1G6ZA

Solution structure of the clr4 chromo domain
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
b'ISSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRKRRLKGSNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLR4 PROTEIN
publication title Solution structure, domain features, and structural implications of mutants of the chromo domain from the fission yeast histone methyltransferase Clr4.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 7
structure length 70
sequence length 70
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2000-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g6zA00
4RA8A 1DOMA 5EPJA 1A15A 2N55A 3R93A 4MHEA 1HUNA 1F9RA 1EOTA 2X6LA 1E0BA 1NR2A 1NCVA 4X3UA 5JJZA 1SSOA 1DONA 1HUMA 1NR4A 4XDXA 2L11A 1VMPA 5T1GA 2FFKB 1NAPA 2B2VA 5D14A 4QUCA 2BDNA 1ML0D 1PFNA 2FJ2A 2B2YA 2HCIA 2FHTA 2MP1A 1MI2A 2KEEA 4HCSA 1XYIA 2K01A 4IURA 4ZKCB 2EOTA 4O42A 2RVLA 1F9SA 1ICWA 1QNKA 2NWGA 2HCCA 1GUWA 5EPKA 1ESRA 3FDTA 3MWYW 2K04A 4IUQA 2KUMA 2B2UA 2B2VC 1MSGA 1WTWA 1EL0A 1X3QA 2DY8A 2K03A 5EKIA 2B2WA 1O7ZA 4R8IA 1B53A 4HEDA 3DEOA 1EIGA 2FMMA 4DN4M 4ZKBB 4CJ0B 2M2LA 1ILQA 3TZDA 1IL8A 4IUVA 1WTVA 3I90A 1HFGA 2N88A 2NYZD 4X3TA 4U68A 2B2UC 4ZAIA 2J7ZA 2JP1A 1X3PA 4IUUA 1IKMA 1Q3LA 4OIKA 1HFNA 2B2WC 3DM1A 1WTOA 1BF4A 1QE6A 1BO0A 1BNZA 1DOKA 1CM9A 1QG7A 2RSNA 1F2LA 2B2TA 2IL8A 3G7LA 1JE4A 2NZ1D 1O80A 2Q8TA 1RHPA 1U4PA 3H91A 5EJWA 5CMDA 1HRJA 1MGSA 2KEDA 1F9QA 2CVRA 1G2SA 1XX8A 3ONAB 3F2UA 1RJTA 1RTNA 1VMCA 2X6GA 1B2TA 4MN3A 1RODA 1SDFA 2B2TC 3IL8A 5AFWA 2MJ8A 5T1IA 1O7YA 3TN2A 2HUGA 1ILPA 5COYA 2K28A 3QO2A 3I8ZA 1WD1A 2KOLA 2D9UA 2MGSA 1U4LA 4RAUC 1WTRA 1J8IA 1G91A 4OIJA 2RA4A 4NW2A 4QUFA 1B3AA 3MTSA 5DNFA 1WD0A 1PFMA 1PFBA 1EIHA 2VXWA 2EPBA 4ZK9B 4LMQD 1HHVA 2FINB 5EPLA 3UI2A 2HDMA 2RSOA 3GV3A 5E4XA 1WVLA 4X3SA 2H1EA 4IUPA 2XIWA 5CBAE 1C8CA 1F9PA 2MPMA 2X69A 2L1BA 3LWEA 2L4NA 3P7JA 1DZ1A 2EE1A 1LV9A 2L9HA 5EQ0A 1PLFA 1TVXA 2K1BA 1B50A 1JICA 1BBXC 4X3KA 1G2TA 4UAIA 1WTXA 1WTPA 1AP0A 4HSVA 4IUTA 5CBEE 4R9WA 1M8AA 4CJ2C 1G6ZA 5D65A 1KNEA 2L12A 1MSHA 2Q8RE 5CORA 1B4OA 4XT1B 2DY7A 2SDFA 1U4RA 2KVMA 1EQTA 2KECA 3KBXA 2JYOA 3IFDA 3N52A 4ZLTF 3Q6SA 3SVMA 4CJ1B 1AZQA 1ZXTA 1S4ZA 1CA6A 3I3CA 4XT3B 3KUPA 1U4MA 4RWSC 3GV6A 1X32A 3FPUB 1SAPA 2K05A 1KNAA 5E4WC 3I91A 2HDLA 3DEPA 1WTQA 1RTOA 2B2YC 2R3ZA 3HP3A 1IKLA 1J9OA 1AZPA 3D6WA 1HA6A 4HAEA 1CA5A 1DOLA 1PDQA
chains in the Genus database with same CATH superfamily
