1FSBA

Structure of the egf domain of p-selectin, nmr, 19 structures
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
40
structure length
40
Chain Sequence
b'TASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P-SELECTIN
publication title Structure and function of the epidermal growth factor domain of P-selectin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 3
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1996-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1fsbA00
2VH0B 5CISA 5CKNA 1HX2A 3TK6B 3ELAL 1V3XB 3KL6B 2Y7ZB 2J38B 3LTFB 1XDTR 2BMGA 2EI6B 1U67A 3N8YB 3U7UG 1QFKL 2H9EL 1W8BL 2Y7XB 1SZBA 1DIYA 1XFEA 3LN1A 2W2OE 5IKTA 4Z6AL 4CSYA 1P9JA 1EQGA 2K2TA 2PUQL 4JZEL 3NT1A 4RRZA 1KLOA 4BXSA 2P3UA 1EZQB 1APOA 1IQLL 1KLIL 2DDUA 4LMFA 3KQEL 3SOVA 4BDWA 2VVCK 4YZUB 3ENSA 4RRYA 5JB9E 4ISIL 1PRHA 2K2SB 1G2LB 4M11A 3SOQA 2XC5L 3FBYA 1L5GB 2FLGA 2J2UB 5FDQA 5CKMA 3GCXE 1HREA 2OYEP 2W2QE 3NJPC 2VJ3A 2F9BL 2P3FN 3DEMA 3P5BL 1PXXA 3HO3A 4BTTA 4RRWA 1TPGA 5JVZA 1NZIA 2BOKL 1ADXA 2XC4L 1CX2A 2WG4B 3CS7L 4X8VL 1ATDA 5K0HB 1YUKB 1CVWL 5JBBE 2KV4A 2NPRA 1IJQA 1URKA 2P28B 2RNLA 1CVUA 5L30L 3HO5A 4NGAL 3QMOA 3QH0A 4RUTA 2W86A 4CUFA 1G1SA 3ASIA 1IQIL 1APQA 1N7DA 1G2MB 1ATAA 3GISX 2Y5GL 3Q3KB 1MQ5L 2VWMK 1IQFL 3EGFA 2W2NE 1FE2A 3PGHA 1TOZA 3OLUA 4JYVL 2BQ6A 4JYUL 4OTYA 1MOXC 1PFXL 4RS0A 1IQKL 1G1TA 1FJSL 3M36L 1EPJA 1HT5A 3CFWA 1IQGL 4YT7L 4BDXA 1JBUL 2BOUA 2J4IB 1U8CB 3C9AC 2P16L 3LC3B 3LTGD 1EPHA 3R05A 2PHBB 2Q1JB 2WPJE 1IQML 2D1JB 3N8WB 1IGXA 1EMOA 3N8XA 2RHPA 1UZPA 3HS6A 1F7EA 1NFXB 2WPHE 1LMJA 2XBXL 3Q7DA 2P26A 1FSBA 1WHEA 5F19A 2J94B 2VWOL 3HO4A 4OTJA 3V64C 4D0FA 3ZYIB 4RRXA 4X8UL 2UWLB 1JV2B 5JVYA 4JZDL 1EGFA 1PGEA 1HZ8A 4LORA 2P94L 4PH9A 4ZH8B 1LPGA 2MGRA 2P95L 1AUTL 1KLJL 2VH6B 5CKQA 2EI7B 1NT0A 1DQBA 4Z0LA 3ZYJB 3N8VA 1FAKL 3BPSE 2XC0L 3RR3A 4BXWA 3MDLA 3H5CB 3KQDL 1BF9A 1YUGA 2YGOA 2MGPA 3SOBB 1PTHA 5IKVA 1K36A 1GK5A 1ZAQA 1YGCL 2PR3B 3N8YA 1M1XB 4AQTA 3CA7A 1G1RA 4A7IA 3HS5A 3HPTA 5F1AA 1IQJL 3FCSB 1F7MA 4NG9L 3FFGL 3CENL 1LQDA 2W2PE 1HAFA 3U73A 3N8ZA 4Y7BB 4Y76B 2WFTA 5I46L 5L2ZL 1EMNA 3M37L 2RA0L 2FZZL 4XLWA 1LPZA 1UZQA 1EAIC 2XBYL 2VVUL 3NTBA 2JKHL 1UZKA 4D0EA 1IOXA 1HJ7A 2Y38A 3SW2A 1HRFA 4O02B 1EPIA 1JL9A 2B7DL 4X8TL 2KL7A 1EPGA 2Y82B 4BTUA 1NFUB 1F0RB 2I9BA 2XBVL 2WYJB 3F6UL 4O1ZA 1HAEA 1EQHA 2WG3C 2UWOB 3POYA 1Q4GA 1FFMA 1IQNL 2CJIB 3TK5B 2W3KB 3GCWE 5EGMB 1O5DL 4C16A 1COUA 1G1QA 1FAXL 2WFXB 1IQEL 1HCGB 2UWPB 1ATEA 2WPIE 5KN5C 2I9AA 1CQEA 5IKRA 5JB8E 1YUFA 2G00L 2AYLA 3KQCL 1IQHL 4NA9L 4Y6DB 1YO8A 3MQEA 2Y81B 4Y71B 3TZIA 2WPLE 1N1IA 1NFWB 1XKAL 2VWLL 5COXA 4FM5A 3OLTA 3LN0A 4TGFA 4Y79B 3NTGA 1LPKA 1EBVA 1NFYB 1FF7A 3TH3L 2TGFA 5JBCE 2P93L 1CEJA 2M74A 4XBMA 2Y5HL 2BO2A 4CUDA 1WU1B 4BTIA 3N8WA 2J34B 2FLRL 3KK6A 4YT6L 1XKBA 3BT2A 2MHPA 2YGPA 1J9CL 5JBAE 2WYGB 2WPKE 4G1MB 4ZXYL 3HS7A 5JW1A 3LAQA 4X8SL 1KSNB 1CCVA 4ZAEB 1A3PA 3V65B 3ZYGA 