1FJPA

Nmr solution structure of phospholamban (c41f)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
b'MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILIFLLLICIIVMLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIAC PHOSPHOLAMBAN
publication title NMR Solution Structure of Phospholamban
pubmed rcsb
molecule tags Membrane protein
total genus 14
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fjpA00
2M3BA 2KB7P 2KYVA 1FJKA 2HYNA 1FJPA 1N7LA 1ZLLA
chains in the Genus database with same CATH superfamily
3C1LA 1J1EB 1QLED 2OYIA 1SQQE 1K73Q 5DJTB 1K05A 1KILD 3VYIA 2Q7CA 1KB9H 2PAJA 2M0BA 2R3CA 5H2FH 2ZYAA 1SQXE 3M0DC 5B66E 3NFQA 1CW5A 1OFCX 1GK6A 4Y99C 4EIJA 1N7SA 3H1HG 4U7JA 1PV3A 2WSFJ 5KKZC 3CD6P 1MUUA 2M5AA 5APSA 3V2RA 1CZQA 2H88C 3AE6C 3HE4A 1FJKA 1VQOP 4ASWA 2IBZE 3CCVP 1EDKA 3AE2C 1GD2E 4RKUJ 1L4AA 2D2CC 3RK2C 2HPCB 4I7ZC 1NTZK 3GHGC 4GOFA 3SSUA 3H1JD 1LTAC 3CXHH 1S9KD 3RK3D 2P7JA 2RKLA 3VTPC 2KS1B 3CCJP 1AA0A 1SQVG 3Q1MA 3EFFK 2QJKB 5DJUB 3CX5E 1YBKA 1HJ0A 1ZMEC 1U7MA 2WPVB 1M1JC 3B5NB 3NMDA 2V4HA 2N1TD 1URQD 2FYUK 1L0LD 4DCKA 1KB9I 1PGJA 5KLVD 4YXDC 3P8CD 1GW4A 2IX7C 1QGKB 3Q5PA 4PV1D 3KPEA 3TF5A 2PP6A 2SPZA 3CMEP 4OGQB 3GG2A 1BE3D 5KJ7A 1DD3A 1FC2C 5APYA 5GTIH 1SQQD 2HYNA 2W6JH 3KZIH 3BRTB 1AQTA 3VOPA 1FS0E 4WY4D 1PP9G 3R4YA 2NPSD 3I5CA 1PGQA 1SQVE 5AW0B 2M3BA 3PHLA 2HPCA 1DIPA 2JR8A 3M06A 3TNUB 3CWBJ 5CCHC 3G9RA 4JQ0D 1X9VA 1YI2P 4EI2A 1OW7A 5KAFE 4L74A 2KS1A 1FOSF 3L72E 1NGMB 3LW5J 2QJPC 1DH3A 4AQRD 1BSNA 3CCRP 2FYZA 5B5EE 3B71A 2FXPA 5L8RJ 1VL2A 4O9BA 1MFZA 4HYTB 5H2FE 3QH9A 1KILB 2NRGA 3AE7C 1JCCA 1QVFO 4ZNCA 3H1HD 2WSSH 1TU3F 1RF0A 4PD4H 3TGUE 4W7YA 2N9BA 1QX8A 1NTKE 3L4FA 4DOJA 1RE3C 2G3AA 2LR2A 1W5CE 4C7RA 3RK2B 3PLNA 3BVHA 2O01J 3AE9C 3HUSC 1SLQA 3R2PA 1N7LA 2FYUE 3L73J 2KIKA 2WTYA 3SFDC 3JC22 2XV5A 1SQVD 1KV4A 1GL2C 3USSA 2QSIA 1KILA 1NU1K 2L91A 3M0DA 2J5UA 2ZJSE 3MUDA 1JCDA 3LIDA 4WBAA 5AVWB 3PJSK 1DEBA 3TSIA 3PH0A 3H1IG 1M56D 3BCCJ 1LT1A 2N1TB 5BU5A 1PZQA 2KB7P 2E74B 3C8VA 4NPEA 1X8YA 5CJ0A 1RF1C 2R5BA 1LNQA 2Z5HA 3HD7C 4PD4I 4H13C 2IZ0A 2UWJE 4IFFA 2QA4P 1L2PA 1PP9D 2IZ1A 2ZVNB 2OTLP 1JTHB 4WY4B 1N7SD 2NPSB 3Q5RA 2O1JA 3L74E 1L0NK 1SQBG 2POHA 1Q2NA 4MN4C 2QVAA 5CBOA 4IOIH 4D6TG 3E1IA 2C9LY 1KYOI 1H0TB 3KHUA 2AEJA 1YQ3C 2M8RA 4H0LD 1IFDA 3ABVC 1FU1A 4YXWH 2HFED 1ZRTE 2E5YA 3Q2YA 1HVVA 1GMJA 3N7NA 1EXIA 2QM7A 4H44C 2N1TA 1ZW0A 1AV1A 1IC2A 4U3FE 1BGYG 5CHXA 1T6AA 1IFMA 2A06E 1NTZJ 3TGUJ 2JO1A 3RL0C 3FWNA 1NTMK 1JTHA 3WUUA 2ITAA 1EZVE 2OGUA 4WY4A 3V2PA 3KDPB 5BVZA 1LT9B 5AVYB 2NPSA 2I1JA 1RY3A 5AVSB 1LWUC 2Z4EA 3VP9A 3IN6A 5KJ7D 1T2KC 4B86A 1L0LK 1PGPA 3HUSB 2FXMA 1OXZA 3BRVB 2FYUJ 1H0TA 2WITA 4EOTA 3E1RA 3JCUH 2B9BA 4ZKPA 1FZGA 3L70J 1GK4A 2XZRA 1P84E 1FOSE 4IL6E 2C0XA 3H1ID 3GW6A 2GA1A 1T3UA 3H25A 3CL3D 1NVOA 5GTHH 3HD7B 4H13B 2ZT9C 1ZRTD 4HH2A 3CWBG 3L37A 1NYHA 3AEEC 1LT9A 3G3ZA 2BASA 4EDFA 3A0HE 2Y0DA 2IFMA 3U1CA 2FFDC 2ZAEB 3S9OA 3HUSA 1JB0J 3V6IA 5CMZA 3IFMA 2XKMA 3AEBC 1SQBD 4JYBA 5APUA 3II6A 4N6JA 4YTPC 4D6TD 4JPZB 1YQ4C 1OVVA 2OYHC 1PPJE 4GKGA 1SQXG 2FYNC 2QJYC 2W6BA 3AEDC 1ZP0C 2Q6QA 4H0LB 4KJMA 1NTME 5BU8B 2WPSA 1T3JA 1JM0A 3CPWO 2H8PD 2J58A 4JBZA 1SQPK 3RL0g 3AE4C 2IBZG 1M1KQ 4UB6H 4U3FJ 3HD7A 1BGYD 4DZOA 1UIIA 1HH0A 2BCCJ 3FX0A 1NOHA 2WMMA 4W80A 1YIJP 1S2EA 1X0TA 3WU2H 3MTUE 1S1CX 4KHXA 5AW8B 1J1DB 3U1AA 2WPRA 1HWTC 1N73B 2WSEH 1BCCE 4I1LA 2P1JA 1NU1J 1JY2O 1BDDA 1Q82Q 1KQGB 2E76C 3A0BE 3EQ2A 3RK2D 1MKMA 4A7PA 1K8AQ 2O1KA 2P10A 5AW1B 2YKPA 3M91A 1U7JA 1RE4C 2AEMA 4GIFA 5CJ4A 1OW6A 3A2AA 2E5TA 1EXJA 1NKNA 3IF4A 1R5SA 3L73E 1ZOYC 3FXEA 2RN0A 5CBNA 3AEFC 1S72P 1XTGB 1L0NJ 2JJLA 1LJ2A 2O3JA 1KQSO 1KQFB 3AEAC 3CWBD 1IK7A 1N73A 4XA4A 3H1LJ 2E74D 3H32B 2CPBA 1VDFA 5TISH 3BCCE 2OYOA 1QL2A 4IFDK 3L72G 