHA 7FDRA 2E5LJ 1TKDA 4KH0B 5I3PA 1RI7A 1N34F 1N0VC 1S6PB 4USMA 2DGUA 2RDJA 3M32B 5KFPA 4L72B 3HDSA 2XC9A 2AJ1A 2ZFHA 1Q7LB 4KV8A 1M5KC 1WG1A 1OQ6A 3M6VA 1N33F 2ZDPA 3NEKA 2V4QA 4ITSA 1RKIA 1NBEB 3MMCB 3LP1B 4F4XA 2MY7A 4M5IA 1B0PA 4DS4A 1FERA 2PE8A 4OX9J 2Q43A 1SV5A 3UN3A 4ICLA 2AT1B 2LLZA 5C2CA 4ZJLA 2FHMA 4U6PA 5IT0A 3JXOA 3PZPA 3WZ0A 2VPWB 1OY6A 1LK7A 1HFEL 2RMLA 3D0HE 3JSMA 2AX0A 3OD2A 2R7UA 4B08A 1DTTB 3T9NA 2V4RA 2ZVIA 2WSCC 4OZNA 1LWCB 1GXLA 5IZHA 2HVIA 5J2NA 2H5EA 4Q0BB 1CLFA 5EHHA 1Y4ZB 4LRDA 1RYRA 3DRRA 3PVXA 2I5JB 3MOZA 3QAEA 5IQ6A 1FJ7A 3VTIA 1J5EJ 4DR7J 3DM2A 1SJ1A 2VPXB 4MFBA 4EBCA 1RT6B 2EFGA 3L3CA 4LR9A 4O4RA 1NJZA 2CPIA 2W2QP 2J76E 3ZNUA 5BR8F 5E3QA 2XS5A 1IXKA 2OPRA 4RU2A 1S79A 3PW0A 5JXSA 4MIBA 1D09B 4WU2A 3W66A 4ED1A 3K58A 2MTLA 2XSJB 4DR4J 3CDWA 2DY9A 2I9SA 3FKBA 3DRYA 2XY5A 4JYAJ 4CTAA 2E1MC 3KUGA 5IT4A 2HHHJ 1VQ9S 2RD5C 1U1PA 2H65B 1FA0A 2HW3A 2KHDA 3IWXA 3DLEB 2RHQB 3H2VE 4NLVA 2F7VA 2BW7A 2FUG9 3F73A 1ZS6A 2A3JA 3MGJA 3ZTOA 1KONA 4ZVGA 2V9KA 5D0HA 2YWGA 3M2UA 4J9NA 5LSOA 4O3PA 3AA9A 4USUA 5HROB 3MCSA 4F26A 5KG7A 2HHPA 2KM8C 2IJRA 4F3QA 4C11B 2XWYA 5D3GA 1S6UA 3BB5A 3HD1A 3VQTA 4QPTA 1U47A 2QO3A 1V6HA 4TU9A 9RUBA 1U1OA 2CPHA 4FDFA 4DF4A 1UVJA 1FESA 5E5NA 3SQOP 1U25A 3I82A 4O4GB 1KQSR 3ITHA 3HT0A 1HBUB 3OL6A 2RKIA 4XK8C 5DQGA 2J6TA 3UDEA 4LF6F 2EK6A 1T03B 2IY5B 5GMDA 2WOMA 1HD1A 2PI5A 4ED5A 4B9SA 2IMOA 5GADI 1RAGB 5D4NA 2QLWA 2C3YA 4J37A 5ETRA 3JSRA 2Z4PA 1TFYA 4QIVA 4ECUA 4I2QA 4M5JA 3W9HA 4MTPA 1U1QA 4J9OA 3ISND 2F8MA 7FD1A 2W9CA 2APOA 3TNVA 2UUTA 3CJKB 2RQ4A 4IOAQ 4OLPA 2R7SA 1OY8A 3OJUA 4YHHF 1RHKB 2WK4A 2ZBQA 3CC2S 1WJ9A 1NK5A 2JL9A 1G6BA 5G0RA 2HRUA 1RAAB 5EDWA 3P6YC 4KBIA 4PQAA 2V8HA 4WFNQ 1SKRA 4CP5A 