2J95B 2GD4A 2P3FL 2OYUP 2BZ6L 2FD6A 3LC5B 1DVAL 2WPME 3IJEB 2XBWL 4MMYB 1IVOC 1TLEA 5E8DA 3TGFA 1I0UA 4ZXXL 1K37A 1W7XL 1X7AL 2W3IB 4M10A 1Z6EL 1KIGL 1DX5I 2Y80B 1CCFA 2BOHA 3K9XA 1L3YA 1IP0A 2VVVL 1ATBA 4ISHL 4MMZB 2ADXA 5KIRA 2Y5FL 4JZFL 3BT1A 2KB9A 3F1SB 4COXA 5IKQA 1UZJA 2FLBL 3TBDA 3KCGL 1C5MF 4D90A 1B9WA 4ZHAB 1NPEB 1IGZA 1OB1C 2EI8B 2W2ME 4Y7AB 4Z0KB 3IITB 3QCWA 2BQ7A 2BOXA 2VWNL 2W26B 1DDXA 4E1GA 3KRKA 5L2YL 2BQWA 1P0SL 3LIWB 4CUEA 1NQLB 3KQBL 1Z6CA 2P3TA 1IOEL 1MQ6L 6COXA 1RFNB 1HT8A 4XL1A 1F0SB 1WHFA 4MMXB
chains in the Genus database with same CATH superfamily
2VH0B 5CISA 5CKNA 1HX2A 3TK6B 3ELAL 1V3XB 3KL6B 2Y7ZB 2J38B 3LTFB 1XDTR 2BMGA 2EI6B 1U67A 3N8YB 3U7UG 1QFKL 2H9EL 1W8BL 2Y7XB 1SZBA 1DIYA 1XFEA 3LN1A 2W2OE 5IKTA 4Z6AL 4CSYA 1P9JA 1EQGA 2K2TA 2PUQL 4JZEL 3NT1A 4RRZA 1KLOA 4BXSA 2P3UA 1EZQB 1APOA 1IQLL 1KLIL 2DDUA 4LMFA 3KQEL 3SOVA 4BDWA 2VVCK 4YZUB 3ENSA 4RRYA 5JB9E 4ISIL 1PRHA 1LK9A 2K2SB 2VRSA 1G2LB 4M11A 3SOQA 2XC5L 3FBYA 1L5GB 2FLGA 2J2UB 5FDQA 5CKMA 3GCXE 1HREA 2OYEP 2W2QE 3NJPC 2VJ3A 2F9BL 2P3FN 3DEMA 3P5BL 1PXXA 3HO3A 4BTTA 4RRWA 1TPGA 5JVZA 1NZIA 2BOKL 1ADXA 2XC4L 1CX2A 2WG4B 3CS7L 4X8VL 1ATDA 5K0HB 1YUKB 1CVWL 5JBBE 2KV4A 2NPRA 1IJQA 1URKA 2P28B 2RNLA 1CVUA 5L30L 3HO5A 4NGAL 3QMOA 3QH0A 4RUTA 2W86A 4CUFA 1G1SA 3ASIA 1IQIL 1APQA 1N7DA 1G2MB 1ATAA 3GISX 2Y5GL 3Q3KB 1MQ5L 2VWMK 1IQFL 3EGFA 2W2NE 1FE2A 3PGHA 1TOZA 3OLUA 4JYVL 2BQ6A 4JYUL 4OTYA 1MOXC 1PFXL 4RS0A 1IQKL 1G1TA 1FJSL 3M36L 1EPJA 1HT5A 2BT8A 3CFWA 1IQGL 4YT7L 4BDXA 1JBUL 2BOUA 2J4IB 1U8CB 3C9AC 2BT7A 2P16L 4A94C 3LC3B 3LTGD 1EPHA 3R05A 2PHBB 2Q1JB 2WPJE 1IQML 2D1JB 3N8WB 1IGXA 1EMOA 3N8XA 2HORA 2RHPA 1UZPA 3HS6A 1F7EA 1NFXB 2WPHE 1LMJA 2XBXL 3Q7DA 2P26A 1FSBA 1WHEA 5F19A 2J94B 2VWOL 3HO4A 4OTJA 3V64C 4D0FA 3ZYIB 4RRXA 4X8UL 2UWLB 1JV2B 5JVYA 4JZDL 1EGFA 1PGEA 1HZ8A 4LORA 2P94L 4PH9A 4ZH8B 1LPGA 2MGRA 2P95L 1AUTL 1KLJL 2VH6B 5CKQA 2EI7B 1NT0A 1DQBA 4Z0LA 3ZYJB 3N8VA 1FAKL 3BPSE 2XC0L 1QIUA 3RR3A 4BXWA 3MDLA 3H5CB 3KQDL 1BF9A 1YUGA 2YGOA 2MGPA 1LMMA 3SOBB 1PTHA 5IKVA 1K36A 1GK5A 1ZAQA 1YGCL 2PR3B 3N8YA 1M1XB 4AQTA 3CA7A 1G1RA 4A7IA 3HS5A 3HPTA 5F1AA 1IQJL 3FCSB 1F7MA 4NG9L 3FFGL 3CENL 1LQDA 2W2PE 1HAFA 3U73A 3N8ZA 4Y7BB 4GU3A 4Y76B 2WFTA 1V1HA 5I46L 5L2ZL 1EMNA 2YGQA 3M37L 2RA0L 2FZZL 4XLWA 1LPZA 1UZQA 1EAIC 2XBYL 2VVUL 3NTBA 1V1IA 2JKHL 1UZKA 4D0EA 1IOXA 1HJ7A 2Y38A 3SW2A 1HRFA 4O02B 1EPIA 1JL9A 2B7DL 4X8TL 2KL7A 1EPGA 2Y82B 2KNIA 4BTUA 1NFUB 1F0RB 2I9BA 2XBVL 2WYJB 3F6UL 4O1ZA 2JJLA 1HAEA 1EQHA 2WG3C 2UWOB 3POYA 1Q4GA 1FFMA 1IQNL 2CJIB 3TK5B 2W3KB 3GCWE 5EGMB 1O5DL 4C16A 1COUA 1G1QA 1FAXL 1KKEA 2WFXB 1IQEL 1HCGB 2UWPB 1ATEA 2WPIE 5KN5C 2I9AA 1CQEA 5IKRA 5JB8E 1YUFA 2G00L 2AYLA 3KQCL 1IQHL 4NA9L 4Y6DB 1YO8A 3MQEA 2H9EC 2Y81B 4Y71B 3TZIA 2WPLE 1N1IA 1NFWB 1XKAL 2VWLL 5COXA 4FM5A 3OLTA 3LN0A 4TGFA 4Y79B 3NTGA 1LPKA 1EBVA 1NFYB 1FF7A 3TH3L 2TGFA 5JBCE 2P93L 1CEJA 2M74A 4GU4A 4XBMA 