1DOMA 4BXXG 1F2ZA 4P2CB 1Z7TA 2IPKD 4JI1L 3ICEA 2X6LA 5FLMH 3SR1A 4EQPA 4JI3Q 3M4OH 2IWHA 3GTKB 4LF8L 4B3MQ 4Q0FA 1PYSB 1SJHD 2OWOA 2JJQA 3HOZH 2BA1A 1EY5A 5D14A 2LY7A 2MP1A 1C48A 4A3FG 4DUZL 4RCNA 1L1OC 1F9SA 1LLRD 1ICWA 2HCCA 1LT6D 4XTCS 1EL0A 1CQVA 1EU3A 3G6EA 2YU9B 1Y8OB 5IGEA 1GUOA 1EUJA 1NUCA 4A3KH 4V0BA 2NYZD 4ZAIA 3HGBA 1L1OB 2AQ3B 5IY0A 1KIXA 4G4KA 3CXCA 3HRZC 3ERQA 3K5LA 1DOKA 4OWTB 1UWVA 3G7LA 1Y1WB 3M7NA 3L9AX 4ME5A 3MAQA 4DV2L 1VF7A 3CPWA 4X66L 4XXEA 2MFIA 5IYCG 1JCKB 1HNXQ 1VDZA 1PH7A 2PQAA 3GTOB 1KLUD 2Z9HA 2J4XA 3K5OA 3I2ZA 1BBUA 5TSSA 1WTRA 4C3IH 3SGIA 1LT5D 2JEBI 4B08A 1PFMA 1VQ9A 2JA7B 5D3IB 4A76A 3ZYYX 1I3QB 4H0LC 1PRTC 2FINB 3ULLA 1STYA 3GV3A 2H1EA 3QJYA 4KY7A 5KNBA 1WJJA 1LV9A 1EY8A 3VYSA 4FVMA 1C0AA 1T9HA 3VR3A 1BBXC 1WTXA 5C4JB 2ICIA 4HMJA 1PRTB 1VQFA 3CCQA 3H15A 2JA6G 1GUTA 1BXTA 2PZUA 2SDFA 1N34Q 3D3RA 5LMNL 5ELDA 2HHHQ 5CV7A 5K5PA 1Y14B 2JA6H 1TWHB 3NXWA 4J15A 3FPUB 5EAYA 5LL6S 4JBKA 2D2CC 2R3ZA 1MIUA 5LMNW 4CDFC 4A3MH 3EROA 4KHVA 1PH1A 5C4HA 1LTAD 1YVCA 3HKZG 4F8MA 4X65L 4G7HC 1SLJA 5A2QE 4ABNA 4HN7A 4K5WA 3S1QH 1CT1D 1HTLD 4IPDA 1B3QA 4A3JH 2FJ2A 2MQHA 2B2YA 4HJAA 3T56B 2RVLA 2R93G 4RH6A 1KC8C 4TRDA 4LFAQ 3F2DA 2PQEA 5DEHA 4DR2Q 4MTNA 3DEOA 5C4XB 2DGYA 2MUYA 3I90A 4UDUC 1X3PA 2A8VA 2AQ1B 2B63H 1KRTA 1BNZA 2YV5A 2R7FA 2QDBA 3HKSA 2NVYB 2JEAI 1SMXA 4R4IA 4JCVE 2F52A 4DV5Q 5FLXL 3Q24A 4WJWA 4AIMA 3T1YQ 1D5MC 4NXML 3KDFA 4DNTB 1S72A 1I50H 3S17H 4GKJQ 4DV6Q 3BYYB 5GADC 1DM0B 3EJIA 1X56A 1V1PB 3S14H 2RKSA 2OXPA 3SK8A 2PMZB 4A3KB 3S9WA 4KN4C 1OO9B 2Z4IA 3K8AA 5CV4A 2EJGC 2IX1A 4OX9L 1FD7D 3D0FA 3OMCA 5C0XG 3F2BA 1WTPA 1JQYD 3I4NG 5BR8Q 4OO1I 3NBIA 3R2IA 1KD1C 2O5JC 4F87A 1FNWA 4IO9A 3PUVA 3VYRA 3FEWX 2KECA 1YHBA 2K5WA 3Q6SA 1AZQA 4KKUA 5IWAQ 1S4ZA 2JE6I 1CA6A 2ZJPA 1D5XC 3GV6A 3AEVA 5EBCA 4C3IB 3DEPA 2F0JA 1NSNS 4AQYQ 1BOSA 1Q90A 4DU9A 4BBSG 3EIVA 3RNUA 3FHWA 5JPNC 2Z6KC 5ELEA 1TWAB 1SNQA 2L11A 3CMAA 3HOYG 3F8TA 1HNWQ 2FHTA 4IJHA 1LTID 3OWFA 1STNA 1PXUA 4ZKCB 4O42A 4UP9A 1EYAA 3NEMA 2P5ZX 3M85A 3E9IA 1WFQA 3MXNA 2Q2IA 3A74A 3KOJA 5ISRA 1FJGL 4B3RQ 2F0KA 3SXHA 4DK6C 4K8IA 3DXJC 1CHQD 1W6JA 1ET6A 3S2DH 4QMGA 2JA6B 2EXDA 2B2WC 4JOIA 4A3MB 5I6WA 1JR0D 1E1OA 2F0DA 4A3IH 2NZ1D 3CKIB 4RKBA 2UU9Q 1QB5D 1RJTA 4DR3Q 2NN6H 4BBRH 1YHQA 1SDFA 3M4PA 3IL8A 4KTAA 4LF9L 5T1IA 1EQQA 3S1QB 4JYAL 3AU7A 4A3JB 3QO2A 1AE2A 2A68C 2O5IC 2RBMA 1EEID 1VQEA 2NVQH 3WWVA 2M00A 3MTSA 2ZM6L 1QZGA 1BDOA 5JVG3 4CKBA 3W5OA 2EXZA 3W1BA 4DR5Q 2K4KA 5EPLA 4DR7Q 1K8AC 3LGJA 3CCSA 2VQFQ 2HQEA 2XIWA 1AE3A 3DM3A 4NXNL 4KLKA 2F0FA 3J7YW 5EQ0A 4QGUA 1I5FA 2JA8G 2M9VA 1NY4A 2B63B 3GTLH 2UUAL 1H9JA 3URYA 2AWNA 2IY5B 4A3EG 1L2FA 3PUXA 4CJ2C 1E1TA 3VR6A 1G6ZA 1MSHA 3P75A 4LJZC 5IGGA 3KBXA 4DV7Q 2Z6BA 3N52A 4MTKA 5DM73 4X62Q 2LFNA 2NN6I 3HKZE 4XT3B 3U58A 5JOBA 3Q0AA 3U4ZA 1B7YB 1CUKA 1K3RA 5A35A 2QF7A 3A8IE 2ASBA 3S17B 4JI4L 1K8OA 1Y1VG 1H9SA 1HQRD 1LYLA 1STGA 1I94L 1CKNB 1ZEQX 3KFUA 1NTGA 2VUMH 4HIDA 2B2VA 4DUYQ 4JG2A 2D0PA 4QIWE 3I4MH 1CKOA 2WIIB 1JE5A 3VA7A 2B2UA 2XSCA 1MSGA 2XWBB 2JSOA 1VQ6A 2KCNA 2PZTA 2KCMA 3MXGA 3G4SA 4R8IA 4JI0L 5IP9H 1HZAA 1YNXA 3J81L 4PMBA 1EZ6A 3I55A 3MEHA 3TZDA 5HURA 3CD6A 1SYGA 1T5XD 3J7ZC 4X64Q 1WTOA 3ULPA 4KY6A 1V1QA 3WDNA 2LSSA 1H9RA 2V4DA 1E3PA 1SYFA 5EJWA 4L63B 2JA5H 1E22A 4R4OA 5D3DA 1EIYB 