2M3EA 4WB4A 3S1KA 4N3YB 2H43A 1Q7YQ 2AXTE 1VQLP 3MHVA 4ZMDA 1R5LA 1S3JA 2E75C 4K3AA 1URQC 3VMYA 4M3LA 3H6PA 3MD0A 3S4RA 1SQXD 2JWDA 2N9YB 1YYCA 2QRXA 5CCGC 4PV1C 2YIUB 3GLMA 4LC1A 5AVUB 1NTMJ 5AW6B 3TGUG 2R5DA 1VF5C 2KSEA 3B4SA 1IFPA 1SFCB 1NTKG 1EC5A 2IBZD 3CCSP 1ZLLA 4OWFA 1L0LJ 2KZIA 1YHQP 2KLUA 1NO4A 1FZAA 1QEXA 3H32A 1KORA 2YO3A 2P67A 2JP3A 1KB9E 1DEEG 1K9MQ 3W67A 1BE3J 1IFNA 2XNXA 4BXLA 2FYUG 1BCCJ 4Y99B 4I6MC 1JMMA 1KFMA 4WWIA 2ZYDA 5KKZB 1PL5A 2AXCA 1NTZE 4UB8H 3B8EB 1SVFA 2C0WA 1VQMP 3CX5D 2WWWA 3L70G 3BASA 2OYHA 1AVOA 2WQYC 3LIEA 2LXBA 4Y28J 1DD4A 1OZHA 3L75E 2D2CB 2W6AA 3OJAB 3BCCD 3HE5A 5TJHA 1WRGA 4I7ZB 5E79H 2Y0EA 3KYQA 1N8RQ 1E79H 2ZXXA 3GHGB 5AVXB 2I8DA 1SFCA 4L73A 3CXHE 1GZLA 1KYOH 3M0AA 4L75A 1QL1A 3MZWB 1FZCC 2QIWA 1HTLC 1GL2D 1SQBK 2P58A 1Y47A 3L70E 1FBMA 4AUWA 2Q3IA 3L74G 1M1JB 3L35A 1HF9A 1YJ9P 3H1HJ 3CI9A 1R8EA 1FZFA 4K35A 2W83C 3L72D 1RQUA 1T8ZA 3HD7D 4LLHA 4H13D 3M9BA 2B88A 4GDOA 2FXOA 3AE5C 5KLIC 4ASVA 5GTIE 1Q90D 2WT7B 2MJZA 3KZIE 1NH4A 1MFTA 5AVVB 3M9QA 3V2NA 1EDIA 2JEEA 2Y9YA 1FDOA 2K9YA 1SQPJ 3W68A 1OW8A 1LTJC 1S5LH 3GHGA 2K9JB 4XE5B 2OYIC 4U3FG 4C7NB 1M57D 1IFIA 2A06G 3BATA 4QMAA 3TGUD 5EFWB 2KXPB 1NTKD 2QJPB 1EZVG 1YTZI 4N78E 5AW9B 3V4QA 1KN7A 1N7SC 1M1JA 2G8YA 4H44D 3GMAA 2WPQA 1ZR4A 1YJNP 2KP8A 3QWOC 3H1KJ 1LTSC 2W27A 4PJ0H 3FWLA 1X79B 2WSEJ 3OW2O 2FYUD 1L4AC 2CK3H 3G4SP 1PP9J 2WT7A 4R4MA 4PD4E 1H88A 3L71E 2Q9IA 1KZUB 3MGNA 2BCCE 2KOGA 2R44A 3L70D 1P84I 3G71P 3JSVC 3L75J 1J1EC 2FY8A 1EDLA 3ZDMA 2K9JA 2K3RA 5CCHA 3U59A 4C7NA 1NU1E 2YMKA 1LTBC 5KLVK 1L0NG 3SFEC 5B66H 4TT3H 3I56P 1KYOE 1Q86Q 1OX3A 2O01N 3AE3C 2Q3EA 3CCEP 3H1LG 2DW3A 1SQQK 1GL2B 1VQPP 4YPCA 2JDIH 1BSHA 5KJ7C 3FGAD 2IPPA 3L74D 1OVRA 1Y8AA 1SQXK 2YXRB 3V4WA 1FZBA 1M90Q 1Q81Q 5AVRB 1KQLA 1KILE 1A02J 1VPCA 3GF3A 2ZT9D 1PPJG 1RF1B 3L36A 2I1KA 2YNYA 1L0NE 2IDBA 5KAIH 1RE3A 3TK1A 4EYYQ 1VQ4P 1NTMG 3D6ZA 1EDJA 3H1LE 2H89C 1S5LX 3RGUA 2JKVA 2H7HA 3A5TA 2QJKC 1S5LE 3CC7P 4I2LC 1JEKA 2XDJA 3AE8C 1N86A 2YKQA 4U3FD 1H8AA 3B5NC 2A06D 3I55P 2GUVA 3F5HA 1M8OB 2K1AA 2HODB 2A45G 1EZVD 3TDKA 1JOCA 3SWYA 1GL2A 2MKVA 4OGQC 2E42A 5APXA 4OVNF 3G6EP 1HGVA 1BCCG 3H1JE 1S9KE 2L5GB 3H1IJ 3RK3E 3F89A 1SFCD 1XTCC 2IYPA 4H44B 3CCUP 2FBWC 2IBZI 1LTIC 2VRSA 2KNCB 1RF1A 1AFOA 1MZ9A 1A02F 2WSCH 4ZKUA 1ZR2A 3L71J 1L0LE 1NAYA 5AVZB 4RO0A 3RL0B 3P8CE 2KI7B 2YKOA 2BEQD 3VMZA 3CCLP 3EWKA 4GODA 1OIPA 1SQVK 1BE3E 2V7QH 1P84D 1LWUB 1SQBJ 5AW4B 3L73G 2YMYA 5B5EH 4D6TJ 3CX5I 3CLQA 2E76D 1GW3A 1KILC 1L0ND 3VP8A 5M1BA 2HODA 3MP7B 3MUDC 1YTZT 2D2CD 3JCUE 2R32A 1VQ5P 1CI6B 5APVA 3H1LD 3SWFA 3BCCG 1FJPA 3O8ZA 1M7LA 2HR3A 1BGYJ 3OA7A 2KNCA 2W90A 1JY2P 4OH8B 3MIWA 1NKZB 1SQPG 1NHLA 1PPJD 1QVGO 5GTHE 2YXQB 3AEGC 2ZT9B 5KAIE 2Y9ZA 3CCQP 1NTKK 2QG4A 1VQ9P 1BDCA 1LWUA 3H1HE 1NTMD 2Q1KA 2B89A 1U57A 2FFDB 3RK3C 5KTBA 3P7KA 2OTKE 3EFGA 2Z5IA 2E75D 1ZN5A 3TYYA 1G2CB 1CI6A 2N1TC 5CCGD 2PRRA 2E74C 3H1KG 3O6QB 1SQPE 2OYHB 2FYNB 2QJYB 1AVYA 4L76A 4IFMA 5CCHD 3M9HA 3H1JJ 1BCCD 1S4XA 1VF5D 3GF7A 2JWAA 1USEA 3HE5B 3OAKA 1IO4A 1NTZG 4GT1A 4WY4C 2WZ7A 3A7OA 1VQ6P 3UIAA 2NPSC 4UB6E 2KSJA 2KLVA 3L75G 5KLVJ 2XNDH 3WU2E 2WVRA 3H1KE 3CXHI 2FFDA 1OMIA 1RH5B 2RH0A 1PGOA 1FAVA 1SQQJ 2QM8A 1PFIA 3L73D 4JF7A 1IFJA 3B5NA 3RBZA 3V2QA 1PP9E 1Y9BA 1G2CA 1SQXJ 4JYCA 5APQA 5APTA 1JY2N 3O6QA 1K04A 1MV8A 2E76B 2YO2A 4RESB 4CPGA 1IJDB 3AE1C 2GM4A 5AVTB 3PP5A 3PRJA 4HB1A 1GTWA 4HKZH 1KD1Q 3RBXA 1DX7A 1HJBA 2HG5D 1H89A 1LT9C 3TNUA 2HLOA 1WT6A 1HBWA 3KXDA 1ZXGA 1EQ7A 3V5BA 1SQPD 5AW7B 1W2EA 2WSFH 1SS1A 1KFNA 2KK7A 3VMXA 2QE7H 2RMZA 1J2JB 3IAOA 3NXSA 2NZ2A 3ITKA 2KUBA 2B87B 2OTJP 5K5GB 5TISE 3RK3B 3N4XA 1LP1B 2IYOA 4LGDE 3WUTA 2Q5UA 1P84H 2E75B 4IL6H 3D71A 1JNMA 1URQB 1W2BO 1G1JA 4WVZA 3H1KD 2CPSA 1KB9D 2C9NY 1RE4A 5AW5B 1VQ8P 1LGHB 4R4LA 