2Y5HL 2BO2A 4CUDA 1WU1B 4BTIA 3N8WA 2J34B 2FLRL 3KK6A 4YT6L 2BSFA 1XKBA 3BT2A 2MHPA 2YGPA 1J9CL 5JBAE 2WYGB 2WPKE 4G1MB 4ZXYL 3HS7A 5JW1A 3LAQA 4X8SL 1KSNB 1CCVA 4ZAEB 1A3PA 3V65B 3ZYGA 2J95B 2GD4A 2P3FL 2OYUP 2BZ6L 2FD6A 3LC5B 1DVAL 2WPME 3IJEB 2XBWL 4MMYB 2WZPP 1IVOC 1TLEA 5E8DA 3TGFA 1I0UA 4ZXXL 1K37A 1W7XL 1X7AL 2W3IB 4M10A 1Z6EL 1KIGL 1DX5I 2Y80B 1CCFA 2BOHA 3K9XA 1L3YA 1IP0A 2VVVL 1ATBA 4ISHL 4MMZB 2ADXA 5KIRA 2Y5FL 4JZFL 3BT1A 2KB9A 3F1SB 4COXA 5IKQA 1UZJA 2FLBL 3TBDA 3KCGL 1C5MF 4D90A 1B9WA 4ZHAB 1NPEB 1IGZA 1OB1C 2EI8B 2W2ME 4Y7AB 4Z0KB 3IITB 2HOXA 3QCWA 2BQ7A 2BOXA 2VWNL 2W26B 1DDXA 4E1GA 3KRKA 5L2YL 2BQWA 1P0SL 3LIWB 4CUEA 1NQLB 3KQBL 1Z6CA 2P3TA 1IOEL 1MQ6L 6COXA 1RFNB 1HT8A 4XL1A 3S6XA 1F0SB 1WHFA 4MMXB
chains in the Genus database with same CATH topology
2VH0B 5CISA 5CKNA 1HX2A 3TK6B 3ELAL 1V3XB 3KL6B 2Y7ZB 2J38B 3LTFB 1XDTR 2BMGA 2EI6B 1U67A 3N8YB 3U7UG 1QFKL 2H9EL 1W8BL 2Y7XB 1SZBA 1DIYA 1XFEA 3LN1A 2W2OE 5IKTA 4Z6AL 4CSYA 1P9JA 1EQGA 2K2TA 2PUQL 4JZEL 3NT1A 4RRZA 1KLOA 4BXSA 2P3UA 1EZQB 1APOA 1IQLL 1KLIL 2DDUA 4LMFA 3KQEL 3SOVA 4BDWA 2VVCK 4YZUB 3ENSA 4RRYA 5JB9E 4ISIL 1PRHA 2K2SB 1G2LB 4M11A 3SOQA 2XC5L 3FBYA 1L5GB 2FLGA 2J2UB 5FDQA 5CKMA 3GCXE 1HREA 2OYEP 2W2QE 3NJPC 2VJ3A 2F9BL 2P3FN 3DEMA 3P5BL 1PXXA 3HO3A 4BTTA 4RRWA 1TPGA 5JVZA 1NZIA 2BOKL 1ADXA 2XC4L 1CX2A 2WG4B 3CS7L 4X8VL 1ATDA 5K0HB 1YUKB 1CVWL 5JBBE 2KV4A 2NPRA 1IJQA 1URKA 2P28B 2RNLA 1CVUA 5L30L 3HO5A 4NGAL 3QMOA 3QH0A 4RUTA 2W86A 4CUFA 1G1SA 3ASIA 1IQIL 1APQA 1N7DA 1G2MB 1ATAA 3GISX 2Y5GL 3Q3KB 1MQ5L 2VWMK 1IQFL 3EGFA 2W2NE 1FE2A 3PGHA 1TOZA 3OLUA 4JYVL 2BQ6A 4JYUL 4OTYA 1MOXC 1PFXL 4RS0A 1IQKL 1G1TA 1FJSL 3M36L 1EPJA 1HT5A 3CFWA 1IQGL 4YT7L 4BDXA 1JBUL 2BOUA 2J4IB 1U8CB 3C9AC 2P16L 4A94C 3LC3B 3LTGD 1EPHA 3R05A 2PHBB 2Q1JB 2WPJE 1IQML 2D1JB 3N8WB 1IGXA 1EMOA 3N8XA 2RHPA 1UZPA 3HS6A 1F7EA 1NFXB 2WPHE 1LMJA 2XBXL 3Q7DA 2P26A 1FSBA 1WHEA 5F19A 2J94B 2VWOL 3HO4A 4OTJA 3V64C 4D0FA 3ZYIB 4RRXA 4X8UL 2UWLB 1JV2B 5JVYA 4JZDL 1EGFA 1PGEA 1HZ8A 4LORA 2P94L 4PH9A 4ZH8B 1LPGA 2MGRA 2P95L 1AUTL 1KLJL 2VH6B 5CKQA 2EI7B 1NT0A 1DQBA 4Z0LA 3ZYJB 3N8VA 1FAKL 3BPSE 2XC0L 3RR3A 4BXWA 3MDLA 3H5CB 3KQDL 1BF9A 1YUGA 2YGOA 2MGPA 1LMMA 3SOBB 1PTHA 5IKVA 1K36A 1GK5A 1ZAQA 1YGCL 2PR3B 3N8YA 1M1XB 4AQTA 3CA7A 1G1RA 4A7IA 3HS5A 3HPTA 5F1AA 1IQJL 3FCSB 1F7MA 4NG9L 3FFGL 3CENL 1LQDA 2W2PE 1HAFA 3U73A 3N8ZA 4Y7BB 4Y76B 2WFTA 5I46L 5L2ZL 1EMNA 2YGQA 3M37L 2RA0L 2FZZL 4XLWA 1LPZA 1UZQA 1EAIC 2XBYL 2VVUL 3NTBA 2JKHL 1UZKA 4D0EA 1IOXA 1HJ7A 2Y38A 3SW2A 1HRFA 4O02B 1EPIA 1JL9A 2B7DL 4X8TL 2KL7A 1EPGA 2Y82B 2KNIA 4BTUA 1NFUB 1F0RB 2I9BA 2XBVL 2WYJB 3F6UL 4O1ZA 1HAEA 1EQHA 2WG3C 2UWOB 3POYA 1Q4GA 1FFMA 1IQNL 2CJIB 3TK5B 2W3KB 3GCWE 5EGMB 1O5DL 4C16A 1COUA 1G1QA 1FAXL 2WFXB 1IQEL 1HCGB 2UWPB 1ATEA 2WPIE 5KN5C 2I9AA 1CQEA 5IKRA 5JB8E 1YUFA 2G00L 2AYLA 3KQCL 1IQHL 4NA9L 4Y6DB 1YO8A 3MQEA 2H9EC 2Y81B 4Y71B 3TZIA 2WPLE 1N1IA 