1G6EA

Antifungal protein from streptomyces tendae tu901, 30-conformers ensemble
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
b'MINRTDCNENSYLEIHNNEGRDTLCFANAGTMPVAIYGVNWVESGNNVVTLQFQRNLSDPRLETITLQKWGSWNPGHIHEILSIRIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIFUNGAL PROTEIN
publication title Solution structure, backbone dynamics and chitin binding of the anti-fungal protein from Streptomyces tendae TU901.
pubmed doi rcsb
source organism Streptomyces tendae
molecule tags Antifungal protein
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2000-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09076 Crystall_2 Beta/Gamma crystallin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.20.30 Mainly Beta Sandwich Gamma-B Crystallin; domain 1 Gamma-B Crystallin; domain 1 1g6eA00
1GH5A 1F53A 1G6EA 1C01A 1BHUA
chains in the Genus database with same CATH superfamily
2K1XA 4W9AA 2KFBA 4IAUA 1YHPA 1GCSA 1ZIRA 1BLBA 4GR7A 1ZGTA 1AMMA 3SO0A 1F53A 3LWKA 1NPSA 2BB2A 4PSPA 1OKIA 1HK0X 5HT8A 1HA4A 1E7NA 2V2UA 2DADA 4EL6A 2M3UA 3I9HA 1ELPA 1G6EA 4W9BA 3UJZA 3ENTA 5HT9A 2BV2A 2M3TA 1C01A 1BHUA 3SNZA 3ENUA 2JDGA 1AG4A 1PRRA 1HDFA 1BD7A 1GAMA 1ZWMA 3SNYA 1ZWOA 2NBRA 1WKTA 2B1OA 1YTQA 3HZBA 2A5MA 2G98A 1A45A 4JGFA 2M3CA 3HZ2A 4GCRA 1GH5A 2K1WA 4NI3A 1ZIEA 1PRSA 1DSLA 2JDFA 1A7HA 3CW3A 1A5DA 3SO1A 3QK3A 3IAJA 4FD9A 2KP5A 1I5IA 1H4AX 4PSRA 4AKAA 1ZIQA 1M8UA
chains in the Genus database with same CATH topology
1GH5A 1F53A 1WKTA 1G6EA 1C01A 1BHUA 3UJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GH5 A;  1F53 A;  1G6E A;  1C01 A;  1BHU A; 
#chains in the Genus database with same CATH topology
 2K1X A;  4W9A A;  2KFB A;  4IAU A;  1YHP A;  1GCS A;  1ZIR A;  1BLB A;  4GR7 A;  1ZGT A;  1AMM A;  3SO0 A;  1F53 A;  3LWK A;  1NPS A;  2BB2 A;  4PSP A;  1OKI A;  1HK0 X;  5HT8 A;  1HA4 A;  1E7N A;  2V2U A;  2DAD A;  4EL6 A;  2M3U A;  3I9H A;  1ELP A;  1G6E A;  4W9B A;  3UJZ A;  3ENT A;  5HT9 A;  2BV2 A;  2M3T A;  1C01 A;  1BHU A;  3SNZ A;  3ENU A;  2JDG A;  1AG4 A;  1PRR A;  1HDF A;  1BD7 A;  1GAM A;  1ZWM A;  3SNY A;  1ZWO A;  2NBR A;  1WKT A;  2B1O A;  1YTQ A;  3HZB A;  2A5M A;  2G98 A;  1A45 A;  4JGF A;  2M3C A;  3HZ2 A;  4GCR A;  1GH5 A;  2K1W A;  4NI3 A;  1ZIE A;  1PRS A;  1DSL A;  2JDF A;  1A7H A;  3CW3 A;  1A5D A;  3SO1 A;  3QK3 A;  3IAJ A;  4FD9 A;  2KP5 A;  1I5I A;  1H4A X;  4PSR A;  4AKA A;  1ZIQ A;  1M8U A; 
#chains in the Genus database with same CATH homology
 1GH5 A;  1F53 A;  1WKT A;  1G6E A;  1C01 A;  1BHU A;  3UJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...