1G6MA

Nmr solution structure of cbt2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQTPTTTGCSGGENNCYKKEWRDNRGYRTERGCGCPSVKKGIGINCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution structure of CBT2
rcsb
molecule tags Toxin
molecule keywords SHORT NEUROTOXIN 1
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2000-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1g6mA00
2FD6U 2OFSA 3LAQU 2CCXA 2HLRA 1F8UB 1H0JA 1NYSA 2H7ZB 1NXBA 3U73U 2VLWA 1CDSA 1NORA 3NEQA 4UY2C 3KFDE 1KBSA 2H62C 1CRFA 1HAAA 3NH7A 2UX2A 2X8BB 4AEAA 1QM7A 1IJCA 1FFJA 1YWHA 1ONJA 2MFAA 2CTXA 3BT1U 2QJ9C 4XJJA 1JGKA 1IKCA 1LSIA 3KFDI 2L03A 1NTNA 2MJYA 3BT2U 5DZ5A 1NEAA 1V6PA 2LCRA 2QJBC 1PLOA 2H64C 1IDGA 1TGXA 2GOOC 2MJ4A 3VTSA 1FASA 1BXPA 2PJYC 2BTXA 3NDSA 1HC9A 2N99A 2H62D 2H64B 1KC4A 5IMYC 1M9ZA 2ABXA 2I9BE 2JQPA 3EBXA 1HAJA 2K3GA 1IK8A 1HC9B 1KBAA 2JVEA 4BDTB 2CDXA 1CB9A 1IDLA 1KFHA 2BHIA 6EBXA 2ERAA 4EY8B 1KBTA 1MAHF 2L5SA 3HH7A 1KL8A 4QTIU 1DRSA 5DO6A 1FF4A 1KXIA 3ERAA 1G6MA 4OM5A 1FSCA 1W6BA 1CHVS 4BIKB 1NYUA 1IQ9A 1KU6B 2J8BA 2QJAC 1CCQA 1FRAA 2GOOB 4P7UA 1IDHA 1NTXA 4FAOC 4ZQYA 1CDRA 1VB0A 2MJ0A 1CVOA 4HQPF 1TXAA 2MHYA 1COEA 1B41B 5EBXA 1IDIA 1CXOA 1LJZA 1RGJA 4DO8A 4FAOE 4OM4A 1QKEA 4IYEA 1ZADA 2HLQA 1ES7B 2MUOA 3U74U 2QC1A 2H7ZA 3FEVA 4RUDA 1BTEA 1F94A 1I02A 3PLCA 1ERGA 1KTZB 5IMTD 1CREA 1XT3A 2LA1A 1CDQA 1LXHA 1FSSB 2PJYB 1RL5A 2NBTA 1S4YA 1CTXA 4LFTA 1CDTA 1MR6A 5DU1A 1TFSA 3EVSC 1ABTA 2CRTA 1L4WA 1KS6A 1LX5B 2MUPA 3QB4B 1TXBA 1LXGA 1HOYA 1CODA 2UWRA 1ERAA 2CRSA 1REWC 1QKDA 1JBDA 2H5FA 1CXNA 1JE9A 2H8UA 1UG4A
chains in the Genus database with same CATH superfamily