1NFWB 1XKAL 2VWLL 5COXA 4FM5A 3OLTA 3LN0A 4TGFA 4Y79B 3NTGA 1LPKA 1EBVA 1NFYB 1FF7A 3TH3L 2TGFA 5JBCE 2P93L 1CEJA 2M74A 4XBMA 2Y5HL 2BO2A 4CUDA 1WU1B 4BTIA 3N8WA 2J34B 2FLRL 3KK6A 4YT6L 1XKBA 3BT2A 2MHPA 2YGPA 1J9CL 5JBAE 2WYGB 2WPKE 4G1MB 4ZXYL 3HS7A 5JW1A 3LAQA 4X8SL 1KSNB 1CCVA 4ZAEB 1A3PA 3V65B 3ZYGA 2J95B 2GD4A 2P3FL 2OYUP 2BZ6L 2FD6A 3LC5B 1DVAL 2WPME 3IJEB 2XBWL 4MMYB 2WZPP 1IVOC 1TLEA 5E8DA 3TGFA 1I0UA 4ZXXL 1K37A 1W7XL 1X7AL 2W3IB 4M10A 1Z6EL 1KIGL 1DX5I 2Y80B 1CCFA 2BOHA 3K9XA 1L3YA 1IP0A 2VVVL 1ATBA 4ISHL 4MMZB 2ADXA 5KIRA 2Y5FL 4JZFL 3BT1A 2KB9A 3F1SB 4COXA 5IKQA 1UZJA 2FLBL 3TBDA 3KCGL 1C5MF 4D90A 1B9WA 4ZHAB 1NPEB 1IGZA 1OB1C 2EI8B 2W2ME 4Y7AB 4Z0KB 3IITB 3QCWA 2BQ7A 2BOXA 2VWNL 2W26B 1DDXA 4E1GA 3KRKA 5L2YL 2BQWA 1P0SL 3LIWB 4CUEA 1NQLB 3KQBL 1Z6CA 2P3TA 1IOEL 1MQ6L 6COXA 1RFNB 1HT8A 4XL1A 3S6XA 1F0SB 1WHFA 4MMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VH0 B;  5CIS A;  5CKN A;  1HX2 A;  3TK6 B;  3ELA L;  1V3X B;  3KL6 B;  2Y7Z B;  2J38 B;  3LTF B;  1XDT R;  2BMG A;  2EI6 B;  1U67 A;  3N8Y B;  3U7U G;  1QFK L;  2H9E L;  1W8B L;  2Y7X B;  1SZB A;  1DIY A;  1XFE A;  3LN1 A;  2W2O E;  5IKT A;  4Z6A L;  4CSY A;  1P9J A;  1EQG A;  2K2T A;  2PUQ L;  4JZE L;  3NT1 A;  4RRZ A;  1KLO A;  4BXS A;  2P3U A;  1EZQ B;  1APO A;  1IQL L;  1KLI L;  2DDU A;  4LMF A;  3KQE L;  3SOV A;  4BDW A;  2VVC K;  4YZU B;  3ENS A;  4RRY A;  5JB9 E;  4ISI L;  1PRH A;  2K2S B;  1G2L B;  4M11 A;  3SOQ A;  2XC5 L;  3FBY A;  1L5G B;  2FLG A;  2J2U B;  5FDQ A;  5CKM A;  3GCX E;  1HRE A;  2OYE P;  2W2Q E;  3NJP C;  2VJ3 A;  2F9B L;  2P3F N;  3DEM A;  3P5B L;  1PXX A;  3HO3 A;  4BTT A;  4RRW A;  1TPG A;  5JVZ A;  1NZI A;  2BOK L;  1ADX A;  2XC4 L;  1CX2 A;  2WG4 B;  3CS7 L;  4X8V L;  1ATD A;  5K0H B;  1YUK B;  1CVW L;  5JBB E;  2KV4 A;  2NPR A;  1IJQ A;  1URK A;  2P28 B;  2RNL A;  1CVU A;  5L30 L;  3HO5 A;  4NGA L;  3QMO A;  3QH0 A;  4RUT A;  2W86 A;  4CUF A;  1G1S A;  3ASI A;  1IQI L;  1APQ A;  1N7D A;  1G2M B;  1ATA A;  3GIS X;  2Y5G L;  3Q3K B;  1MQ5 L;  2VWM K;  1IQF L;  3EGF A;  2W2N E;  1FE2 A;  3PGH A;  1TOZ A;  3OLU A;  4JYV L;  2BQ6 A;  4JYU L;  4OTY A;  1MOX C;  1PFX L;  4RS0 A;  1IQK L;  1G1T A;  1FJS L;  3M36 L;  1EPJ A;  1HT5 A;  3CFW A;  1IQG L;  4YT7 L;  4BDX A;  1JBU L;  2BOU A;  2J4I B;  1U8C B;  3C9A C;  2P16 L;  3LC3 B;  3LTG D;  1EPH A;  3R05 A;  2PHB B;  2Q1J B;  2WPJ E;  1IQM L;  2D1J B;  3N8W B;  1IGX A;  1EMO A;  3N8X A;  2RHP A;  1UZP A;  3HS6 A;  1F7E A;  1NFX B;  2WPH E;  1LMJ A;  2XBX L;  3Q7D A;  2P26 A;  1FSB A;  1WHE A;  5F19 A;  2J94 B;  2VWO L;  3HO4 A;  4OTJ A;  3V64 C;  4D0F A;  3ZYI B;  4RRX A;  4X8U L;  2UWL B;  1JV2 B;  5JVY A;  4JZD L;  1EGF A;  1PGE A;  1HZ8 A;  4LOR A;  2P94 L;  4PH9 A;  4ZH8 B;  1LPG A;  2MGR A;  2P95 L;  1AUT L;  1KLJ L;  2VH6 B;  5CKQ A;  2EI7 B;  1NT0 A;  1DQB A;  4Z0L A;  3ZYJ B;  3N8V A;  1FAK L;  3BPS E;  