3NSWA 4A3BG 2K5NA 1JWSD 1A3VA 2ALYB 2K5HA 1B2TA 4MN3A 2F4VL 2MJ8A 3CRLC 1SNCA 3OYYA 5COYA 2F0NA 2EJFC 3UE0A 1KDBA 3ITPA 4A3GH 3A54A 3HOXH 1XMQQ 4YWMA 2E74C 3SK5A 4DV1Q 3WOEA 4A3BH 2E5LL 3C3LA 4RGMA 2YTYA 1B3AA 1X3EA 5IODA 1GUSA 2A68D 1EIHA 1D2BA 3GP7A 4LMQD 1BCPC 1B9NA 5ELNA 1TU2B 2JN4A 2E2IH 3I73A 1ENAA 3L3OC 2YYZA 1EY7A 2MPMA 1Y8NB 3UE1A 2L4NA 4A3DH 1FVIA 3S2DB 4LUOA 2VB2X 2EY1A 4K0KQ 3X3MA 2R7DA 3VYTA 3HEJA 1G2TA 1SROA 4P72A 1PH6A 1BCPB 5I4DA 4HSVA 4DV3L 1S5FD 4TVAB 5CBEE 4A3IB 2Y0SE 1QJOA 1XTDA 4DKAC 2ZJRA 2OT2A 4C2MH 3BG3A 4XT1B 1SYEA 1EWIA 4GN4B 1Q7YC 3A55A 4BBRB 2Q2UA 1A63A 5G3LD 5IP7G 1E24A 5EKLA 1PTOH 1QCBD 3GTKH 4HJ8A 3JAMc 2NVQB 1Q8KA 1HA5A 3D6WA 1QOHA 1PHJA 4L5RC 2UUBL 3I56A 3R93A 1XWEA 4XIGS 4KKTA 3FKIH 3LX0A 4V190 3HS0C 3K7UC 2N78A 1XNRQ 1SYDA 4HIKA 4K6LA 3G71A 1GHJA 4ZKBB 1PZID 4MIUA 4ODGA 3GTLB 1NBWA 3CCMA 2K7VA 1JJCB 4G7ZC 4QF4A 4FXKC 2VNUD 3FMCA 3ER0A 4B3SQ 4JI8Q 2DY8A 2K03A 5NUCA 3A8KE 4C3JG 2JA8B 5FO9B 1ENCA 1VQ7A 1X55A 1TT2A 4C1NI 3B6YA 1HFNA 3QOJA 1BF4A 2VQEL 1LM0A 4G57A 1CM9A 4JI3L 4I65A 1EY9A 4DK3C 5LL6X 4B3ML 4FXDA 1MGSA 3CP0A 1F9QA 1S40A 3F1ZA 1RTNA 1ZKOA 4K2LA 1KAAA 3TN2A 2K5QA 4BY7G 4JI2Q 1TIID 4WJ4A 1WD1A 4DNIA 1O78A 3I4MB 3EVQA 3MFYA 2E2HH 2RA4A 1WYDA 1CSQA 3MVVA 3J80E 5IT9L 1STBA 1VQGA 3JAME 3MFGA 1RDPD 3I72A 5H1SE 5C4JH 1HHVA 1X3GA 4NP5A 4LF7Q 5IGFA 1KDAA 5M3MG 1UUPA 3TP8A 5LMUQ 2X69A 3M7GA 1P8LA 4LUZA 1SNDA 5GROA 2AQ2B 2B8GA 1BCPD 2VS1A 3CHBD 1JICA 3IKJA 5HGTA 1JMCA 5M5XH 4YCWA 3NK9A 5CV9A 1GUNA 2KHSA 4QL5A 4A93G 2JA5B 4B9XA 1TY2A 1PH9A 2DY7A 3RN2A 3VR4A 1HCZA 1XPOA 2JYOA 1KL9A 1SE8A 4LF5Q 4RFBA 2YTVA 1VQOA 2SEBD 4A3GB 2I07B 3JC66 1B9MA 1EZ8A 3EQLC 3HOXB 4A3BB 1E2ZA 4P73A 4MHEA 2WINB 4GLVB 3G48A 3OIQA 4X3UA 1LTRD 2BE5C 2NBFA 4YY3L 3ND8A 1JJGA 2XRQD 4RCOA 4A3DB 4NPSA 4GLAC 1S3OA 1TXYA 4QJFA 2KEEA 4R4CA 1YITA 2Q2HA 2PO4A 4IURA 1Q81C 1DJRD 4LF4L 1GHKA 4ZQ3A 1QNKA 2F0SA 1PTOC 2R6GA 4YIJA 5J22A 2UXCQ 3MWYW 4LWCA 3QOLA 1X3QA 3PUZA 1SBBB 4C2MB 3V2TA 4JBWA 4KV6A 1EIGA 2FMMA 1HXYD 2F0PA 4ME3A 2M2LA 2NVYH 4L8JA 1PTOB 2F1MA 3I70A 4OIKA 3H0GH 1FL0A 1YNNC 1IHZA 2F0OA 2RSNA 4F7XA 4BXXH 1CK1A 5EKKA 4K14A 5CMDA 2F0HA 4ULLA 1IBMQ 5M5YH 4CHTB 2EYJA 1HZCA 1Q8IA 2AMCB 5C6AA 3FKIB 5E7NA 3OIPA 5AFWA 1YJWA 5ELFA 4A3FH 2BDOA 3A0JA 1PYWD 2KOLA 3NQIA 3HOWG 1BVSA 4RGTA 4LFAL 4MNOA 4S3SA 3R8BA 2QEXA 1W6KA 4DR2L 3C1FA 3BZCA 5DNFA 1PFBA 4A3CG 1J5EQ 1PA6A 2EPBA 1ASYA 5ELBA 1H9KA 1XJVA 1SEBD 3Q8DA 4O2DA 2EYLA 2R61A 2DUDA 4A3LG 4DV0Q 3SDZA 2SNSA 2Q8RE 2D5DA 1H95A 5IYCH 2A6HC 2H4OA 3D8GA 5JVH3 1VQDA 2MHVA 1Y69U 4XQJA 4NDXA 1AFPA 1RL2A 1M1KC 4AYBG 2J0TD 3AYHB 3PQIA 1TWAH 4GKJL 2ES2A 2E2HB 2Z6KA 4DV6L 1J9OA 1N32L 3NQTA 1M4VA 4XQQA 2IT1A 5EPJA 2PW5A 1TS4A 3IFTA 1SYBA 1HUNA 4R8NA 1BR9A 1ASZA 3MC0B 1E0BA 1GOZA 2CKZB 1TKWB 2QA4A 4FF4A 1S5DD 1NAPA 4HCSA 5BR8L 2BE5D 5M5XB 4KN7C 2OEOA 1JB7A 4JV5L 2F0QA 4ID6A 4J1MA 