2FD6U 2OFSA 3LAQU 2CCXA 2HLRA 1F8UB 1H0JA 1NYSA 2H7ZB 1NXBA 3U73U 2VLWA 1CDSA 1NORA 3NEQA 4KSNA 4UY2C 3KFDE 1KBSA 2H62C 1CRFA 1HAAA 3NH7A 2UX2A 2X8BB 4AEAA 1QM7A 1IJCA 1FFJA 1YWHA 1ONJA 2MFAA 2CTXA 3BT1U 2QJ9C 4XJJA 1JGKA 1IKCA 1LSIA 3KFDI 2L03A 1NTNA 2MJYA 3BT2U 5DZ5A 1NEAA 1V6PA 2LCRA 2QJBC 1PLOA 2H64C 1IDGA 1TGXA 2GOOC 2MJ4A 3VTSA 1FASA 1BXPA 2PJYC 2BTXA 3NDSA 1HC9A 2N99A 2H62D 2H64B 1KC4A 5IMYC 1M9ZA 2ABXA 2I9BE 2JQPA 3EBXA 1HAJA 2K3GA 1IK8A 1HC9B 1KBAA 2JVEA 4BDTB 2CDXA 1CB9A 1IDLA 1KFHA 2BHIA 6EBXA 2ERAA 4EY8B 1KBTA 1MAHF 2L5SA 3HH7A 1KL8A 4QTIU 1DRSA 5DO6A 1FF4A 1KXIA 3ERAA 1G6MA 4OM5A 1FSCA 1W6BA 1CHVS 4BIKB 1NYUA 1IQ9A 1KU6B 2J8BA 2QJAC 1CCQA 1FRAA 2GOOB 4P7UA 1IDHA 1NTXA 4FAOC 4ZQYA 1CDRA 1VB0A 2MJ0A 1CVOA 4HQPF 1TXAA 2MHYA 1COEA 1B41B 5EBXA 1IDIA 1CXOA 1LJZA 1RGJA 4DO8A 4FAOE 4OM4A 1QKEA 4IYEA 1ZADA 2HLQA 1ES7B 2MUOA 3U74U 2QC1A 2H7ZA 3FEVA 4RUDA 1BTEA 1F94A 1I02A 3PLCA 1ERGA 1KTZB 5IMTD 1CREA 1XT3A 2LA1A 1CDQA 1LXHA 1FSSB 2PJYB 1RL5A 2NBTA 1S4YA 1CTXA 4LFTA 1CDTA 1MR6A 5DU1A 1TFSA 3EVSC 1ABTA 2CRTA 1L4WA 1KS6A 1LX5B 2MUPA 3QB4B 1TXBA 1LXGA 1HOYA 1CODA 2UWRA 1ERAA 2CRSA 1REWC 1QKDA 1JBDA 2H5FA 1CXNA 1JE9A 2H8UA 1UG4A
chains in the Genus database with same CATH topology
2FD6U 2OFSA 3LAQU 2CCXA 2HLRA 1F8UB 1H0JA 1NYSA 2H7ZB 1NXBA 3U73U 2VLWA 1CDSA 1NORA 3NEQA 4KSNA 4UY2C 3KFDE 1KBSA 2H62C 1CRFA 1HAAA 3NH7A 2UX2A 2X8BB 4AEAA 1QM7A 1IJCA 1FFJA 1YWHA 1ONJA 2MFAA 2CTXA 3BT1U 2QJ9C 4XJJA 1JGKA 1IKCA 1LSIA 3KFDI 2L03A 1NTNA 2MJYA 3BT2U 5DZ5A 1NEAA 1V6PA 2LCRA 2QJBC 1PLOA 2H64C 1IDGA 1TGXA 2GOOC 2MJ4A 3VTSA 1FASA 1BXPA 2PJYC 2BTXA 3NDSA 1HC9A 2N99A 2H62D 2H64B 1KC4A 5IMYC 1M9ZA 2ABXA 2I9BE 2JQPA 3EBXA 1HAJA 2K3GA 1IK8A 1HC9B 1KBAA 2JVEA 4BDTB 2CDXA 1CB9A 1IDLA 1KFHA 2BHIA 6EBXA 2ERAA 4EY8B 1KBTA 1MAHF 2L5SA 3HH7A 1KL8A 4QTIU 1DRSA 5DO6A 1FF4A 1KXIA 3ERAA 1G6MA 4OM5A 1FSCA 1W6BA 1CHVS 4BIKB 1NYUA 1IQ9A 1KU6B 2J8BA 2QJAC 1CCQA 1FRAA 2GOOB 4P7UA 1IDHA 1NTXA 4FAOC 4ZQYA 1CDRA 1VB0A 2MJ0A 1CVOA 4HQPF 1TXAA 2MHYA 1COEA 1B41B 5EBXA 1IDIA 1CXOA 1LJZA 1RGJA 4DO8A 4FAOE 4OM4A 1QKEA 4IYEA 1ZADA 2HLQA 1ES7B 2MUOA 3U74U 2QC1A 2H7ZA 3FEVA 4RUDA 1BTEA 1F94A 1I02A 3PLCA 1ERGA 1KTZB 5IMTD 1CREA 1XT3A 2LA1A 