4PV1B 4W7ZA 1FDIA 3AECC 1JY3O 3CCMP 2E43A 1OWAA 1GU5A 2R3SA 2ZFCA 3A0HH 1NTZD 1VF5B 3L71G 1EZVI 2BCCG 1SQVJ 2P2UA 5AVQB 1Z56A 2WSCJ 1GDTA 3L75D 2IFNA 2PFXA 3P8MC 3H1IE 1KC8Q 2OARA 2BEZF 1NWQA 2B87A 2K88A 3L72J 1NU1G 1L4AD 1D7MA 3NTNA 2V7QJ 1JY3P 1AQ5A 3CXHD 1KMIZ 1LP1A 2K37A 2LKMA 1X22A 1NJIQ 3VN0A 3RL0D 4H0LC 4UB8E 2KYVA 1FZEA 2PGDA 3HTKB 1YITP 1N2DC 4Z1MH 1URQA 3K5BA 1G1IA 1JMBA 1HUCA 1LTTC 4GOEA 5CCGA 3LW5H 1CSBA 4TLFA 1T2KD 4AYCA 1SQBE 5E79E 4D6TE 1NTKJ 3P32A 4DT0A 2A45H 1J1DC 1RQVA 2LXCB 1N73C 3D70A 1FZCB 3SWKA 2W8ZA 1VQ7P 1PIXA 4RJTA 3Q5SA 4BRYB 1FDMA 1KTMA 1E5WA 3WMM0 2J59M 3A3YB 3VMAA 1OVUA 2AEFA 2QEXP 1VQKP 5C39A 3KQGA 3A0BH 1WMKA 3CC4P 3CC2P 1BGYE 4HJGH 5AW3B 1UIXA 4BWNA 4C46A 3HTKA 2O01H 4N78D 5KLIB 4IL6X 3HRNA 3PTZA 3H1JG 3Q3DA 3IR9A 1NAFA 3T97B 1LTJB 3B5ND 3FXDA 3CX5H 3C9IA 2OYIB 3WUVA 1JY3N 4NPDA 4PD4D 5APWA 1FZCA 1L0LG 3CMAP 1IK9A 2ZYGA 3L71D 5KLVG 2A45I 4KT0J 1JUNA 2BCCD 2KZJA 4OGQD 4BRYA 1GU4A 3L74J 2XU6A 1VQNP 1BE3G 1N7SB 1LTGC 2AXTH 1SQQG 1ZV8A 3D6YA 2GUSA 1RF0C 2M5AB 4XFJA 1NU1D 1FE6A 2ZXEB 3HE4B 4PJ0E 1YJWP 1SP4A 1KYOD 1L4AB 5AW2B 1IZNB 2Y0CA 2YIUC 2OQQA 3CWBE 3E7KA 4DJGA 2ZVOB 5KAFH 1USDA 5KLVE 3T97A 1HGZA 2FKWB 1RHZB 1AJYA 1SFCC 1JO5A 4NPFX 1LTJA
chains in the Genus database with same CATH topology
2FXMA 1J1EB 1OXZA 3HE5B 3BRVB 1T8ZA 3OAKA 3HD7D 2WITA 4LLHA 1IO4A 2OYIA 3M9BA 4EOTA 1KILD 4GT1A 4ZKPA 4WY4C 2WZ7A 3A7OA 3VYIA 2WT7B 2MJZA 3UIAA 2NPSC 1NH4A 5AVVB 2Q7CA 2PAJA 2R3CA 2KSJA 3M0DC 3M9QA 3V2NA 1FZGA 2KLVA 2JEEA 1GK4A 3NFQA 1CW5A 1GK6A 4Y99C 4EIJA 1N7SA 2XZRA 1LTJC 1FOSE 3GHGA 2FFDA 4XE5B 2C0XA 2OYIC 1MUUA 5APSA 3V2RA 4C7NB 1FAVA 1CZQA 1IFIA 2QM8A 3BATA 3HE4A 1PFIA 1FJKA 4JF7A 1T3UA 1IFJA 3B5NA 3CL3D 1GD2E 3V2QA 1L4AA 3HD7B 4HH2A 1YTZI 1G2CA 4N78E 3L37A 4JYCA 5APQA 5AW9B 1LT9A 3V4QA 5APTA 3G3ZA 3RK2C 1JY2N 2BASA 1N7SC 2HPCB 1MV8A 2YO2A 1M1JA 1NTZK 4RESB 2IFMA 3U1CA 3GHGC 2FFDC 2WPQA 1ZR4A 2KP8A 1IJDB 1LTAC 2GM4A 5AVTB 3PP5A 3HUSA 1S9KD 1LTSC 3RK3D 2W27A 1GTWA 2P7JA 5CMZA 1X79B 3VTPC 3IFMA 2XKMA 1DX7A 1HJBA 1L4AC 2HG5D 4JYBA 1H89A 5APUA 3II6A 4N6JA 2WT7A 1LT9C 1H88A 3TNUA 1LTJA 2Q9IA 1KZUB 2HLOA 4GKGA 2OYHC 1WT6A 1HBWA 1M1JC 3B5NB 3MGNA 2KOGA 3NMDA 2N1TD 1URQD 2FYUK 2W6BA 1EQ7A 3V5BA 5AW7B 1W2EA 2WSFH 1KFNA 3P8CD 1GW4A 2IX7C 3VMXA 1J1EC 1J2JB 3KPEA 5BU8B 2WPSA 1T3JA 2PP6A 3NXSA 5CCHA 3U59A 4C7NA 5KJ7A 2H8PD 5APYA 2J58A 2HYNA 1SQPK 3BRTB 3RK3B 3N4XA 1LTBC 5KLVK 3VOPA 4WY4D 3HD7A 4DZOA 2NPSD 1HH0A 3I5CA 5AW0B 1NOHA 2M3BA 4LGDE 4W80A 2HPCA 2Q5UA 3M06A 3MTUE 4KHXA 1SQQK 3TNUB 5AW8B 1J1DB 3U1AA 2WPRA 5CCHC 1HWTC 1GL2B 1X9VA 1JNMA 1URQB 1G1JA 1N73B 5KJ7C 2CPSA 2WSEH 2C9NY 1RE4A 2IPPA 1SQXK 4I1LA 5AW5B 1LGHB 1FOSF 3V4WA 2P1JA 1FZBA 4W7ZA 1JY3O 1JY2O 1DH3A 5AVRB 1KQLA 4AQRD 1A02J 1VPCA 2E43A 1OWAA 1GU5A 2ZFCA 2FYZA 3EQ2A 1RF1B 3L36A 2I1KA 2YNYA 3RK2D 4O9BA 2P2UA 1MFZA 4HYTB 5AVQB 1Z56A 2O1KA 1RE3A 5AW1B 1KILB 2YKPA 3M91A 1JCCA 3TK1A 1RE4C 1GDTA 2IFNA 4GIFA 5CJ4A 3P8MC 3A2AA 1NKNA 2OARA 2H7HA 3A5TA 1NWQA 4I2LC 1L4AD 1RF0A 2XDJA 3NTNA 1N86A 2YKQA 4W7YA 1H8AA 1JY3P 2N9BA 1AQ5A 3B5NC 1XTGB 3L4FA 4DOJA 2LKMA 1RE3C 3VN0A 2JJLA 3RL0D 2GUVA 2HODB 2KYVA 1FZEA 2A45G 1JOCA 3HTKB 3SWYA 4C7RA 1GL2A 3RK2B 1N2DC 1URQA 3BVHA 2E42A 5APXA 1N73A 4XA4A 3H32B 1G1IA 1HUCA 1HGVA 1LTTC 2CPBA 1VDFA 1S9KE 2L5GB 3HUSC 5CCGA 1SLQA 3LW5H 1N7LA 3R2PA 1CSBA 1QL2A 4IFDK 1T2KD 4AYCA 1SFCD 1XTCC 4WB4A 2WTYA 1LTIC 2VRSA 4N3YB 2H43A 2XV5A 3P32A 1RF1A 1AFOA 2A45H 1J1DC 1MZ9A 1A02F 2WSCH 4ZKUA 1GL2C 1URQC 1ZR2A 1N73C 1KILA 1NU1K 3VMYA 3M0DA 1FZCB 4M3LA 3H6PA 3MD0A 5AVZB 3RL0B 3P8CE 3MUDA 1JCDA 1YYCA 5CCGC 3LIDA 4WBAA 5AVWB 2YKOA 4LC1A 5AVUB 3VMZA 1FDMA 1DEBA 3TSIA 1E5WA 3WMM0 2J59M 3A3YB 1SQVK 2N1TB 5BU5A 2KB7P 1LWUB 5AW4B 5AW6B 2R5DA 1X8YA 3KQGA 2YMYA 5CJ0A 