2XRSD 4JK1C 1IL2A 1WTWA 4DGZA 3J7AF 1LUZA 1IBLQ 4NKLA 2B2WA 1O7ZA 4FDBA 4HEDA 5KYLA 3GTMH 1T5EA 1PTOD 2F0MA 4Q5VA 1WTVA 4X3TA 2OQ0A 2Z4HA 3PCOB 4B3TQ 4PQXA 3GTQH 1SR3A 2F3WA 4LW1A 4XYOA 4BA1I 1XNQQ 2Q8TA 1RHPA 2CWPA 1A3UA 4JI1Q 4IZ8A 5FO7B 1YNND 1EY0A 4IPCA 1SJED 1A8VA 2OCEA 5FLXc 5K36G 4C3HG 1YHAA 5C4ZA 1SE3A 3TP7A 1VQAA 1EWCA 4DFAA 2R93H 1PZJD 2L55A 5FKAC 3VYUA 5G3LF 4GNXC 3KLRA 3I4OA 3K5NA 2RQXA 3GQBA 1IYJB 1VQLA 3QIAA 3A5UA 1HZBA 4KY5A 4G7OC 2EE1A 5GQOA 1FYCA 3H0GB 4GNXB 1QUQB 1EU4A 1XTCD 4UAIA 4PMWA 5BN4A 1CKNA 1VQBA 2MO0A 1CHPD 2O2LD 3CC7A 4DV2Q 1KNEA 4IOAA 5M5YB 4X66Q 3BYTB 1B4OA 3T13A 3TEHB 4JI5Q 2KVMA 4ZLTF 2JQOA 1GD7A 2Z0SA 3I3CA 4A3FB 1R9TH 3C1EA 5C5LA 5IYBG 2K5VA 1JB3A 2WB1E 1I4PA 2A6HD 4CDDC 4DR6L 4IN3A 2HDLA 4EGVA 2LXJA 3E9HA 1CA5A 1OXVA 4LFBQ 2GVAA 3VDYA 2R92G 1ZYRC 3MZ5A 1VQ4A 1CZWA 4PMCA 1DONA 1NMFA 2DJGC 2L0CA 5C0XH 3SHLA 3PMFA 3NTHA 1VCIA 4CGYB 5FLXE 4M8AA 1XYIA 3KLSX 3I4NH 3A8JE 1I6VC 4PNYA 4IPHA 4IUQA 4DV7L 2Y0SG 1KHIA 3HOUG 2RF4A 4UPAA 5CV5A 1CI3M 4X62L 1Z47A 5M3FG 3NTIA 3CQZH 2N88A 5HGQA 4N9PA 4O0AA 1HH2P 3DM1A 3HG9A 4JBMA 1D1KA 3T53B 3PUWA 2F3IA 4BBSH 1BCPF 4BY1G 4YCVA 4DR1Q 4U673 1QZHA 4KI0A 2AUJD 4K6DA 4X65Q 3TREA 5KIXA 4DUYL 3H94A 3J81i 2HUGA 3HOYH 4N8X1 1S5BD 1A6XA 2RDHA 5C0XI 2DJFC 1A2TA 1J8IA 1G91A 2XN9C 4I7ZC 3QR8A 4OXPA 1I4QA 5JJIA 1U0LA 1V43A 1EY4A 4KHPL 1IYVA 3GTMB 1KQSA 1N33L 5ELCA 4IUPA 3W2DA 4L5SA 4IUNA 4PG3A 4X64L 1E2WA 3RZOH 2IJ0A 2NUCA 1PLFA 4B9WA 1JT8A 3GTQB 1LTSD 1PH4A 3KLSA 4PZ6A 2KHIA 2RHQB 1JWUD 4GOPC 2BH8A 4A4IA 4FNFA 2GA4B 3HFZB 4AYBE 4IUTA 1IBKL 1IW7C 2JK8A 4K2KA 1VQ8A 3RR5A 3HKZB 5AJ3Q 1JORA 3QG1A 2QILA 1BKBA 3V96A 1XMQL 3CCLA 4GOPB 1X32A 5JPMC 2R93B 4JBJA 3TP6A 4LK1C 1YJNA 1RTOA 2B2YC 2L15A 3D4RA 1HA6A 3M4QA 2KJXA 1PDQA 4RA8A 3V05A 4CBVA 1SN8A 2K75A 2N55A 3ND9A 4LF6L 2PNHA 3NBHB 5JJZA 4QIWB 5C3EG 1VMPA 5I2YA 4MZ9A 4FYDA 4OX9Q 2JA8H 2CH4A 1ZYRD 3OTOQ 4FO2A 4KKSA 4A3EH 2EOTA 2A1AA 3ULJA 1PYBA 5IYDG 1G51A 1EWHA 4GS3A 4KD3A 3ZJYC 1KDCA 3NPPA 5EKIA 4LFCQ 4JI6L 1B53A 1EYCA 3H09A 4EVOA 1SFOH 4E6IA 3PO2G 4APVA 2J7ZA 1R9TB 3PO3G 1XMOL 4OGQC 1H9MA 5GAHC 1KAWA 3P1HA 1MJCA 1MKHA 1F2LA 1GVPA 1Y1VH 1R4QB 2I5HA 5IGBA 1JE4A 3M3YH 4NB3A 1XNRL 2ZJQA 3D6CA 4YWLA 1WCMG 2X6GA 1I4XA 1RODA 3E6ZX 2AHOB 2G9HD 4QB4A 4C1NK 3DWAA 4HJ7A 5IE8A 1YZ6A 2EYFA 3BVZA 4IFDG 1G8ZD 2WAQE 3I4NB 5J39A 3RN5A 3RMHA 1TWCH 4QCLA 3BU2A 4IALA 2UXBL 1CQFA 1FJGQ 3UI2A 1N36Q 4DAYB 2BCOA 3S2HH 1UAPA 3CQZB 5HY6A 5F2DA 3GDEA 2EQSA 1VQNA 2Y0SB 1X65A 2MNAA 5FJ8G 3K6OA 3EA6A 1AW7A 4K8JA 1X54A 4BBSB 1K0RA 1M8AA 1U9RA 2PZWA 1WTHA 5CORA 3BDOA 4ZCKA 4JC0A 4O1NA 1IW7D 1E7ZA 4DA2A 3HOYB 2KCTA 3P20A 3NUCA 3KUPA 4KJOA 4RWSC 1WTQA 1PTOF 3NTKA 4HAEA 2ZM6Q 4LF7L 3VA5A 1VS0A 3GO5A 4K5VA 1II3A 5LMUL 2CWAA 2F0WA 5E3FA 1AEXA 3DUZA 2F0LA 3N6RA 4OEMB 2NZOA 3RZOB 5T1GA 4FXGC 4NMZA 3H3VH 1K8MA 2D62A 3H6MA 4RHRA 1K73C 3NELA 3KBGA 2LS01 