2XC0 L;  3RR3 A;  4BXW A;  3MDL A;  3H5C B;  3KQD L;  1BF9 A;  1YUG A;  2YGO A;  2MGP A;  3SOB B;  1PTH A;  5IKV A;  1K36 A;  1GK5 A;  1ZAQ A;  1YGC L;  2PR3 B;  3N8Y A;  1M1X B;  4AQT A;  3CA7 A;  1G1R A;  4A7I A;  3HS5 A;  3HPT A;  5F1A A;  1IQJ L;  3FCS B;  1F7M A;  4NG9 L;  3FFG L;  3CEN L;  1LQD A;  2W2P E;  1HAF A;  3U73 A;  3N8Z A;  4Y7B B;  4Y76 B;  2WFT A;  5I46 L;  5L2Z L;  1EMN A;  3M37 L;  2RA0 L;  2FZZ L;  4XLW A;  1LPZ A;  1UZQ A;  1EAI C;  2XBY L;  2VVU L;  3NTB A;  2JKH L;  1UZK A;  4D0E A;  1IOX A;  1HJ7 A;  2Y38 A;  3SW2 A;  1HRF A;  4O02 B;  1EPI A;  1JL9 A;  2B7D L;  4X8T L;  2KL7 A;  1EPG A;  2Y82 B;  4BTU A;  1NFU B;  1F0R B;  2I9B A;  2XBV L;  2WYJ B;  3F6U L;  4O1Z A;  1HAE A;  1EQH A;  2WG3 C;  2UWO B;  3POY A;  1Q4G A;  1FFM A;  1IQN L;  2CJI B;  3TK5 B;  2W3K B;  3GCW E;  5EGM B;  1O5D L;  4C16 A;  1COU A;  1G1Q A;  1FAX L;  2WFX B;  1IQE L;  1HCG B;  2UWP B;  1ATE A;  2WPI E;  5KN5 C;  2I9A A;  1CQE A;  5IKR A;  5JB8 E;  1YUF A;  2G00 L;  2AYL A;  3KQC L;  1IQH L;  4NA9 L;  4Y6D B;  1YO8 A;  3MQE A;  2Y81 B;  4Y71 B;  3TZI A;  2WPL E;  1N1I A;  1NFW B;  1XKA L;  2VWL L;  5COX A;  4FM5 A;  3OLT A;  3LN0 A;  4TGF A;  4Y79 B;  3NTG A;  1LPK A;  1EBV A;  1NFY B;  1FF7 A;  3TH3 L;  2TGF A;  5JBC E;  2P93 L;  1CEJ A;  2M74 A;  4XBM A;  2Y5H L;  2BO2 A;  4CUD A;  1WU1 B;  4BTI A;  3N8W A;  2J34 B;  2FLR L;  3KK6 A;  4YT6 L;  1XKB A;  3BT2 A;  2MHP A;  2YGP A;  1J9C L;  5JBA E;  2WYG B;  2WPK E;  4G1M B;  4ZXY L;  3HS7 A;  5JW1 A;  3LAQ A;  4X8S L;  1KSN B;  1CCV A;  4ZAE B;  1A3P A;  3V65 B;  3ZYG A;  2J95 B;  2GD4 A;  2P3F L;  2OYU P;  2BZ6 L;  2FD6 A;  3LC5 B;  1DVA L;  2WPM E;  3IJE B;  2XBW L;  4MMY B;  1IVO C;  1TLE A;  5E8D A;  3TGF A;  1I0U A;  4ZXX L;  1K37 A;  1W7X L;  1X7A L;  2W3I B;  4M10 A;  1Z6E L;  1KIG L;  1DX5 I;  2Y80 B;  1CCF A;  2BOH A;  3K9X A;  1L3Y A;  1IP0 A;  2VVV L;  1ATB A;  4ISH L;  4MMZ B;  2ADX A;  5KIR A;  2Y5F L;  4JZF L;  3BT1 A;  2KB9 A;  3F1S B;  4COX A;  5IKQ A;  1UZJ A;  2FLB L;  3TBD A;  3KCG L;  1C5M F;  4D90 A;  1B9W A;  4ZHA B;  1NPE B;  1IGZ A;  1OB1 C;  2EI8 B;  2W2M E;  4Y7A B;  4Z0K B;  3IIT B;  3QCW A;  2BQ7 A;  2BOX A;  2VWN L;  2W26 B;  1DDX A;  4E1G A;  3KRK A;  5L2Y L;  2BQW A;  1P0S L;  3LIW B;  4CUE A;  1NQL B;  3KQB L;  1Z6C A;  2P3T A;  1IOE L;  1MQ6 L;  6COX A;  1RFN B;  1HT8 A;  4XL1 A;  1F0S B;  1WHF A;  4MMX B; 
#chains in the Genus database with same CATH topology
 2VH0 B;  5CIS A;  5CKN A;  1HX2 A;  3TK6 B;  3ELA L;  1V3X B;  3KL6 B;  2Y7Z B;  2J38 B;  3LTF B;  1XDT R;  2BMG A;  2EI6 B;  1U67 A;  3N8Y B;  3U7U G;  1QFK L;  2H9E L;  1W8B L;  2Y7X B;  1SZB A;  1DIY A;  1XFE A;  3LN1 A;  2W2O E;  5IKT A;  4Z6A L;  4CSY A;  1P9J A;  1EQG A;  2K2T A;  2PUQ L;  4JZE L;  3NT1 A;  4RRZ A;  1KLO A;  4BXS A;  2P3U A;  1EZQ B;  1APO A;  1IQL L;  1KLI L;  2DDU A;  4LMF A;  3KQE L;  3SOV A;  