1CDQA 1LXHA 1FSSB 2PJYB 1RL5A 2NBTA 1S4YA 1CTXA 4LFTA 1CDTA 1MR6A 5DU1A 1TFSA 3EVSC 1ABTA 2CRTA 1L4WA 1KS6A 1LX5B 2MUPA 3QB4B 1TXBA 1LXGA 1HOYA 1CODA 2UWRA 1ERAA 2CRSA 1REWC 1QKDA 1JBDA 2H5FA 1CXNA 1JE9A 2H8UA 1UG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD6 U;  2OFS A;  3LAQ U;  2CCX A;  2HLR A;  1F8U B;  1H0J A;  1NYS A;  2H7Z B;  1NXB A;  3U73 U;  2VLW A;  1CDS A;  1NOR A;  3NEQ A;  4UY2 C;  3KFD E;  1KBS A;  2H62 C;  1CRF A;  1HAA A;  3NH7 A;  2UX2 A;  2X8B B;  4AEA A;  1QM7 A;  1IJC A;  1FFJ A;  1YWH A;  1ONJ A;  2MFA A;  2CTX A;  3BT1 U;  2QJ9 C;  4XJJ A;  1JGK A;  1IKC A;  1LSI A;  3KFD I;  2L03 A;  1NTN A;  2MJY A;  3BT2 U;  5DZ5 A;  1NEA A;  1V6P A;  2LCR A;  2QJB C;  1PLO A;  2H64 C;  1IDG A;  1TGX A;  2GOO C;  2MJ4 A;  3VTS A;  1FAS A;  1BXP A;  2PJY C;  2BTX A;  3NDS A;  1HC9 A;  2N99 A;  2H62 D;  2H64 B;  1KC4 A;  5IMY C;  1M9Z A;  2ABX A;  2I9B E;  2JQP A;  3EBX A;  1HAJ A;  2K3G A;  1IK8 A;  1HC9 B;  1KBA A;  2JVE A;  4BDT B;  2CDX A;  1CB9 A;  1IDL A;  1KFH A;  2BHI A;  6EBX A;  2ERA A;  4EY8 B;  1KBT A;  1MAH F;  2L5S A;  3HH7 A;  1KL8 A;  4QTI U;  1DRS A;  5DO6 A;  1FF4 A;  1KXI A;  3ERA A;  1G6M A;  4OM5 A;  1FSC A;  1W6B A;  1CHV S;  4BIK B;  1NYU A;  1IQ9 A;  1KU6 B;  2J8B A;  2QJA C;  1CCQ A;  1FRA A;  2GOO B;  4P7U A;  1IDH A;  1NTX A;  4FAO C;  4ZQY A;  1CDR A;  1VB0 A;  2MJ0 A;  1CVO A;  4HQP F;  1TXA A;  2MHY A;  1COE A;  1B41 B;  5EBX A;  1IDI A;  1CXO A;  1LJZ A;  1RGJ A;  4DO8 A;  4FAO E;  4OM4 A;  1QKE A;  4IYE A;  1ZAD A;  2HLQ A;  1ES7 B;  2MUO A;  3U74 U;  2QC1 A;  2H7Z A;  3FEV A;  4RUD A;  1BTE A;  1F94 A;  1I02 A;  3PLC A;  1ERG A;  1KTZ B;  5IMT D;  1CRE A;  1XT3 A;  2LA1 A;  1CDQ A;  1LXH A;  1FSS B;  2PJY B;  1RL5 A;  2NBT A;  1S4Y A;  1CTX A;  4LFT A;  1CDT A;  1MR6 A;  5DU1 A;  1TFS A;  3EVS C;  1ABT A;  2CRT A;  1L4W A;  1KS6 A;  1LX5 B;  2MUP A;  3QB4 B;  1TXB A;  1LXG A;  1HOY A;  1COD A;  2UWR A;  1ERA A;  2CRS A;  1REW C;  1QKD A;  1JBD A;  2H5F A;  1CXN A;  1JE9 A;  2H8U A;  1UG4 A; 