2NWGA 1GUWA 5EPKA 3K5MA 3E0EA 3LNNA 3KYHC 3CRKC 3KLWA 4DV4L 3CC2A 2QGQA 1UE7A 4CJ0B 5IP7H 2PNRC 4U68A 2IHEA 4LNQA 2PPBC 1UNSA 4JPBW 1DD2A 3K0YA 1IKMA 1L1OA 2QCPX 1PH5A 3CW2C 3OW2A 2N49A 1L0WA 1V9PA 2OF1A 1U4PA 4C56C 1I94Q 5C3WA 1UEAB 2CVRA 1G2SA 1X6OA 2EVBA 2KA7A 3ONAB 4XYQA 3KJOA 3DWQA 4YHHL 1G291 4JI7Q 1D5ZC 4DR4Q 3H3VI 2UXCL 1U4LA 4A3EB 3BDLA 2NVTH 2EYHA 5IT9c 3KF6B 4QUFA 5C3EB 4C3JH 1Y1WG 3S1RH 1KTKA 2KQ3A 3PIP3 3TS0A 1C8CA 1SFOB 1F2YA 3J80L 1TVXA 2RCFA 1PH3A 1B50A 2HIXA 1AN8A 4UP8A 3NE5B 1Y1VB 3T51B 4FF3A 1OXUA 3M3YB 2L12A 1EOVA 2PCFB 3PO3B 5E1FA 2JA7G 3TBIB 1U4RA 3NHHA 1TQOA 2F4VQ 1BUVT 4BY7H 3SEBA 1UE6A 2ID0A 3L7ZC 2DNEA 2AUKA 1XXGA 5EGTA 2XNAC 3A7AB 3I91A 1WCMB 1SE2A 2E5LQ 2OTLA 1H9SB 1TWCB 1STEA 2E75C 4DXGA 4POGA 4P75A 1K28A 5LHY1 2Z1CA 5M3MH 3M4YA 2R7ZG 5C44G 3S2HB 1HUMA 1HNXL 2WFWA 1Q46A 3SE0A 3NP8A 3TDQA 4DV0L 3J81j 1PFNA 2A73B 2K01A 5JEAG 3RD4A 4DK1A 1CFMA 5L37A 4DV3Q 2R7ZH 4A93H 1GJXA 2K04A 1VQKA 4HIOA 1B70B 2ZXOA 5IT9E 3A56A 5IOCA 2RHSB 4A75A 4DN4M 5JEAH 1HFGA 4P74A 2D0OA 3BZDB 4DPGA 1RIPA 4FF2A 2V1CC 3EBEA 1XPRA 1VQHA 4OHJA 2WB1G 5I9OA 5C0XJ 3T1HQ 3H3VC 1PH2A 3CAMA 5GAEC 3EFXD 2AKWB 1LTBD 4CKCA 3C2PA 4KMUC 3TSSA 3OHXC 3S16H 2GN5A 3OOCA 3C46A 2B2TC 5CGKA 1N34L 1L0XB 3DHQA 4GNXA 3J7A5 2SNMA 2HHHL 4EQNA 1K9MC 1IXRA 1M90C 1TR5A 2CFMA 1GXDC 4X6AH 1UEBA 1EFWA 2ATWA 1Z6HA 3Q23A 1IZ6A 2HIVA 2RDGA 4BWGB 1WVLA 5FLMG 4B3TL 3PIO3 4IQZA 1V1PA 1Q82C 3KF8B 3VR5A 3S15H 2L5TA 1FGUA 3HOZG 1HPCA 4PV1C 4ZUIA 3S1MH 3L0OA 3CCUA 2VQEQ 1TWGH 1XNQL 1BQQT 4QQBX 2E2DC 2UXDQ 1BBWA 2F0GA 3ERSX 3KK7A 4J8QA 3IRBA 5J1ZA 5KGUA 3BJUA 2F0EA 4YCUA 2ZTEA 2C9OA 3O13A 3QWNA 1FNUA 5DLQE 2ZTCA 4A3KG 3PF5A 3HOWH 4WJ3M 3K80C 4ZYSA 1KNAA 1C4QA 2KBNA 3T4AC 2NVTB 3HP3A 1V1OA 2LKVA 4A3CH 1QVGA 4UHVA 2I0QA 1EYDA 4L5QA 4C3JB 2OQKA 3S1RB 1F9RA 1EOTA 2CW0C 4H7BA 1GUGA 4POFA 1LO5D 4JVZA 4DV5L 2AWOA 3SK4A 1ML0D 1MI2A 2H5XA 3RUZA 4A3LH 2WV6D 3R2TA 3T1YL 1NMGA 4M1UB 1HR0Q 4C3IG 4JI5L 3K0XA 3WOFA 1C7YA 2UUCQ 1HJPA 3LWUA 3J7AV 1CTMA 1TS5A 3F2CA 1IL8A 4HJ5A 4BY7B 1GO3E 3PGZA 2EYPA 4IUUA 3MHBA 1K83H 4WFN3 4IOCA 3PF4A 4LFBL 2IL8A 5CR3A 2PI2A 1F77A 2OTJA 4AH6A 2KEDA 5M3MB 3BVGA 5A2QL 4YY3Q 1HNZQ 2IW3A 1Q12A 5M9OA 1O7YA 2F0UA 1RKNA 2K28A 5IWAL 5ELOA 3M9BA 2B29A 2D9UA 4RGNA 4LF4Q 5BN3A 2NZHA 2R7ZB 5C44B 4AQYL 2LXKA 2EJMA 4A93B 5KEEA 4Z9CB 4A3MG 4WRDA 3CCVA 1STAA 1NNXA 4GKKQ 1YIJA 4GOPA 5I6YA 5DM63 3U4VA 5JAVA 3OSOA 1I6HH 2ENBA 1EYGA 4OWWB 3GTJH 4LF8Q 4A3JG 1O7LA 1HNWL 1JOOA 4DR1L 4PZ7A 1N8RC 5JJKA 3E0JA 3NBHA 4DUZQ 4R9WA 3CCEA 4I7AA 2EYMA 3NENA 1XPUA 1TY0A 3OWEB 2VB3X 2K33A 3S16B 2EZVA 5K36H 2N3SA 4C3HH 2WB1B 1JWMD 3KJPA 3GTPH 4B3RL 2CQOA 5M5WH 1RD9D 4IFDJ 1U4MA 4DAMA 2EDGA 1CZGA 4N8FA 4RMFA 1ENFA 3MXUA 2K05A 5CYUA 5E4WC 2B63G 2WAQG 3VR2A 2A5HA 4OO1G 3W3AA 3GTGH 3BDCA 2NVXH 2LMCB 2UU9L 2HT1A 3SK6A 4DR3L 4K5XA 3S15B 3AQQA 4HTHA 3UDXA 4OO1H 3S1MB 2GVBA 2CW0D 