4BDW A;  2VVC K;  4YZU B;  3ENS A;  4RRY A;  5JB9 E;  4ISI L;  1PRH A;  1LK9 A;  2K2S B;  2VRS A;  1G2L B;  4M11 A;  3SOQ A;  2XC5 L;  3FBY A;  1L5G B;  2FLG A;  2J2U B;  5FDQ A;  5CKM A;  3GCX E;  1HRE A;  2OYE P;  2W2Q E;  3NJP C;  2VJ3 A;  2F9B L;  2P3F N;  3DEM A;  3P5B L;  1PXX A;  3HO3 A;  4BTT A;  4RRW A;  1TPG A;  5JVZ A;  1NZI A;  2BOK L;  1ADX A;  2XC4 L;  1CX2 A;  2WG4 B;  3CS7 L;  4X8V L;  1ATD A;  5K0H B;  1YUK B;  1CVW L;  5JBB E;  2KV4 A;  2NPR A;  1IJQ A;  1URK A;  2P28 B;  2RNL A;  1CVU A;  5L30 L;  3HO5 A;  4NGA L;  3QMO A;  3QH0 A;  4RUT A;  2W86 A;  4CUF A;  1G1S A;  3ASI A;  1IQI L;  1APQ A;  1N7D A;  1G2M B;  1ATA A;  3GIS X;  2Y5G L;  3Q3K B;  1MQ5 L;  2VWM K;  1IQF L;  3EGF A;  2W2N E;  1FE2 A;  3PGH A;  1TOZ A;  3OLU A;  4JYV L;  2BQ6 A;  4JYU L;  4OTY A;  1MOX C;  1PFX L;  4RS0 A;  1IQK L;  1G1T A;  1FJS L;  3M36 L;  1EPJ A;  1HT5 A;  2BT8 A;  3CFW A;  1IQG L;  4YT7 L;  4BDX A;  1JBU L;  2BOU A;  2J4I B;  1U8C B;  3C9A C;  2BT7 A;  2P16 L;  4A94 C;  3LC3 B;  3LTG D;  1EPH A;  3R05 A;  2PHB B;  2Q1J B;  2WPJ E;  1IQM L;  2D1J B;  3N8W B;  1IGX A;  1EMO A;  3N8X A;  2HOR A;  2RHP A;  1UZP A;  3HS6 A;  1F7E A;  1NFX B;  2WPH E;  1LMJ A;  2XBX L;  3Q7D A;  2P26 A;  1FSB A;  1WHE A;  5F19 A;  2J94 B;  2VWO L;  3HO4 A;  4OTJ A;  3V64 C;  4D0F A;  3ZYI B;  4RRX A;  4X8U L;  2UWL B;  1JV2 B;  5JVY A;  4JZD L;  1EGF A;  1PGE A;  1HZ8 A;  4LOR A;  2P94 L;  4PH9 A;  4ZH8 B;  1LPG A;  2MGR A;  2P95 L;  1AUT L;  1KLJ L;  2VH6 B;  5CKQ A;  2EI7 B;  1NT0 A;  1DQB A;  4Z0L A;  3ZYJ B;  3N8V A;  1FAK L;  3BPS E;  2XC0 L;  1QIU A;  3RR3 A;  4BXW A;  3MDL A;  3H5C B;  3KQD L;  1BF9 A;  1YUG A;  2YGO A;  2MGP A;  1LMM A;  3SOB B;  1PTH A;  5IKV A;  1K36 A;  1GK5 A;  1ZAQ A;  1YGC L;  2PR3 B;  3N8Y A;  1M1X B;  4AQT A;  3CA7 A;  1G1R A;  4A7I A;  3HS5 A;  3HPT A;  5F1A A;  1IQJ L;  3FCS B;  1F7M A;  4NG9 L;  3FFG L;  3CEN L;  1LQD A;  2W2P E;  1HAF A;  3U73 A;  3N8Z A;  4Y7B B;  4GU3 A;  4Y76 B;  2WFT A;  1V1H A;  5I46 L;  5L2Z L;  1EMN A;  2YGQ A;  3M37 L;  2RA0 L;  2FZZ L;  4XLW A;  1LPZ A;  1UZQ A;  1EAI C;  2XBY L;  2VVU L;  3NTB A;  1V1I A;  2JKH L;  1UZK A;  4D0E A;  1IOX A;  1HJ7 A;  2Y38 A;  3SW2 A;  1HRF A;  4O02 B;  1EPI A;  1JL9 A;  2B7D L;  4X8T L;  2KL7 A;  1EPG A;  2Y82 B;  2KNI A;  4BTU A;  1NFU B;  1F0R B;  2I9B A;  2XBV L;  2WYJ B;  3F6U L;  4O1Z A;  2JJL A;  1HAE A;  1EQH A;  2WG3 C;  2UWO B;  3POY A;  1Q4G A;  1FFM A;  1IQN L;  2CJI B;  3TK5 B;  2W3K B;  3GCW E;  5EGM B;  1O5D L;  4C16 A;  1COU A;  1G1Q A;  1FAX L;  1KKE A;  2WFX B;  1IQE L;  1HCG B;  2UWP B;  1ATE A;  2WPI E;  5KN5 C;  2I9A A;  1CQE A;  5IKR A;  5JB8 E;  1YUF A;  2G00 L;  2AYL A;  3KQC L;  1IQH L;  4NA9 L;  4Y6D B;  1YO8 A;  3MQE A;  2H9E C;  2Y81 B;  4Y71 B;  3TZI A;  2WPL E;  1N1I A;  1NFW B;  1XKA L;  2VWL L;  5COX A;  4FM5 A;  3OLT A;  3LN0 A;  4TGF A;  4Y79 B;  3NTG