1E6YA 2A6OA 2UUAF 3TAQA 3CCZA 3H20A 4UUWA 1RHJB 3Q24A 1TL7B 4YDDB 2CXEA 1T9XA 4Q43A 1T02A 4FF4A 5K8MA 4OZ3A 3GFXA 3MUVP 5LMUF 4NRUA 4RUHA 4DL7A 4DQPA 4JBCA 4NZ7A 1ZPWX 3MR7A 4DHVA 3CW2C 4LBIA 5THWA 2V67A 3OV7A 1LKZA 3DLGA 2FD2A 1XMBA 1CBKA 5HJYA 4MIAA 2F40A 1T9VA 3OHBA 5DZ7A 1NK7A 4WU3A 5L39A 1ULRA 5KFHA 3M30A 3SMZA 1V3SA 2CNOB 2YVSA 4K2XA 4H4OA 4P10A 5ETPA 3QJJA 3E2EA 1HPZB 2ALYB 2C3PA 1EHWA 4FXDA 4LSLA 2PO4A 3SSQA 2QA4G 4URQU 2IFXA 1IUJA 2ZM6F 2C2ZB 2B4PA 1JKHB 4RR5A
chains in the Genus database with same CATH topology
2IAJA 3FZ2A 3R27A 5D4OA 2RF2A 2R7VA 2IRXA 3OFGA 3M9MB 2GIRA 3FMBA 4QWAA 3BGUA 2MQNA 5FDLA 3KYLA 3KLFB 4OI1A 1LW0B 5EWGA 2RS2A 3MTKA 4I7FA 3BJYA 4I2PB 4DL3A 4PG8A 5K14A 5B0DA 2R7TA 3CD6S 5B0FA 3M8PA 1PO6A 3SQGA 2ZC3A 2FGCA 3P3DA 3NKYA 4KAIA 1FEEA 5IM0A 3GYNA 2EG1A 4DBQA 1YJWS 2BZ2A 1YIJS 3I5BA 1NK6A 3EX7B 3EGNA 2KU7A 5L8RC 4C3LA 4DMZA 3PKMA 1RA7A 4Y6IA 1RYSA 1JLGA 5CCLA 1WG5A 1VRTA 2KKHA 4MKBA 1NH7A 1MSWD 3MD1A 4IDKB 4YR3A 1SUQB 1JLQA 2UXBF 2A2CA 1Q1KA 1XK8A 3TAMA 3I0SA 3N01A 1P9QC 3UD4P 4CCHA 4BC9A 3HHLD 3MWBA 4AQYF 1FNXH 2W25A 1QE1A 2DCLA 1FRKA 2XMKA 2VG5B 2OMLA 4AUKA 4DQQA 3KLVA 2JFDA 4G6VB 2OD6A 3D2WA 1LWFA 2IHR1 2DGOA 4ED2A 2FVPA 2RSQA 4JUZA 2R8GA 1T05A 2Y0SD 2WONA 4OI3A 3DMJA 2ZE2B 3K8VA 1H2UX 4DJBA 3GG1A 3DOLB 1TKXB 4DG1B 3IN5A 4Y28C 3TA0A 2VFSA 1U4BA 3CCUS 4TKTA 1TFWA 3MMAB 2KYZA 1Y5LB 1NEEA 2Z8QA 1KQGB 3AA8A 3MM6B 3VAFA 2V4JA 5JJBA 1OIAA 2DH7A 2QIFA 2ZHAA 2R8IA 2AGPA 3VAJA 2P9GA 4EYIB 3UNGC 3N5FA 5A2QY 2R7XA 1MW7A 4PR6A 2AJ0A 3ZZRA 3PIOQ 1RK8A 5KFLA 1R0AA 3RAMA 4JV5F 4HT5A 4PQUA 2DPJA 5IQQA 2DRBA 2FLLA 1FKOA 3DCAA 2G0CA 1SQEA 1RGVA 2VOOA 2CPXA 1E6VA 1VRUA 4YEAA 5CH7B 2GNKA 5EWEA 3CUNA 3NNCA 1KVIA 2MJNA 4YP3A 5IXUA 1DQ9A 4PWUA 3QGHA 5KFJA 1DHMA 4C8NA 4K4WA 1WF2A 4YB5A 1TP7A 4YY3F 1C1CA 1HYSA 4CTAB 4Y2MA 3BS9A 1VQOS 2XNQA 3DNCA 1L3SA 3QO9B 2AF6A 2XMVA 3I5CA 4RW4A 2PN6A 4JI2F 3JTPA 1WNEA 1ZETA 2BACA 5SZTA 2VBXA 4RWXA 4YDXA 3PR4A 1UETA 3MEKA 2CQ2A 2NLWA 4IFVA 2MB0B 3H2LA 2AW0A 2CPZA 3Q2TC 4YB6A 2OSQA 3O5TB 1VQMS 3GV8B 1AROP 4E98A 5FLXY 1OO0B 4K4XA 2B5JB 1BY9A 3CDUA 3CCWA 1K1SA 4KGMA 1VQ5S 1S1WA 1UL3A 2W9BB 2BXJA 3T1YF 3H8YA 2J7UA 3IG1A 5KFBA 3DRPA 3L09A 2FHOB 1S1XA 4B3OA 2HVHA 5KFXA 1TL5A 2ROGA 3W2VA 3OXFA 1VJWA 1QAIA 3MMJA 1LV5A 4B9LA 4IH6A 2M0GB 1M1KT 2NSCA 3BGFA 5KG3A 3HXMA 1WG4A 3IA0A 3KK2B 2ZH5A 1DRZA 1VC6A 1Y5NB 3BN7A 5D78A 2OD4A 3G8QA 3WBZA 2K1RA 3VZIA 2RE1A 3M8RA 4ES3A 2R2TA 2E7WA 2HFZA 3KOAA 1X0PA 2GHPA 3HHKA 3PO5A 4DFJA 2XULA 4NLPA 4MK9A 3D1QA 3KNGA 3MHYA 2YX1A 4PCQA 4ZVEA 4RW6A 3C2PA 2K3IA 2C3UA 4QQBA 3TYTA 4F50A 4ZCLA 3CC4S 3CD0A 3I32A 5CHCB 2DRAA 1C1BA 1S9GA 2BA9A 4IH7A 5T7LB 1RT7A 2RT3A 4OIXA 2XWXA 2CPYA 2IC3A 4J9PA 2CJKA 3CPWR 1KLMB 4RW7B 4LIWA 4YOEA 3I9ZA 3LP0B 2ZNYA 3I87A 3UCGA 4X65F 2R7WA 1WD6A 2YNFB 1H98A 2JSXA 4CT8A 2E66A 2MQPA 5GAHU 2EW9A 4CH0S 1C4CA 5DRKA 1K73T 1BWEA 3GZ7A 1KSPA 3DHWC 3MPWA 1DTQB 2R7QA 2IVFB 1J2VA 3CGIA 4J9SA 1S0MA 2FJWA 4PWDA 5CCMA 2HWIA 2IVMA 4KSEB 2M5YA 1H7WA 5LSLA 3NP5A 4NXMF 2RU3A 3LH2S 2CQCA 1QVFR 3NRBA 4ETXA 3DLBA 1F9FA 4K4YA 2PGCA 2DNOA 2ROPA 3DHXA 3H5XA 2GGPB 2OJ3A 2LXFA 4EBEA 1GNKA 3B8HA 1U1RA 4C8ZA 5F8NA 4EO8A 5KFQA 5CYQB 4B17A 1VC0A 4TYBA 5J2PA 1HA1A 1VK8A 1SH0A 3M1VB 2CQGA 4CO4A 2ZH6A 4ED6A 4ZPCA 1ZYQA 1VQ4S 4QBUA 1KQKA 3D1OA 2HVZA 3CXCR 2RKIB 4B9TA 3IS9B 4ZPAA 2WCXA 3OPKA 3T6JA 1N36F 1RT5B 2V0NA 4ZP6A 3B4DA 3PNIA 3E8OA 3OL8A 2BQRA 5HMZA 4DR2F 5IFMA 2IRYA 3QZ8A 2JRSA 5L1LA 4X4TA 2XGQA 