3HOVG 1LT3D 1TWGB 1I4HA 1A2UA 3STBC 3TRZA 4ZRZA 4R1JA 5AJ3L 3D4WA 3M4OB 2SOBA 5CV6A 3HOZB 3U50C 4DR5L 4OELB 3HOVH 4DR7L 1VQIA 2VQFL 4YWKA 1A0IA 2FXQA 1I4GA 3CC4A 3HOWB 5IYBH 4LUVA 1S5ED 3PV0A 1QVCA 1Q3LA 4LAAA 2A19A 1OXXK 1VQCA 1N32Q 2G5DA 1QG7A 2I5MX 4ILWA 2R92H 1JOKA 4DAYA 2RDFA 1XX8A 2I46A 1PRTD 3K58A 3OTOL 2WACA 1SNOA 2E76C 4CKEA 2CHBD 5LMNQ 3QB3A 2NTSA 2VZAA 1UE1A 4OIJA 4JV5Q 4LFCL 2QDLA 4IPGA 1WD0A 3HOUH 2ZXRA 3K81C 5M3FH 2VXWA 4RGOS 3DMUA 4KD4A 1F9PA 5I2XA 1OXSC 4AYBB 1CSPA 1K83B 3D31A 1HTPA 2PQAB 2PMZE 2WP8J 1O7IA 2KHJA 2K14A 1AP0A 5I9PA 4DF7A 3K57A 5KNDA 4HR7B 4BY1H 1DCZA 1KABA 1QILA 4EQ5A 1YI2A 4DAVA 1SMYC 5C3XA 1HQMC 1PZKD 2E2JH 2Q2TA 4GN5A 3U9OA 1PMRA 1EQRA 1VQPA 3CF5A 2F0IA 3S1NH 1K0SA 1Y8PB 3U9SA 1N36L 4R4TA 2XGTA 1A15A 4A3IG 1LTTD 1YNJC 1STHA 4XDXA 1I6HB 1DXMA 2NN6G 4BBRG 4DK0A 5JJLA 3GTJB 3S24A 3CCRA 3I7FA 4DV1L 1GM5A 2F0VA 1D8LA 3FDTA 2Q8IB 1MD2D 2A69C 3X3NA 3A5ZB 2F4IA 4NXMQ 4CDEC 3STBD 2EIFA 4C3HB 3AMUA 1ILQA 3GTPB 4IUVA 2C5CA 5M5WB 2JP1A 4DR6Q 2ZXPA 3FVQA 3KF6A 2NB0A 4K0KL 2EYOA 1Q86C 5KNCA 2MO1A 2RCNA 1G6PA 3AFQA 2XTIA 2K50A 3GTGB 2QW7A 5EBDA 1X9NA 1B1ZA 2NVXB 2PI2E 2VL6A 3F2UA 1VMCA 5C3EH 2WAQB 1TWFH 1FR3A 5IIFA 3J81c 2EY5A 5JEAJ 1ET9A 4EQOA 1A62A 2MGSA 5IYDH 2IHFA 3PSIA 3RZDH 1LT4D 4HIMA 4N9TA 2NTTA 2PYKA 3OPOA 1TS3A 3HOVB 1FGBD 2HDMA 5E4XA 2C35B 4X3SA 2QEJC 3RLFA 3PO2H 5FOBB 1MBYA 1V8QA 3GD7A 2VY3A 3P7JA 3PO3H 4KJNA 2L9HA 2VUMG 1EQVA 1I50B 1D1IA 2YTXA 4TKOB 3FRPB 2K6AA 4OWXB 3I4MG 3S14B 4GZYC 4PZ8A 2R92B 4OONA 4B3SL 3KDFB 5D65A 1WCMH 4JI8L 4HCEA 4L5TA 4FP5D 5IP9G 4JI7L 4DR4L 3SVMA 2I5LX 3RLNA 5KYIA 1D7QA 1IYUA 2N8NA 4IFDH 1SMYD 3J80i 3PUYA 5C5MA 3JAMi 2VW9A 1SE4A 3PIPA 1JJ2A 3TQYA 3HOUB 4TQUS 5M3FB 5FK9C 1W2BA 3DWPA 4KHPQ 4F88A 3CCJA 3TP5A 1OXTA 2JA5G 2K5DA 1N33Q 1NCVA 4J6HA 1NR4A 2XWJB 1PH8A 1VQJA 1MJEA 2FFKB 3OMGA 4JI2L 1MHWC 4QUCA 1YNJD 2BDNA 4LF9Q 4L6TB 5FJ8H 5GAGC 2HCIA 4A3GG 1ONLA 4JYAQ 3J81E 4H13C 3HOXG 2F03A 3RLOA 1I4RA 1IBKQ 4BY1B 2KUMA 2O4XA 2XVSA 3HZXA 2EY6A 4HMIA 3UDFA 4KHZA 4RKLA 3L2PA 5FO8B 2E2JB 1E2VA 2A69D 4FF1A 5J3BA 4A3DG 1S5CD 2G9DA 1DYQA 4ZUJA 4HSPA 3OW7A 4H02A 4NXNQ 3AFPA 4IFDI 3S1NB 2B2TA 4IJLA 1C9OA 1O80A 2Z8LA 2UUAQ 4LF6Q 1TS2A 5IGCA 4JOIC 3KF8A 2HQLA 2EY2A 4ALPA 1PVOA 3MXNB 1KRSA 1QWYA 4DAPA 1ILPA 5IGDA 4Y7NH 4LF5L 3I8ZA 4P71A 2DN8A 2KCCA 1QNUA 3EN2A 3K7AH 1VQMA 1X3FA 5KRUA 1KXLA 4H44C 3T16A 1EY6A 2IX0A 1CKMA 1NJIC 2KENA 1N9WA 4ZK9B 4JI6Q 2B8FA 4WORA 1EEFD 1B8AA 4XQNA 4JI4Q 2B39A 1JOQA 3FKIG 5CBAE 2JA9A 1VF5C 3J80c 1YBYA 2L1BA 4DXFA 1DZ1A 4GLXA 3T1HL 2A6EC 1F2MA 1XMOQ 4UY8C 2K1BA 1K8GA 4X3KA 1L0YB 1Q1BA 3E3XA 1LACA 2YU9H 5CV8A 4TSSA 2K52A 1EQTA 3IFDA 3CMEA 3E5SA 3BVMA 4EX5A 1PFSA 1TWFB 1ZXTA 4BS9A 1ESFA 1PV4A 2B3GA 4JI0Q 4JW0A 1RCVD 3IAYA 3PIOA 1SAPA 1DGSA 2TSSA 3DLLA 4Y52H 1IKLA 2A74C 1AZPA 2FMCA 3JAML 3MXPA 1W3SA 3RZDB 1DOLA 1SNPA 1Y1WH 3NWSA 1VQ5A 4QY7A 