1RF1C 2R5BA 1SFCB 3HD7C 2Z5HA 3CLQA 4IFFA 1GW3A 1KILC 5AW3B 1ZLLA 3VP8A 4C46A 2HODA 3HTKA 1YTZT 2O01H 1JTHB 4N78D 4WY4B 2R32A 1NO4A 3HRNA 1FZAA 1N7SD 1CI6B 3H32A 5APVA 2NPSB 2YO3A 2P67A 2O1JA 3SWFA 1L0NK 3IR9A 1IFNA 1NAFA 2XNXA 2POHA 1FJPA 3O8ZA 4Y99B 1M7LA 4I6MC 1JMMA 1KFMA 1LTJB 3B5ND 3OA7A 3E1IA 2C9LY 3C9IA 2OYIB 3B8EB 1SVFA 2C0WA 1JY2P 1JY3N 2WWWA 2M8RA 4OH8B 3MIWA 1IFDA 3BASA 1FU1A 5APWA 1NKZB 1FZCA 2OYHA 1IK9A 2HFED 1NHLA 2A45I 1JUNA 1HVVA 3LIEA 3N7NA 1NTKK 1GU4A 2QM7A 2W6AA 3OJAB 2XU6A 2N1TA 3HE5A 1LWUA 1N7SB 1WRGA 3KYQA 1LTGC 1ZV8A 3GHGB 2GUSA 1RF0C 3RK3C 5KTBA 3P7KA 2FFDB 5AVXB 1IC2A 1SFCA 5CHXA 3EFGA 1IFMA 2ZXEB 1GZLA 3M0AA 3HE4B 2Z5IA 1QL1A 1SP4A 1FZCC 3RL0C 1HTLC 1GL2D 1NTMK 1L4AB 1SQBK 5AW2B 1JTHA 1ZN5A 3V2PA 4WY4A 3KDPB 3TYYA 1G2CB 5BVZA 1CI6A 1LT9B 5AVYB 2NPSA 2I1JA 2N1TC 5CCGD 1RY3A 5AVSB 1FBMA 4AUWA 1LWUC 2Q3IA 2OYHB 2Z4EA 1M1JB 4IFMA 3L35A 5CCHD 3M9HA 3T97A 1HGZA 3VP9A 3CI9A 2FKWB 5KJ7D 1FZFA 1T2KC 4B86A 1SFCC 1JO5A 1L0LK 3HUSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3B A;  2KB7 P;  2KYV A;  1FJK A;  2HYN A;  1FJP A;  1N7L A;  1ZLL A; 
#chains in the Genus database with same CATH topology
 3C1L A;  1J1E B;  1QLE D;  2OYI A;  1SQQ E;  1K73 Q;  5DJT B;  1K05 A;  1KIL D;  3VYI A;  2Q7C A;  1KB9 H;  2PAJ A;  2M0B A;  2R3C A;  5H2F H;  2ZYA A;  1SQX E;  3M0D C;  5B66 E;  3NFQ A;  1CW5 A;  1OFC X;  1GK6 A;  4Y99 C;  4EIJ A;  1N7S A;  3H1H G;  4U7J A;  1PV3 A;  2WSF J;  5KKZ C;  3CD6 P;  1MUU A;  2M5A A;  5APS A;  3V2R A;  1CZQ A;  2H88 C;  3AE6 C;  3HE4 A;  1FJK A;  1VQO P;  4ASW A;  2IBZ E;  3CCV P;  1EDK A;  3AE2 C;  1GD2 E;  4RKU J;  1L4A A;  2D2C C;  3RK2 C;  2HPC B;  4I7Z C;  1NTZ K;  3GHG C;  4GOF A;  3SSU A;  3H1J D;  1LTA C;  3CXH H;  1S9K D;  3RK3 D;  2P7J A;  2RKL A;  3VTP C;  2KS1 B;  3CCJ P;  1AA0 A;  1SQV G;  3Q1M A;  3EFF K;  2QJK B;  5DJU B;  3CX5 E;  1YBK A;  1HJ0 A;  1ZME C;  1U7M A;  2WPV B;  1M1J C;  3B5N B;  3NMD A;  2V4H A;  2N1T D;  1URQ D;  2FYU K;  1L0L D;  4DCK A;  1KB9 I;  1PGJ A;  5KLV D;  4YXD C;  3P8C D;  1GW4 A;  2IX7 C;  1QGK B;  3Q5P A;  4PV1 D;  3KPE A;  3TF5 A;  2PP6 A;  2SPZ A;  3CME P;  4OGQ B;  3GG2 A;  1BE3 D;  5KJ7 A;  1DD3 A;  1FC2 C;  5APY A;  5GTI H;  1SQQ D;  2HYN A;  2W6J H;  3KZI H;  3BRT B;  1AQT A;  3VOP A;  1FS0 E;  4WY4 D;  1PP9 G;  3R4Y A;  2NPS D;  3I5C A;  1PGQ A;  1SQV E;  5AW0 B;  2M3B A;  3PHL A;  2HPC A;  1DIP A;  2JR8 A;  3M06 A;  3TNU B;  3CWB J;  5CCH C;  3G9R A;  4JQ0 D;  1X9V A;  1YI2 P;  4EI2 A;  1OW7 A;  5KAF E;  4L74 A;  2KS1 A;  1FOS F;  3L72 E;  1NGM B;  3LW5 J;  2QJP C;  1DH3 A;  4AQR D;  1BSN A;  3CCR P;  2FYZ A;  5B5E E;  3B71 A;  2FXP A;  5L8R J;  1VL2 A;  4O9B A;  1MFZ A;  4HYT B;  5H2F E;  3QH9 A;  1KIL B;  2NRG A;  3AE7 C;  1JCC A;  1QVF O;  4ZNC A;  3H1H D;  2WSS H;  1TU3 F;  1RF0 A;  4PD4 H;  3TGU E;  4W7Y A;  2N9B A;  1QX8 A;  1NTK E;  3L4F A;  4DOJ A;  1RE3 C;  2G3A A;  2LR2 A;  1W5C E;  4C7R A;  3RK2 B;  3PLN A;  3BVH A;  2O01 J;  3AE9 C;  3HUS C;  1SLQ A;  3R2P A;  1N7L A;  2FYU E;  3L73 J;  2KIK A;  2WTY A;  3SFD C;  3JC2 2;  2XV5 A;  1SQV D;  1KV4 A;  1GL2 C;  3USS A;  2QSI A;  1KIL A;  1NU1 K;  2L91 A;  3M0D A;  2J5U A;  2ZJS E;  3MUD A;  1JCD A;  3LID A;  4WBA A;  5AVW B;  3PJS K;  1DEB A;  3TSI A;  3PH0 A;  3H1I G;  1M56 D;  3BCC J;  1LT1 A;  2N1T B;  5BU5 A;  1PZQ A;  2KB7 P;  2E74 B;  3C8V A;  4NPE A;  1X8Y A;  5CJ0 A;  1RF1 C;  2R5B A;  1LNQ A;  2Z5H A;  3HD7 C;  4PD4 I;  4H13 C;  2IZ0 A;  2UWJ E;  4IFF A;  2QA4 P;  1L2P A;  1PP9 D;  2IZ1 A;  2ZVN B;  2OTL P;  1JTH B;  4WY4 B;  1N7S D;  2NPS B;  3Q5R A;  2O1J A;  3L74 E;  1L0N K;  1SQB G;  2POH A;  1Q2N A;  4MN4 C;  2QVA A;  5CBO A;  4IOI H;  4D6T G;  3E1I A;  2C9L Y;  1KYO I;  1H0T B;  