#chains in the Genus database with same CATH topology
 2FD6 U;  2OFS A;  3LAQ U;  2CCX A;  2HLR A;  1F8U B;  1H0J A;  1NYS A;  2H7Z B;  1NXB A;  3U73 U;  2VLW A;  1CDS A;  1NOR A;  3NEQ A;  4KSN A;  4UY2 C;  3KFD E;  1KBS A;  2H62 C;  1CRF A;  1HAA A;  3NH7 A;  2UX2 A;  2X8B B;  4AEA A;  1QM7 A;  1IJC A;  1FFJ A;  1YWH A;  1ONJ A;  2MFA A;  2CTX A;  3BT1 U;  2QJ9 C;  4XJJ A;  1JGK A;  1IKC A;  1LSI A;  3KFD I;  2L03 A;  1NTN A;  2MJY A;  3BT2 U;  5DZ5 A;  1NEA A;  1V6P A;  2LCR A;  2QJB C;  1PLO A;  2H64 C;  1IDG A;  1TGX A;  2GOO C;  2MJ4 A;  3VTS A;  1FAS A;  1BXP A;  2PJY C;  2BTX A;  3NDS A;  1HC9 A;  2N99 A;  2H62 D;  2H64 B;  1KC4 A;  5IMY C;  1M9Z A;  2ABX A;  2I9B E;  2JQP A;  3EBX A;  1HAJ A;  2K3G A;  1IK8 A;  1HC9 B;  1KBA A;  2JVE A;  4BDT B;  2CDX A;  1CB9 A;  1IDL A;  1KFH A;  2BHI A;  6EBX A;  2ERA A;  4EY8 B;  1KBT A;  1MAH F;  2L5S A;  3HH7 A;  1KL8 A;  4QTI U;  1DRS A;  5DO6 A;  1FF4 A;  1KXI A;  3ERA A;  1G6M A;  4OM5 A;  1FSC A;  1W6B A;  1CHV S;  4BIK B;  1NYU A;  1IQ9 A;  1KU6 B;  2J8B A;  2QJA C;  1CCQ A;  1FRA A;  2GOO B;  4P7U A;  1IDH A;  1NTX A;  4FAO C;  4ZQY A;  1CDR A;  1VB0 A;  2MJ0 A;  1CVO A;  4HQP F;  1TXA A;  2MHY A;  1COE A;  1B41 B;  5EBX A;  1IDI A;  1CXO A;  1LJZ A;  1RGJ A;  4DO8 A;  4FAO E;  4OM4 A;  1QKE A;  4IYE A;  1ZAD A;  2HLQ A;  1ES7 B;  2MUO A;  3U74 U;  2QC1 A;  2H7Z A;  3FEV A;  4RUD A;  1BTE A;  1F94 A;  1I02 A;  3PLC A;  1ERG A;  1KTZ B;  5IMT D;  1CRE A;  1XT3 A;  2LA1 A;  1CDQ A;  1LXH A;  1FSS B;  2PJY B;  1RL5 A;  2NBT A;  1S4Y A;  1CTX A;  4LFT A;  1CDT A;  1MR6 A;  5DU1 A;  1TFS A;  3EVS C;  1ABT A;  2CRT A;  1L4W A;  1KS6 A;  1LX5 B;  2MUP A;  3QB4 B;  1TXB A;  1LXG A;  1HOY A;  1COD A;  2UWR A;  1ERA A;  2CRS A;  1REW C;  1QKD A;  1JBD A;  2H5F A;  1CXN A;  1JE9 A;  2H8U A;  1UG4 A; 