3BGLA 4FBUA 5D77A 2YNHA 4BHQA 4NLXA 1S0NA 4KTQA 1QJHA 1S4FA 3CTRA 3T6BA 3NG8A 1RT2A 2OP5A 2CQIA 1HNVB 5D4PA 3JTOA 3HVRA 1P1TA 2QYCA 2J9DE 2OPPA 1RTDA 5CYMA 2PIIA 5DM6Q 1HW9A 4OL8A 1M5HA 5L1JA 1HI1A 3O2IA 3U27A 1YI2S 2IMWP 1FDBA 1TVRA 3MAHA 1FTRA 5KFNA 1M5OC 2PD1A 4R0EA 3M9OB 3MDFA 3QAUA 2OPQB 2Z2LA 1S97A 4CZCA 1HNZF 2Q79A 4R8UA 3LGNA 5HQ8A 2MQMA 1S6PA 4N8OA 2BOPA 2IM0A 3KJVA 2FJXA 3M32A 4X4SA 2Y1RI 3HVTA 3PX4A 4NLWA 2E29A 4C3KA 3FVYA 4C97A 3G8TA 3OLAA 1X5PA 1URRA 1XNRF 3OQ2A 3IBWA 3HMJG 1SJRA 3WDOA 4A8KA 2RUGA 4BBYA 2D3UA 2Y1JA 1Q78A 3FJ2A 1ZTWA 3MEEA 3R5DA 1TL3B 1U6FA 1XMQF 1HR0F 1XERA 4ES2A 1XTZA 3TA2A 1JMTA 2KT3A 1RKJA 4Y2IA 4U7UK 2CQBA 4GO5X 3M6XA 2NUUG 5J2MA 2X1GA 5MLCV 2HIQA 2KN4A 5E3RA 1ZH5A 2YKPA 3LP1A 3MMCA 4LUBA 1TKZB 1S0VA 1UMJA 3V4IB 4C8KA 3J7YI 5C42B 2LU1A 2MZQA 3FFIB 4NLDA 4M5DA 1O0PA 4QW9A 1RT3A 3KHGA 3W2WA 4J9RA 3BR8A 1JX4A 4N8NA 2QRRA 5KFVA 1LFWA 3PHEA 1R3NA 2RRAA 1L5UA 2R4FA 4NYZA 2RU9A 3NBPB 2P9EA 3CT9A 4EYHB 1YQHA 1HBMB 3HVWA 3R3TA 4Q5VA 1Y3JA 3CJ4A 3OTCA 3SZ2A 1JJ2R 5J1EA 1WEXA 3R5AA 5J2QB 4QU6A 1GX5A 4OQJA 1RQ0A 2KXFA 2K3KA 2AU0A 1B7FA 5C25B 1IKYA 4PPZA 3QJPA 2KDOA 2UVWA 3H4BA 1DTTA 4Q8FA 4ZHRA 1A9NB 2DD8S 3QWUA 1HNWF 1IKXB 3OR2B 2R2UA 4DL5A 3J80Y 1IN0A 1JLFA 3N4WA 4MK8A 1CG2A 1LWCA 3DDKA 3HF5A 4FS2A 5DO2A 4XPEA 1Q4RA 4ZPVR 5FJ4A 4J9KA 3KG4A 4K4ZA 4RNHA 2OLWA 4Q0BA 2BE2B 1SKSA 5BYQA 4IG3B 1YGYA 4NMLA 3MEDB 4C2MA 1D3WA 3THTA 5GAGU 2GX8A 3QJLA 2FGOA 4QIGA 5A8KB 2GJIA 2JHEA 2L48A 1Y5IB 3KKFA 4RLEA 1VQ6S 1SB6A 5DDQC 3DU5A 2I5JA 4RUCA 3KHHA 2ZD1A 4M63A 1PILA 2LDIA 1YJNS 2FJDB 3EPGA 3OTDA 4QOTA 2KT2A 1VHFA 4IRKA 4KO0B 1IJEB 2EC0A 2DNNA 2ZH7A 1RDRA 2NQPA 2C2DA 5J1NA 4WFYA 2NUHA 4IYQA 4Y65A 5F9NA 3NS6A 3MM5A 4TU7A 3JYTB