3KHU A;  2AEJ A;  1YQ3 C;  2M8R A;  4H0L D;  1IFD A;  3ABV C;  1FU1 A;  4YXW H;  2HFE D;  1ZRT E;  2E5Y A;  3Q2Y A;  1HVV A;  1GMJ A;  3N7N A;  1EXI A;  2QM7 A;  4H44 C;  2N1T A;  1ZW0 A;  1AV1 A;  1IC2 A;  4U3F E;  1BGY G;  5CHX A;  1T6A A;  1IFM A;  2A06 E;  1NTZ J;  3TGU J;  2JO1 A;  3RL0 C;  3FWN A;  1NTM K;  1JTH A;  3WUU A;  2ITA A;  1EZV E;  2OGU A;  4WY4 A;  3V2P A;  3KDP B;  5BVZ A;  1LT9 B;  5AVY B;  2NPS A;  2I1J A;  1RY3 A;  5AVS B;  1LWU C;  2Z4E A;  3VP9 A;  3IN6 A;  5KJ7 D;  1T2K C;  4B86 A;  1L0L K;  1PGP A;  3HUS B;  2FXM A;  1OXZ A;  3BRV B;  2FYU J;  1H0T A;  2WIT A;  4EOT A;  3E1R A;  3JCU H;  2B9B A;  4ZKP A;  1FZG A;  3L70 J;  1GK4 A;  2XZR A;  1P84 E;  1FOS E;  4IL6 E;  2C0X A;  3H1I D;  3GW6 A;  2GA1 A;  1T3U A;  3H25 A;  3CL3 D;  1NVO A;  5GTH H;  3HD7 B;  4H13 B;  2ZT9 C;  1ZRT D;  4HH2 A;  3CWB G;  3L37 A;  1NYH A;  3AEE C;  1LT9 A;  3G3Z A;  2BAS A;  4EDF A;  3A0H E;  2Y0D A;  2IFM A;  3U1C A;  2FFD C;  2ZAE B;  3S9O A;  3HUS A;  1JB0 J;  3V6I A;  5CMZ A;  3IFM A;  2XKM A;  3AEB C;  1SQB D;  4JYB A;  5APU A;  3II6 A;  4N6J A;  4YTP C;  4D6T D;  4JPZ B;  1YQ4 C;  1OVV A;  2OYH C;  1PPJ E;  4GKG A;  1SQX G;  2FYN C;  2QJY C;  2W6B A;  3AED C;  1ZP0 C;  2Q6Q A;  4H0L B;  4KJM A;  1NTM E;  5BU8 B;  2WPS A;  1T3J A;  1JM0 A;  3CPW O;  2H8P D;  2J58 A;  4JBZ A;  1SQP K;  3RL0 g;  3AE4 C;  2IBZ G;  1M1K Q;  4UB6 H;  4U3F J;  3HD7 A;  1BGY D;  4DZO A;  1UII A;  1HH0 A;  2BCC J;  3FX0 A;  1NOH A;  2WMM A;  4W80 A;  1YIJ P;  1S2E A;  1X0T A;  3WU2 H;  3MTU E;  1S1C X;  4KHX A;  5AW8 B;  1J1D B;  3U1A A;  2WPR A;  1HWT C;  1N73 B;  2WSE H;  1BCC E;  4I1L A;  2P1J A;  1NU1 J;  1JY2 O;  1BDD A;  1Q82 Q;  1KQG B;  2E76 C;  3A0B E;  3EQ2 A;  3RK2 D;  1MKM A;  4A7P A;  1K8A Q;  2O1K A;  2P10 A;  5AW1 B;  2YKP A;  3M91 A;  1U7J A;  1RE4 C;  2AEM A;  4GIF A;  5CJ4 A;  1OW6 A;  3A2A A;  2E5T A;  1EXJ A;  1NKN A;  3IF4 A;  1R5S A;  3L73 E;  1ZOY C;  3FXE A;  2RN0 A;  5CBN A;  3AEF C;  1S72 P;  1XTG B;  1L0N J;  2JJL A;  1LJ2 A;  2O3J A;  1KQS O;  1KQF B;  3AEA C;  3CWB D;  1IK7 A;  1N73 A;  4XA4 A;  3H1L J;  2E74 D;  3H32 B;  2CPB A;  1VDF A;  5TIS H;  3BCC E;  2OYO A;  1QL2 A;  4IFD K;  3L72 G;  2M3E A;  4WB4 A;  3S1K A;  4N3Y B;  2H43 A;  1Q7Y Q;  2AXT E;  1VQL P;  3MHV A;  4ZMD A;  1R5L A;  1S3J A;  2E75 C;  4K3A A;  1URQ C;  3VMY A;  4M3L A;  3H6P A;  3MD0 A;  3S4R A;  1SQX D;  2JWD A;  2N9Y B;  1YYC A;  2QRX A;  5CCG C;  4PV1 C;  2YIU B;  3GLM A;  4LC1 A;  5AVU B;  1NTM J;  5AW6 B;  3TGU G;  2R5D A;  1VF5 C;  2KSE A;  3B4S A;  1IFP A;  1SFC B;  1NTK G;  1EC5 A;  2IBZ D;  3CCS P;  1ZLL A;  4OWF A;  1L0L J;  2KZI A;  1YHQ P;  2KLU A;  1NO4 A;  1FZA A;  1QEX A;  3H32 A;  1KOR A;  2YO3 A;  2P67 A;  2JP3 A;  1KB9 E;  1DEE G;  1K9M Q;  3W67 A;  1BE3 J;  1IFN A;  2XNX A;  4BXL A;  2FYU G;  1BCC J;  4Y99 B;  4I6M C;  1JMM A;  1KFM A;  4WWI A;  2ZYD A;  5KKZ B;  1PL5 A;  2AXC A;  1NTZ E;  4UB8 H;  3B8E B;  1SVF A;  2C0W A;  1VQM P;  3CX5 D;  2WWW A;  3L70 G;  3BAS A;  2OYH A;  1AVO A;  2WQY C;  3LIE A;  2LXB A;  4Y28 J;  1DD4 A;  1OZH A;  3L75 E;  2D2C B;  2W6A A;  3OJA B;  3BCC D;  3HE5 A;  5TJH A;  1WRG A;  4I7Z B;  5E79 H;  2Y0E A;  3KYQ A;  1N8R Q;  1E79 H;  2ZXX A;  3GHG B;  5AVX B;  2I8D A;  1SFC A;  4L73 A;  3CXH E;  1GZL A;  1KYO H;  3M0A A;  4L75 A;  1QL1 A;  3MZW B;  1FZC C;  2QIW A;  1HTL C;  1GL2 D;  1SQB K;  2P58 A;  1Y47 A;  3L70 E;  1FBM A;  4AUW A;  2Q3I A;  3L74 G;  1M1J B;  3L35 A;  1HF9 A;  1YJ9 P;  3H1H J;  3CI9 A;  1R8E A;  1FZF A;  4K35 A;  2W83 C;  3L72 D;  1RQU A;  1T8Z A;  3HD7 D;  4LLH A;  4H13 D;  3M9B A;  2B88 A;  4GDO A;  2FXO A;  3AE5 C;  5KLI C;  4ASV A;  5GTI E;  1Q90 D;  2WT7 B;  2MJZ A;  3KZI E;  1NH4 A;  