1G1EB

Nmr structure of the human mad1 transrepression domain sid in complex with mammalian sin3a pah2 domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
b'SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MAD1 PROTEIN
publication title Solution structure of the interacting domains of the Mad-Sin3 complex: implications for recruitment of a chromatin-modifying complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 27
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02671 PAH Paired amphipathic helix repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1160.11 Mainly Alpha Up-down Bundle Paired amphipathic helix 2 (pah2 repeat) Paired amphipathic helix 1g1eB00
2RMSA 1G1EB 1PD7A 2CR7A 1S5RB 2F05A 2RMRA 2LD7B 2CZYA 1S5QB 1E91A 2L9SB
chains in the Genus database with same CATH superfamily
4YKCA 2LSRA 1PD7A 2CR7A 1S5RB 4FQNA 2RMRA 2L9SB 2RMSA 1G1EB 2KBQA 4YKDA 4YL6A 2LD7B 2CZYA 2KBRA 1E91A 3K1RA 2F05A 1S5QB 4Y5OA 5F3XA
chains in the Genus database with same CATH topology
2RMSA 1G1EB 1PD7A 2CR7A 1S5RB 2F05A 2RMRA 2LD7B 2CZYA 1S5QB 1E91A 2L9SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMS A;  1G1E B;  1PD7 A;  2CR7 A;  1S5R B;  2F05 A;  2RMR A;  2LD7 B;  2CZY A;  1S5Q B;  1E91 A;  2L9S B; 
#chains in the Genus database with same CATH topology
 4YKC A;  2LSR A;  1PD7 A;  2CR7 A;  1S5R B;  4FQN A;  2RMR A;  2L9S B;  2RMS A;  1G1E B;  2KBQ A;  4YKD A;  4YL6 A;  2LD7 B;  2CZY A;  2KBR A;  1E91 A;  3K1R A;  2F05 A;  1S5Q B;  4Y5O A;  5F3X A; 
#chains in the Genus database with same CATH homology
 2RMS A;  1G1E B;  1PD7 A;  2CR7 A;  1S5R B;  2F05 A;  2RMR A;  2LD7 B;  2CZY A;  1S5Q B;  1E91 A;  2L9S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...