#chains in the Genus database with same CATH homology
 2FD6 U;  2OFS A;  3LAQ U;  2CCX A;  2HLR A;  1F8U B;  1H0J A;  1NYS A;  2H7Z B;  1NXB A;  3U73 U;  2VLW A;  1CDS A;  1NOR A;  3NEQ A;  4KSN A;  4UY2 C;  3KFD E;  1KBS A;  2H62 C;  1CRF A;  1HAA A;  3NH7 A;  2UX2 A;  2X8B B;  4AEA A;  1QM7 A;  1IJC A;  1FFJ A;  1YWH A;  1ONJ A;  2MFA A;  2CTX A;  3BT1 U;  2QJ9 C;  4XJJ A;  1JGK A;  1IKC A;  1LSI A;  3KFD I;  2L03 A;  1NTN A;  2MJY A;  3BT2 U;  5DZ5 A;  1NEA A;  1V6P A;  2LCR A;  2QJB C;  1PLO A;  2H64 C;  1IDG A;  1TGX A;  2GOO C;  2MJ4 A;  3VTS A;  1FAS A;  1BXP A;  2PJY C;  2BTX A;  3NDS A;  1HC9 A;  2N99 A;  2H62 D;  2H64 B;  1KC4 A;  5IMY C;  1M9Z A;  2ABX A;  2I9B E;  2JQP A;  3EBX A;  1HAJ A;  2K3G A;  1IK8 A;  1HC9 B;  1KBA A;  2JVE A;  4BDT B;  2CDX A;  1CB9 A;  1IDL A;  1KFH A;  2BHI A;  6EBX A;  2ERA A;  4EY8 B;  1KBT A;  1MAH F;  2L5S A;  3HH7 A;  1KL8 A;  4QTI U;  1DRS A;  5DO6 A;  1FF4 A;  1KXI A;  3ERA A;  1G6M A;  4OM5 A;  1FSC A;  1W6B A;  1CHV S;  4BIK B;  1NYU A;  1IQ9 A;  1KU6 B;  2J8B A;  2QJA C;  1CCQ A;  1FRA A;  2GOO B;  4P7U A;  1IDH A;  1NTX A;  4FAO C;  4ZQY A;  1CDR A;  1VB0 A;  2MJ0 A;  1CVO A;  4HQP F;  1TXA A;  2MHY A;  1COE A;  1B41 B;  5EBX A;  1IDI A;  1CXO A;  1LJZ A;  1RGJ A;  4DO8 A;  4FAO E;  4OM4 A;  1QKE A;  4IYE A;  1ZAD A;  2HLQ A;  1ES7 B;  2MUO A;  3U74 U;  2QC1 A;  2H7Z A;  3FEV A;  4RUD A;  1BTE A;  1F94 A;  1I02 A;  3PLC A;  1ERG A;  1KTZ B;  5IMT D;  1CRE A;  1XT3 A;  2LA1 A;  1CDQ A;  1LXH A;  1FSS B;  2PJY B;  1RL5 A;  2NBT A;  1S4Y A;  1CTX A;  4LFT A;  1CDT A;  1MR6 A;  5DU1 A;  1TFS A;  3EVS C;  1ABT A;  2CRT A;  1L4W A;  1KS6 A;  1LX5 B;  2MUP A;  3QB4 B;  1TXB A;  1LXG A;  1HOY A;  1COD A;  2UWR A;  1ERA A;  2CRS A;  1REW C;  1QKD A;  1JBD A;  2H5F A;  1CXN A;  1JE9 A;  2H8U A;  1UG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...