1MFT A;  5AVV B;  3M9Q A;  3V2N A;  1EDI A;  2JEE A;  2Y9Y A;  1FDO A;  2K9Y A;  1SQP J;  3W68 A;  1OW8 A;  1LTJ C;  1S5L H;  3GHG A;  2K9J B;  4XE5 B;  2OYI C;  4U3F G;  4C7N B;  1M57 D;  1IFI A;  2A06 G;  3BAT A;  4QMA A;  3TGU D;  5EFW B;  2KXP B;  1NTK D;  2QJP B;  1EZV G;  1YTZ I;  4N78 E;  5AW9 B;  3V4Q A;  1KN7 A;  1N7S C;  1M1J A;  2G8Y A;  4H44 D;  3GMA A;  2WPQ A;  1ZR4 A;  1YJN P;  2KP8 A;  3QWO C;  3H1K J;  1LTS C;  2W27 A;  4PJ0 H;  3FWL A;  1X79 B;  2WSE J;  3OW2 O;  2FYU D;  1L4A C;  2CK3 H;  3G4S P;  1PP9 J;  2WT7 A;  4R4M A;  4PD4 E;  1H88 A;  3L71 E;  2Q9I A;  1KZU B;  3MGN A;  2BCC E;  2KOG A;  2R44 A;  3L70 D;  1P84 I;  3G71 P;  3JSV C;  3L75 J;  1J1E C;  2FY8 A;  1EDL A;  3ZDM A;  2K9J A;  2K3R A;  5CCH A;  3U59 A;  4C7N A;  1NU1 E;  2YMK A;  1LTB C;  5KLV K;  1L0N G;  3SFE C;  5B66 H;  4TT3 H;  3I56 P;  1KYO E;  1Q86 Q;  1OX3 A;  2O01 N;  3AE3 C;  2Q3E A;  3CCE P;  3H1L G;  2DW3 A;  1SQQ K;  1GL2 B;  1VQP P;  4YPC A;  2JDI H;  1BSH A;  5KJ7 C;  3FGA D;  2IPP A;  3L74 D;  1OVR A;  1Y8A A;  1SQX K;  2YXR B;  3V4W A;  1FZB A;  1M90 Q;  1Q81 Q;  5AVR B;  1KQL A;  1KIL E;  1A02 J;  1VPC A;  3GF3 A;  2ZT9 D;  1PPJ G;  1RF1 B;  3L36 A;  2I1K A;  2YNY A;  1L0N E;  2IDB A;  5KAI H;  1RE3 A;  3TK1 A;  4EYY Q;  1VQ4 P;  1NTM G;  3D6Z A;  1EDJ A;  3H1L E;  2H89 C;  1S5L X;  3RGU A;  2JKV A;  2H7H A;  3A5T A;  2QJK C;  1S5L E;  3CC7 P;  4I2L C;  1JEK A;  2XDJ A;  3AE8 C;  1N86 A;  2YKQ A;  4U3F D;  1H8A A;  3B5N C;  2A06 D;  3I55 P;  2GUV A;  3F5H A;  1M8O B;  2K1A A;  2HOD B;  2A45 G;  1EZV D;  3TDK A;  1JOC A;  3SWY A;  1GL2 A;  2MKV A;  4OGQ C;  2E42 A;  5APX A;  4OVN F;  3G6E P;  1HGV A;  1BCC G;  3H1J E;  1S9K E;  2L5G B;  3H1I J;  3RK3 E;  3F89 A;  1SFC D;  1XTC C;  2IYP A;  4H44 B;  3CCU P;  2FBW C;  2IBZ I;  1LTI C;  2VRS A;  2KNC B;  1RF1 A;  1AFO A;  1MZ9 A;  1A02 F;  2WSC H;  4ZKU A;  1ZR2 A;  3L71 J;  1L0L E;  1NAY A;  5AVZ B;  4RO0 A;  3RL0 B;  3P8C E;  2KI7 B;  2YKO A;  2BEQ D;  3VMZ A;  3CCL P;  3EWK A;  4GOD A;  1OIP A;  1SQV K;  1BE3 E;  2V7Q H;  1P84 D;  1LWU B;  1SQB J;  5AW4 B;  3L73 G;  2YMY A;  5B5E H;  4D6T J;  3CX5 I;  3CLQ A;  2E76 D;  1GW3 A;  1KIL C;  1L0N D;  3VP8 A;  5M1B A;  2HOD A;  3MP7 B;  3MUD C;  1YTZ T;  2D2C D;  3JCU E;  2R32 A;  1VQ5 P;  1CI6 B;  5APV A;  3H1L D;  3SWF A;  3BCC G;  1FJP A;  3O8Z A;  1M7L A;  2HR3 A;  1BGY J;  3OA7 A;  2KNC A;  2W90 A;  1JY2 P;  4OH8 B;  3MIW A;  1NKZ B;  1SQP G;  1NHL A;  1PPJ D;  1QVG O;  5GTH E;  2YXQ B;  3AEG C;  2ZT9 B;  5KAI E;  2Y9Z A;  3CCQ P;  1NTK K;  2QG4 A;  1VQ9 P;  1BDC A;  1LWU A;  3H1H E;  1NTM D;  2Q1K A;  2B89 A;  1U57 A;  2FFD B;  3RK3 C;  5KTB A;  3P7K A;  2OTK E;  3EFG A;  2Z5I A;  2E75 D;  1ZN5 A;  3TYY A;  1G2C B;  1CI6 A;  2N1T C;  5CCG D;  2PRR A;  2E74 C;  3H1K G;  3O6Q B;  1SQP E;  2OYH B;  2FYN B;  2QJY B;  1AVY A;  4L76 A;  4IFM A;  5CCH D;  3M9H A;  3H1J J;  1BCC D;  1S4X A;  1VF5 D;  3GF7 A;  2JWA A;  1USE A;  3HE5 B;  3OAK A;  1IO4 A;  1NTZ G;  4GT1 A;  4WY4 C;  2WZ7 A;  3A7O A;  1VQ6 P;  3UIA A;  2NPS C;  4UB6 E;  2KSJ A;  2KLV A;  3L75 G;  5KLV J;  2XND H;  3WU2 E;  2WVR A;  3H1K E;  3CXH I;  2FFD A;  1OMI A;  1RH5 B;  2RH0 A;  1PGO A;  1FAV A;  1SQQ J;  2QM8 A;  1PFI A;  3L73 D;  4JF7 A;  1IFJ A;  3B5N A;  3RBZ A;  3V2Q A;  1PP9 E;  1Y9B A;  1G2C A;  1SQX J;  4JYC A;  5APQ A;  5APT A;  1JY2 N;  3O6Q A;  1K04 A;  1MV8 A;  2E76 B;  2YO2 A;  4RES B;  4CPG A;  1IJD B;  3AE1 C;  2GM4 A;  5AVT B;  3PP5 A;  3PRJ A;  4HB1 A;  1GTW A;  4HKZ H;  1KD1 Q;  3RBX A;  1DX7 A;  1HJB A;  2HG5 D;  1H89 A;  1LT9 C;  3TNU A;  2HLO A;  1WT6 A;  1HBW A;  3KXD A;  1ZXG A;  1EQ7 A;  3V5B A;  1SQP D;  5AW7 B;  1W2E A;  2WSF H;  1SS1 A;  1KFN A;  2KK7 A;  