2UXBQ 1AH9A 1IBML 4DNRB 4CDCC 1NR2A 1R4PB 1WOCA 1SSOA 2DNCA 3UDIA 1P16A 3PO2B 1HZ9A 3GTOH 1D6EC 3MEFA 3K59A 3FP9A 1EFID 3TZUA 1PRTF 2UXDL 3TMEA 3D4DA 1EIFA 1ESRA 2B2VC 1QVFA 2JA7H 2VUMB 1J5EL 4KK7A 1I3QH 2TMPA 2QKIC 3TS2A 3G6JB 1LTGD 3NWTA 2F3VA 3MA2B 2B2UC 1B44D 1RF2D 1QE6A 5DAUA 1BO0A 1FNVA 1YJ9A 2BH2A 2CH4W 4OL7A 4UP7A 3CU7A 3R3OA 1JC7A 5BN5A 1WI5A 1SNMA 3H91A 1HRJA 5C44H 1GKHA 3FPPA 1U5KA 3BS1A 1HR0L 3UDGA 1TWHH 2BOSA 3I4LA 4RAUC 1NE3A 2JXMB 4NW2A 2UUCL 1LABA 1K3BC 1Q1EA 4DV4Q 1HR0W 2K32A 1UE5A 3CPFA 1OTCA 1SYCA 2RSOA 2CCZA 2UUBQ 1J6QA 2CQAA 3LWEA 2WKDA 2F0TA 4RG1A 2WKCA 1Z9FA 1YEZA 5C4XG 1QUQA 2BA0A 2ICEC 3W1GA 1KLGD 2E2IB 2HD3A 2A6ED 1ICFB 1HNZL 4GN3B 2ZT9C 4BA2I 2IX3A 1IBLL 5C4XH 1SXTA 4R4QA 4CJ1B 5CC4A 2ZTDA 4HJ9A 4YHHQ 4Y7NB 4RHSA 1SRUA 3Q22A 2PW7A 3BZKA 3H0GG 3K7AB 2E8GA 1LTLA 1A3TA 3A7LA 4GKKL 3AB9A
chains in the Genus database with same CATH topology
1DOMA 1F2ZA 4P2CB 1Z7TA 2IPKD 2X6LA 3SR1A 4EQPA 2IWHA 3GTKB 4Q0FA 1SJHD 2BA1A 1EY5A 5D14A 2LY7A 2MP1A 1C48A 4RCNA 1F9SA 1LLRD 1ICWA 2HCCA 1LT6D 4XTCS 1EL0A 1CQVA 1EU3A 2YU9B 1Y8OB 5IGEA 1GUOA 1NUCA 4V0BA 2NYZD 4ZAIA 3HGBA 2AQ3B 4G4KA 3HRZC 3ERQA 3K5LA 1DOKA 3G7LA 1Y1WB 3M7NA 3L9AX 4ME5A 3MAQA 1VF7A 4XXEA 1JCKB 1VDZA 3GTOB 1KLUD 2J4XA 3K5OA 5TSSA 1WTRA 1LT5D 2JEBI 4B08A 1PFMA 2JA7B 5D3IB 3ZYYX 1I3QB 4H0LC 1PRTC 2FINB 1STYA 3GV3A 2H1EA 3QJYA 4KY7A 5KNBA 1LV9A 1EY8A 3VYSA 4FVMA 3VR3A 1BBXC 1WTXA 5C4JB 2ICIA 4HMJA 1PRTB 1GUTA 1BXTA 2PZUA 2SDFA 3D3RA 5ELDA 5CV7A 5K5PA 1TWHB 3NXWA 3FPUB 5LL6S 2D2CC 2R3ZA 3EROA 4KHVA 5C4HA 1LTAD 4F8MA 4G7HC 5A2QE 4ABNA 4HN7A 4K5WA 1CT1D 1HTLD 2FJ2A 2B2YA 3T56B 2RVLA 4RH6A 4TRDA 2PQEA 5DEHA 3DEOA 5C4XB 2MUYA 3I90A 4UDUC 1X3PA 2AQ1B 1BNZA 2QDBA 2NVYB 2JEAI 5FLXL 3Q24A 4WJWA 1D5MC 4DNTB 3BYYB 1DM0B 3EJIA 1V1PB 2RKSA 2OXPA 3SK8A 2PMZB 4A3KB 3S9WA 4KN4C 1OO9B 2Z4IA 5CV4A 2EJGC 2IX1A 1FD7D 3OMCA 5C0XG 1WTPA 1JQYD 4OO1I 3NBIA 3R2IA 2O5JC 4F87A 1FNWA 3PUVA 3VYRA 3FEWX 2KECA 2K5WA 3Q6SA 1AZQA 4KKUA 1S4ZA 2JE6I 1CA6A 1D5XC 3GV6A 5EBCA 4C3IB 3DEPA 2F0JA 1NSNS 1BOSA 1Q90A 4DU9A 5JPNC 5ELEA 1TWAB 1SNQA 2L11A 2FHTA 1LTID 3OWFA 1STNA 1PXUA 4ZKCB 4O42A 1EYAA 3M85A 3MXNA 5ISRA 2F0KA 3SXHA 4K8IA 3DXJC 1CHQD 1W6JA 1ET6A 4QMGA 2JA6B 2B2WC 4A3MB 5I6WA 1JR0D 2F0DA 2NZ1D 3CKIB 4RKBA 1QB5D 1RJTA 2NN6H 1SDFA 3IL8A 4KTAA 5T1IA 3S1QB 3AU7A 4A3JB 3QO2A 2A68C 2O5IC 2RBMA 1EEID 2M00A 3MTSA 1BDOA 5JVG3 4CKBA 2EXZA 5EPLA 2HQEA 2XIWA 3J7YW 2F0FA 5EQ0A 2M9VA 2B63B 1H9JA 3URYA 2AWNA 3PUXA 4CJ2C 3VR6A 1G6ZA 1MSHA 3P75A 4LJZC 5IGGA 3KBXA 3N52A 5DM73 2LFNA 2NN6I 4XT3B 5JOBA 3Q0AA 5A35A 2QF7A 3A8IE 3S17B 1K8OA 1H9SA 1HQRD 1STGA 1ZEQX 2B2VA 2WIIB 3VA7A 2B2UA 2XSCA 1MSGA 2XWBB 2JSOA 2KCNA 2PZTA 3MXGA 4R8IA 3J81L 4PMBA 1EZ6A 3MEHA 3TZDA 5HURA 1SYGA 1T5XD 1WTOA 4KY6A 3WDNA 1H9RA 2V4DA 1SYFA 5EJWA 4L63B 5D3DA 3NSWA 1JWSD 1A3VA 1B2TA 4MN3A 2MJ8A 3CRLC 1SNCA 5COYA 2F0NA 