A;  1LPK A;  1EBV A;  1NFY B;  1FF7 A;  3TH3 L;  2TGF A;  5JBC E;  2P93 L;  1CEJ A;  2M74 A;  4GU4 A;  4XBM A;  2Y5H L;  2BO2 A;  4CUD A;  1WU1 B;  4BTI A;  3N8W A;  2J34 B;  2FLR L;  3KK6 A;  4YT6 L;  2BSF A;  1XKB A;  3BT2 A;  2MHP A;  2YGP A;  1J9C L;  5JBA E;  2WYG B;  2WPK E;  4G1M B;  4ZXY L;  3HS7 A;  5JW1 A;  3LAQ A;  4X8S L;  1KSN B;  1CCV A;  4ZAE B;  1A3P A;  3V65 B;  3ZYG A;  2J95 B;  2GD4 A;  2P3F L;  2OYU P;  2BZ6 L;  2FD6 A;  3LC5 B;  1DVA L;  2WPM E;  3IJE B;  2XBW L;  4MMY B;  2WZP P;  1IVO C;  1TLE A;  5E8D A;  3TGF A;  1I0U A;  4ZXX L;  1K37 A;  1W7X L;  1X7A L;  2W3I B;  4M10 A;  1Z6E L;  1KIG L;  1DX5 I;  2Y80 B;  1CCF A;  2BOH A;  3K9X A;  1L3Y A;  1IP0 A;  2VVV L;  1ATB A;  4ISH L;  4MMZ B;  2ADX A;  5KIR A;  2Y5F L;  4JZF L;  3BT1 A;  2KB9 A;  3F1S B;  4COX A;  5IKQ A;  1UZJ A;  2FLB L;  3TBD A;  3KCG L;  1C5M F;  4D90 A;  1B9W A;  4ZHA B;  1NPE B;  1IGZ A;  1OB1 C;  2EI8 B;  2W2M E;  4Y7A B;  4Z0K B;  3IIT B;  2HOX A;  3QCW A;  2BQ7 A;  2BOX A;  2VWN L;  2W26 B;  1DDX A;  4E1G A;  3KRK A;  5L2Y L;  2BQW A;  1P0S L;  3LIW B;  4CUE A;  1NQL B;  3KQB L;  1Z6C A;  2P3T A;  1IOE L;  1MQ6 L;  6COX A;  1RFN B;  1HT8 A;  4XL1 A;  3S6X A;  1F0S B;  1WHF A;  4MMX B; 
#chains in the Genus database with same CATH homology
 2VH0 B;  5CIS A;  5CKN A;  1HX2 A;  3TK6 B;  3ELA L;  1V3X B;  3KL6 B;  2Y7Z B;  2J38 B;  3LTF B;  1XDT R;  2BMG A;  2EI6 B;  1U67 A;  3N8Y B;  3U7U G;  1QFK L;  2H9E L;  1W8B L;  2Y7X B;  1SZB A;  1DIY A;  1XFE A;  3LN1 A;  2W2O E;  5IKT A;  4Z6A L;  4CSY A;  1P9J A;  1EQG A;  2K2T A;  2PUQ L;  4JZE L;  3NT1 A;  4RRZ A;  1KLO A;  4BXS A;  2P3U A;  1EZQ B;  1APO A;  1IQL L;  1KLI L;  2DDU A;  4LMF A;  3KQE L;  3SOV A;  4BDW A;  2VVC K;  4YZU B;  3ENS A;  4RRY A;  5JB9 E;  4ISI L;  1PRH A;  2K2S B;  1G2L B;  4M11 A;  3SOQ A;  2XC5 L;  3FBY A;  1L5G B;  2FLG A;  2J2U B;  5FDQ A;  5CKM A;  3GCX E;  1HRE A;  2OYE P;  2W2Q E;  3NJP C;  2VJ3 A;  2F9B L;  2P3F N;  3DEM A;  3P5B L;  1PXX A;  3HO3 A;  4BTT A;  4RRW A;  1TPG A;  5JVZ A;  1NZI A;  2BOK L;  1ADX A;  2XC4 L;  1CX2 A;  2WG4 B;  3CS7 L;  4X8V L;  1ATD A;  5K0H B;  1YUK B;  1CVW L;  5JBB E;  2KV4 A;  2NPR A;  1IJQ A;  1URK A;  2P28 B;  2RNL A;  1CVU A;  5L30 L;  3HO5 A;  4NGA L;  3QMO A;  3QH0 A;  4RUT A;  2W86 A;  4CUF A;  1G1S A;  3ASI A;  1IQI L;  1APQ A;  1N7D A;  1G2M B;  1ATA A;  3GIS X;  2Y5G L;  3Q3K B;  1MQ5 L;  2VWM K;  1IQF L;  3EGF A;  2W2N E;  1FE2 A;  3PGH A;  1TOZ A;  3OLU A;  4JYV L;  2BQ6 A;  4JYU L;  4OTY A;  1MOX C;  1PFX L;  4RS0 A;  1IQK L;  1G1T A;  1FJS L;  3M36 L;  1EPJ A;  1HT5 A;  3CFW A;  1IQG L;  4YT7 L;  4BDX A;  1JBU L;  2BOU A;  2J4I B;  1U8C B;  3C9A C;  2P16 L;  4A94 C;  3LC3 B;  3LTG D;  1EPH A;  3R05 A;  2PHB B;  2Q1J B;  2WPJ E;  1IQM L;  2D1J B;  3N8W B;  1IGX A;  1EMO A;  3N8X A;  2RHP A;  1UZP A;  3HS6 A;  1F7E A;  1NFX B;  2WPH E;  1LMJ A;  2XBX L;  3Q7D A;  2P26 A;  1FSB A;  1WHE A;  5F19 A;  2J94 B;  2VWO L;  3HO4 A;  4OTJ A;  3V64 C;  4D0F A;  3ZYI B;  4RRX A;  4X8U L;  2UWL B;  1JV2 B;  5JVY A;  4JZD L;  1EGF A;  1PGE A;  1HZ8 A;  4LOR A;  2P94 L;  4PH9 A;  4ZH8 B;  1LPG A;  2MGR A;  2P95 L;  1AUT L;  1KLJ L;  2VH6 B;  5CKQ A;  2EI7 B;  1NT0 A;  1DQB A;  4Z0L A;  3ZYJ B;  3N8V A;  1FAK L;  3BPS E;  2XC0 L;  3RR3 A;  4BXW A;  3MDL A;  3H5C B;  3KQD L;  1BF9 A;  1YUG A;  2YGO A;  2MGP A;  1LMM A;  3SOB B;  1PTH A;  5IKV A;  1K36 A;  1GK5 A;  1ZAQ A;  1YGC L;  2PR3 B;  3N8Y A;  1M1X B;  4AQT A;  3CA7 A;  1G1R A;  4A7I A;  3HS5 A;  3HPT A;  5F1A A;  1IQJ L;  3FCS B;  1F7M A;  4NG9 L;  3FFG L;  3CEN L;  1LQD A;  2W2P E;  1HAF A;  3U73 A;  3N8Z A;  4Y7B B;  4Y76 B;  2WFT A;  5I46 L;  5L2Z L;  1EMN A;  2YGQ A;  3M37 L;  2RA0 L;  2FZZ L;  4XLW A;  1LPZ A;  1UZQ A;  1EAI C;  2XBY L;  2VVU L;  3NTB A;  2JKH L;  1UZK A;  4D0E A;  1IOX A;  1HJ7 A;  2Y38 A;  3SW2 A;  1HRF A;  4O02 B;  1EPI A;  1JL9 A;  2B7D L;  4X8T L;  2KL7 A;  1EPG A;  2Y82 B;  2KNI A;  4BTU A;  1NFU B;  1F0R B;  2I9B A;  2XBV L;  2WYJ B;  3F6U L;  4O1Z A;  1HAE A;  1EQH A;  2WG3 C;  2UWO B;  3POY A;  1Q4G A;  1FFM A;  1IQN L;  2CJI B;  3TK5 B;  2W3K B;  3GCW E;  5EGM B;  1O5D L;  4C16 A;  1COU A;  1G1Q A;  1FAX L;  2WFX B;  1IQE L;  1HCG B;  2UWP B;  1ATE A;  2WPI E;  5KN5 C;  2I9A A;  1CQE A;  5IKR A;  5JB8 E;  1YUF A;  2G00 L;  2AYL A;  3KQC L;  1IQH L;  4NA9 L;  4Y6D B;  1YO8 A;  3MQE A;  2H9E C;  2Y81 B;  4Y71 B;  3TZI A;  2WPL E;  1N1I A;  1NFW B;  1XKA L;  2VWL L;  5COX A;  4FM5 A;  3OLT A;  3LN0 A;  4TGF A;  4Y79 B;  3NTG A;  1LPK A;  1EBV A;  1NFY B;  1FF7 A;  3TH3 L;  2TGF A;  5JBC E;  2P93 L;  1CEJ A;  2M74 A;  4XBM A;  2Y5H L;  2BO2 A;  4CUD A;  1WU1 B;  4BTI A;  3N8W A;  2J34 B;  2FLR L;  3KK6 A;  4YT6 L;  1XKB A;  3BT2 A;  2MHP A;  2YGP A;  1J9C L;  5JBA E;  2WYG B;  2WPK E;  4G1M B;  4ZXY L;  3HS7 A;  5JW1 A;  3LAQ A;  4X8S L;  1KSN B;  1CCV A;  4ZAE B;  1A3P A;  3V65 B;  3ZYG A;  2J95 B;  2GD4 A;  2P3F L;  2OYU P;  2BZ6 L;  2FD6 A;  3LC5 B;  1DVA L;  2WPM E;  3IJE B;  2XBW L;  4MMY B;  2WZP P;  1IVO C;  1TLE A;  5E8D A;  3TGF A;  1I0U A;  4ZXX L;  1K37 A;  1W7X L;  1X7A L;  2W3I B;  4M10 A;  1Z6E L;  1KIG L;  1DX5 I;  2Y80 B;  1CCF A;  2BOH A;  3K9X A;  1L3Y A;  1IP0 A;  2VVV L;  1ATB A;  4ISH L;  4MMZ B;  2ADX A;  5KIR A;  2Y5F L;  4JZF L;  3BT1 A;  2KB9 A;  3F1S B;  4COX A;  5IKQ A;  1UZJ A;  2FLB L;  3TBD A;  3KCG L;  1C5M F;  4D90 A;  1B9W A;  4ZHA B;  1NPE B;  1IGZ A;  1OB1 C;  2EI8 B;  2W2M E;  4Y7A B;  4Z0K B;  3IIT B;  3QCW A;  2BQ7 A;  2BOX A;  2VWN L;  2W26 B;  1DDX A;  4E1G A;  3KRK A;  5L2Y L;  2BQW A;  1P0S L;  3LIW B;  4CUE A;  1NQL B;  3KQB L;  1Z6C A;  2P3T A;  1IOE L;  1MQ6 L;  6COX A;  1RFN B;  1HT8 A;  4XL1 A;  3S6X A;  1F0S B;  1WHF A;  4MMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...