3VMX A;  2QE7 H;  2RMZ A;  1J2J B;  3IAO A;  3NXS A;  2NZ2 A;  3ITK A;  2KUB A;  2B87 B;  2OTJ P;  5K5G B;  5TIS E;  3RK3 B;  3N4X A;  1LP1 B;  2IYO A;  4LGD E;  3WUT A;  2Q5U A;  1P84 H;  2E75 B;  4IL6 H;  3D71 A;  1JNM A;  1URQ B;  1W2B O;  1G1J A;  4WVZ A;  3H1K D;  2CPS A;  1KB9 D;  2C9N Y;  1RE4 A;  5AW5 B;  1VQ8 P;  1LGH B;  4R4L A;  4PV1 B;  4W7Z A;  1FDI A;  3AEC C;  1JY3 O;  3CCM P;  2E43 A;  1OWA A;  1GU5 A;  2R3S A;  2ZFC A;  3A0H H;  1NTZ D;  1VF5 B;  3L71 G;  1EZV I;  2BCC G;  1SQV J;  2P2U A;  5AVQ B;  1Z56 A;  2WSC J;  1GDT A;  3L75 D;  2IFN A;  2PFX A;  3P8M C;  3H1I E;  1KC8 Q;  2OAR A;  2BEZ F;  1NWQ A;  2B87 A;  2K88 A;  3L72 J;  1NU1 G;  1L4A D;  1D7M A;  3NTN A;  2V7Q J;  1JY3 P;  1AQ5 A;  3CXH D;  1KMI Z;  1LP1 A;  2K37 A;  2LKM A;  1X22 A;  1NJI Q;  3VN0 A;  3RL0 D;  4H0L C;  4UB8 E;  2KYV A;  1FZE A;  2PGD A;  3HTK B;  1YIT P;  1N2D C;  4Z1M H;  1URQ A;  3K5B A;  1G1I A;  1JMB A;  1HUC A;  1LTT C;  4GOE A;  5CCG A;  3LW5 H;  1CSB A;  4TLF A;  1T2K D;  4AYC A;  1SQB E;  5E79 E;  4D6T E;  1NTK J;  3P32 A;  4DT0 A;  2A45 H;  1J1D C;  1RQV A;  2LXC B;  1N73 C;  3D70 A;  1FZC B;  3SWK A;  2W8Z A;  1VQ7 P;  1PIX A;  4RJT A;  3Q5S A;  4BRY B;  1FDM A;  1KTM A;  1E5W A;  3WMM 0;  2J59 M;  3A3Y B;  3VMA A;  1OVU A;  2AEF A;  2QEX P;  1VQK P;  5C39 A;  3KQG A;  3A0B H;  1WMK A;  3CC4 P;  3CC2 P;  1BGY E;  4HJG H;  5AW3 B;  1UIX A;  4BWN A;  4C46 A;  3HTK A;  2O01 H;  4N78 D;  5KLI B;  4IL6 X;  3HRN A;  3PTZ A;  3H1J G;  3Q3D A;  3IR9 A;  1NAF A;  3T97 B;  1LTJ B;  3B5N D;  3FXD A;  3CX5 H;  3C9I A;  2OYI B;  3WUV A;  1JY3 N;  4NPD A;  4PD4 D;  5APW A;  1FZC A;  1L0L G;  3CMA P;  1IK9 A;  2ZYG A;  3L71 D;  5KLV G;  2A45 I;  4KT0 J;  1JUN A;  2BCC D;  2KZJ A;  4OGQ D;  4BRY A;  1GU4 A;  3L74 J;  2XU6 A;  1VQN P;  1BE3 G;  1N7S B;  1LTG C;  2AXT H;  1SQQ G;  1ZV8 A;  3D6Y A;  2GUS A;  1RF0 C;  2M5A B;  4XFJ A;  1NU1 D;  1FE6 A;  2ZXE B;  3HE4 B;  4PJ0 E;  1YJW P;  1SP4 A;  1KYO D;  1L4A B;  5AW2 B;  1IZN B;  2Y0C A;  2YIU C;  2OQQ A;  3CWB E;  3E7K A;  4DJG A;  2ZVO B;  5KAF H;  1USD A;  5KLV E;  3T97 A;  1HGZ A;  2FKW B;  1RHZ B;  1AJY A;  1SFC C;  1JO5 A;  4NPF X;  1LTJ A; 
#chains in the Genus database with same CATH homology
 2FXM A;  1J1E B;  1OXZ A;  3HE5 B;  3BRV B;  1T8Z A;  3OAK A;  3HD7 D;  2WIT A;  4LLH A;  1IO4 A;  2OYI A;  3M9B A;  4EOT A;  1KIL D;  4GT1 A;  4ZKP A;  4WY4 C;  2WZ7 A;  3A7O A;  3VYI A;  2WT7 B;  2MJZ A;  3UIA A;  2NPS C;  1NH4 A;  5AVV B;  2Q7C A;  2PAJ A;  2R3C A;  2KSJ A;  3M0D C;  3M9Q A;  3V2N A;  1FZG A;  2KLV A;  2JEE A;  1GK4 A;  3NFQ A;  1CW5 A;  1GK6 A;  4Y99 C;  4EIJ A;  1N7S A;  2XZR A;  1LTJ C;  1FOS E;  3GHG A;  2FFD A;  4XE5 B;  2C0X A;  2OYI C;  1MUU A;  5APS A;  3V2R A;  4C7N B;  1FAV A;  1CZQ A;  1IFI A;  2QM8 A;  3BAT A;  3HE4 A;  1PFI A;  1FJK A;  4JF7 A;  1T3U A;  1IFJ A;  3B5N A;  3CL3 D;  1GD2 E;  3V2Q A;  1L4A A;  3HD7 B;  4HH2 A;  1YTZ I;  1G2C A;  4N78 E;  3L37 A;  4JYC A;  5APQ A;  5AW9 B;  1LT9 A;  3V4Q A;  5APT A;  3G3Z A;  3RK2 C;  1JY2 N;  2BAS A;  1N7S C;  2HPC B;  1MV8 A;  2YO2 A;  1M1J A;  1NTZ K;  4RES B;  2IFM A;  3U1C A;  3GHG C;  2FFD C;  2WPQ A;  1ZR4 A;  2KP8 A;  1IJD B;  1LTA C;  2GM4 A;  5AVT B;  3PP5 A;  3HUS A;  1S9K D;  1LTS C;  3RK3 D;  2W27 A;  1GTW A;  2P7J A;  5CMZ A;  1X79 B;  3VTP C;  3IFM A;  2XKM A;  1DX7 A;  1HJB A;  1L4A C;  2HG5 D;  4JYB A;  1H89 A;  5APU A;  3II6 A;  4N6J A;  2WT7 A;  1LT9 C;  1H88 A;  3TNU A;  1LTJ A;  2Q9I A;  1KZU B;  2HLO A;  4GKG A;  2OYH C;  1WT6 A;  1HBW A;  1M1J C;  3B5N B;  3MGN A;  2KOG A;  3NMD A;  2N1T D;  1URQ D;  2FYU K;  2W6B A;  1EQ7 A;  3V5B A;  5AW7 B;  1W2E A;  2WSF H;  1KFN A;  3P8C D;  1GW4 A;  2IX7 C;  3VMX A;  1J1E C;  1J2J B;  3KPE A;  5BU8 B;  2WPS A;  1T3J A;  2PP6 A;  3NXS A;  5CCH A;  3U59 A;  4C7N A;  5KJ7 A;  2H8P D;  5APY A;  2J58 A;  2HYN A;  1SQP K;  3BRT B;  3RK3 B;  3N4X A;  1LTB C;  5KLV K;  3VOP A;  4WY4 D;  3HD7 A;  4DZO A;  2NPS D;  1HH0 A;  3I5C A;  5AW0 B;  1NOH A;  2M3B A;  4LGD E;  4W80 A;  2HPC A;  2Q5U A;  3M06 A;  3MTU E;  4KHX A;  1SQQ K;  3TNU B;  5AW8 B;  1J1D B;  3U1A A;  2WPR A;  5CCH C;  1HWT C;  1GL2 B;  1X9V A;  1JNM A;  1URQ B;  1G1J A;  1N73 B;  5KJ7 C;  2CPS A;  2WSE H;  2C9N Y;  1RE4 A;  2IPP A;  1SQX K;  4I1L A;  5AW5 B;  1LGH B;  1FOS F;  3V4W A;  2P1J A;  1FZB A;  4W7Z A;  1JY3 O;  1JY2 O;  1DH3 A;  5AVR B;  1KQL A;  4AQR D;  1A02 J;  1VPC A;  2E43 A;  1OWA A;  1GU5 A;  2ZFC A;  2FYZ A;  3EQ2 A;  1RF1 B;  3L36 A;  2I1K A;  2YNY A;  3RK2 D;  4O9B A;  2P2U A;  1MFZ A;  4HYT B;  5AVQ B;  1Z56 A;  2O1K A;  1RE3 A;  5AW1 B;  1KIL B;  2YKP A;  3M91 A;  1JCC A;  3TK1 A;  1RE4 C;  1GDT A;  2IFN A;  4GIF A;  5CJ4 A;  3P8M C;  3A2A A;  1NKN A;  2OAR A;  2H7H A;  3A5T A;  1NWQ A;  4I2L C;  1L4A D;  1RF0 A;  2XDJ A;  3NTN A;  1N86 A;  2YKQ A;  4W7Y A;  1H8A A;  1JY3 P;  2N9B A;  1AQ5 A;  3B5N C;  1XTG B;  3L4F A;  4DOJ A;  2LKM A;  1RE3 C;  3VN0 A;  2JJL A;  3RL0 D;  2GUV A;  2HOD B;  2KYV A;  1FZE A;  2A45 G;  1JOC A;  3HTK B;  3SWY A;  4C7R A;  1GL2 A;  3RK2 B;  1N2D C;  1URQ A;  3BVH A;  2E42 A;  5APX A;  1N73 A;  4XA4 A;  3H32 B;  1G1I A;  1HUC A;  1HGV A;  1LTT C;  2CPB A;  1VDF A;  1S9K E;  2L5G B;  3HUS C;  5CCG A;  1SLQ A;  3LW5 H;  1N7L A;  3R2P A;  1CSB A;  1QL2 A;  4IFD K;  1T2K D;  4AYC A;  1SFC D;  1XTC C;  4WB4 A;  2WTY A;  1LTI C;  2VRS A;  4N3Y B;  2H43 A;  2XV5 A;  3P32 A;  1RF1 A;  1AFO A;  2A45 H;  1J1D C;  1MZ9 A;  1A02 F;  2WSC H;  4ZKU A;  1GL2 C;  1URQ C;  1ZR2 A;  1N73 C;  1KIL A;  1NU1 K;  3VMY A;  3M0D A;  1FZC B;  4M3L A;  3H6P A;  3MD0 A;  5AVZ B;  3RL0 B;  3P8C E;  3MUD A;  1JCD A;  1YYC A;  5CCG C;  3LID A;  4WBA A;  5AVW B;  2YKO A;  4LC1 A;  5AVU B;  3VMZ A;  1FDM A;  1DEB A;  3TSI A;  1E5W A;  3WMM 0;  2J59 M;  3A3Y B;  1SQV K;  2N1T B;  5BU5 A;  2KB7 P;  1LWU B;  5AW4 B;  5AW6 B;  2R5D A;  1X8Y A;  3KQG A;  2YMY A;  5CJ0 A;  1RF1 C;  2R5B A;  1SFC B;  3HD7 C;  2Z5H A;  3CLQ A;  4IFF A;  1GW3 A;  1KIL C;  5AW3 B;  1ZLL A;  3VP8 A;  4C46 A;  2HOD A;  3HTK A;  1YTZ T;  2O01 H;  1JTH B;  4N78 D;  4WY4 B;  2R32 A;  1NO4 A;  3HRN A;  1FZA A;  1N7S D;  1CI6 B;  3H32 A;  5APV A;  2NPS B;  2YO3 A;  2P67 A;  2O1J A;  3SWF A;  1L0N K;  3IR9 A;  1IFN A;  1NAF A;  2XNX A;  2POH A;  1FJP A;  3O8Z A;  4Y99 B;  1M7L A;  4I6M C;  1JMM A;  1KFM A;  1LTJ B;  3B5N D;  3OA7 A;  3E1I A;  2C9L Y;  3C9I A;  2OYI B;  3B8E B;  1SVF A;  2C0W A;  1JY2 P;  1JY3 N;  2WWW A;  2M8R A;  4OH8 B;  3MIW A;  1IFD A;  3BAS A;  1FU1 A;  5APW A;  1NKZ B;  1FZC A;  2OYH A;  1IK9 A;  2HFE D;  1NHL A;  2A45 I;  1JUN A;  1HVV A;  3LIE A;  3N7N A;  1NTK K;  1GU4 A;  2QM7 A;  2W6A A;  3OJA B;  2XU6 A;  2N1T A;  3HE5 A;  1LWU A;  1N7S B;  1WRG A;  3KYQ A;  1LTG C;  1ZV8 A;  3GHG B;  2GUS A;  1RF0 C;  3RK3 C;  5KTB A;  3P7K A;  2FFD B;  5AVX B;  1IC2 A;  1SFC A;  5CHX A;  3EFG A;  1IFM A;  2ZXE B;  1GZL A;  3M0A A;  3HE4 B;  2Z5I A;  1QL1 A;  1SP4 A;  1FZC C;  3RL0 C;  1HTL C;  1GL2 D;  1NTM K;  1L4A B;  1SQB K;  5AW2 B;  1JTH A;  1ZN5 A;  3V2P A;  4WY4 A;  3KDP B;  3TYY A;  1G2C B;  5BVZ A;  1CI6 A;  1LT9 B;  5AVY B;  2NPS A;  2I1J A;  2N1T C;  5CCG D;  1RY3 A;  5AVS B;  1FBM A;  4AUW A;  1LWU C;  2Q3I A;  2OYH B;  2Z4E A;  1M1J B;  4IFM A;  3L35 A;  5CCH D;  3M9H A;  3T97 A;  1HGZ A;  3VP9 A;  3CI9 A;  2FKW B;  5KJ7 D;  1FZF A;  1T2K C;  4B86 A;  1SFC C;  1JO5 A;  1L0L K;  3HUS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...