2EJFC 1KDBA 3ITPA 3A54A 2E74C 3SK5A 3WOEA 3C3LA 4RGMA 1B3AA 5IODA 1GUSA 2A68D 1EIHA 1D2BA 3GP7A 4LMQD 1BCPC 1B9NA 1TU2B 3I73A 1ENAA 3L3OC 2YYZA 1EY7A 2MPMA 1Y8NB 2L4NA 3S2DB 2VB2X 2EY1A 3X3MA 3VYTA 3HEJA 1G2TA 1BCPB 5I4DA 4HSVA 1S5FD 5CBEE 4A3IB 1QJOA 2OT2A 3BG3A 4XT1B 1SYEA 3A55A 4BBRB 5G3LD 5EKLA 1PTOH 1QCBD 2NVQB 1HA5A 3D6WA 1QOHA 3R93A 1XWEA 4XIGS 4KKTA 3LX0A 4V190 3HS0C 1SYDA 4K6LA 1GHJA 4ZKBB 1PZID 4MIUA 4ODGA 3GTLB 2K7VA 4G7ZC 4QF4A 4FXKC 2VNUD 3FMCA 2DY8A 2K03A 5NUCA 3A8KE 4C3JG 2JA8B 5FO9B 1ENCA 1TT2A 4C1NI 1HFNA 3QOJA 1BF4A 4G57A 1CM9A 4I65A 1EY9A 5LL6X 4FXDA 1MGSA 1F9QA 1RTNA 1ZKOA 4K2LA 1KAAA 3TN2A 2K5QA 1TIID 1WD1A 1O78A 3I4MB 3EVQA 3MFYA 2RA4A 3MVVA 3J80E 5IT9L 1STBA 3JAME 3MFGA 1RDPD 3I72A 1HHVA 4NP5A 5IGFA 1KDAA 1UUPA 3TP8A 2X69A 3M7GA 1SNDA 2AQ2B 2B8GA 1BCPD 3CHBD 1JICA 3IKJA 5HGTA 3NK9A 5CV9A 1GUNA 2KHSA 2JA5B 4B9XA 1TY2A 2DY7A 3VR4A 1HCZA 2JYOA 4RFBA 2SEBD 4A3GB 2I07B 1B9MA 1EZ8A 3EQLC 3HOXB 4A3BB 1E2ZA 4MHEA 2WINB 3OIQA 4X3UA 1LTRD 2BE5C 2NBFA 3ND8A 2XRQD 4RCOA 4A3DB 2KEEA 1GHKA 2PO4A 4IURA 1DJRD 4ZQ3A 1QNKA 2F0SA 1PTOC 2R6GA 4YIJA 5J22A 3MWYW 3QOLA 1X3QA 3PUZA 1SBBB 4C2MB 3V2TA 4JBWA 4KV6A 1EIGA 2FMMA 1HXYD 2F0PA 2M2LA 4L8JA 1PTOB 2F1MA 3I70A 4OIKA 1YNNC 1IHZA 2F0OA 2RSNA 4F7XA 1CK1A 5EKKA 4K14A 5CMDA 2F0HA 4ULLA 4CHTB 2EYJA 1Q8IA 5C6AA 3FKIB 3OIPA 5AFWA 5ELFA 2BDOA 1PYWD 2KOLA 3NQIA 4RGTA 4S3SA 3R8BA 1W6KA 3C1FA 5DNFA 1PFBA 2EPBA 5ELBA 1H9KA 1SEBD 2EYLA 2R61A 3SDZA 2SNSA 2Q8RE 2D5DA 2A6HC 2H4OA 3D8GA 5JVH3 1Y69U 2MHVA 4XQJA 4NDXA 1AFPA 2J0TD 2E2HB 1J9OA 3NQTA 1M4VA 4XQQA 2IT1A 5EPJA 2PW5A 1TS4A 3IFTA 1SYBA 1HUNA 4R8NA 1BR9A 3MC0B 1E0BA 1GOZA 1TKWB 4FF4A 1S5DD 1NAPA 4HCSA 2BE5D 5M5XB 4KN7C 2OEOA 2F0QA 4ID6A 4J1MA 2XRSD 4JK1C 1WTWA 4DGZA 3J7AF 4NKLA 2B2WA 1O7ZA 4HEDA 5KYLA 1T5EA 1PTOD 2F0MA 4Q5VA 1WTVA 4X3TA 2Z4HA 4PQXA 2F3WA 4XYOA 4BA1I 2Q8TA 1RHPA 1A3UA 4IZ8A 5FO7B 1YNND 1EY0A 1SJED 5K36G 4C3HG 5C4ZA 1SE3A 3TP7A 1EWCA 4DFAA 1PZJD 2L55A 5FKAC 3VYUA 5G3LF 3KLRA 3K5NA 2RQXA 3GQBA 3QIAA 4KY5A 4G7OC 2EE1A 1FYCA 3H0GB 1EU4A 1XTCD 4UAIA 4PMWA 5BN4A 2O2LD 1CHPD 1KNEA 5M5YB 3BYTB 1B4OA 3T13A 2KVMA 4ZLTF 3I3CA 4A3FB 3C1EA 5C5LA 1JB3A 1I4PA 2A6HD 4IN3A 2HDLA 4EGVA 1CA5A 1OXVA 1ZYRC 3MZ5A 1CZWA 4PMCA 1DONA 2L0CA 5C0XH 3SHLA 3PMFA 3NTHA 1VCIA 4CGYB 5FLXE 4M8AA 1XYIA 3KLSX 3A8JE 1I6VC 4PNYA 4IUQA 5CV5A 1CI3M 1Z47A 3NTIA 2N88A 4N9PA 3DM1A 3HG9A 1D1KA 3T53B 3PUWA 1BCPF 4U673 4KI0A 2AUJD 4K6DA 5KIXA 3H94A 2HUGA 1S5BD 1A6XA 2RDHA 5C0XI 1A2TA 1J8IA 1G91A 2XN9C 4I7ZC 1I4QA 1V43A 1EY4A 1IYVA 3GTMB 5ELCA 4IUPA 3W2DA 4IUNA 1E2WA 2IJ0A 2NUCA 1PLFA 4B9WA 3GTQB 1LTSD 3KLSA 1JWUD 4FNFA 2GA4B 4IUTA 1IW7C 4K2KA 3HKZB 1JORA 3QG1A 2QILA 3V96A 1X32A 5JPMC 2R93B 3TP6A 4LK1C 1RTOA 2B2YC 3D4RA 1HA6A 2KJXA 1PDQA 4RA8A 3V05A 4CBVA 3ND9A 2N55A 5JJZA 4QIWB 1VMPA 5I2YA 4FYDA 1ZYRD 4FO2A 4KKSA 2EOTA 1EWHA 4KD3A 1KDCA 3NPPA 5EKIA 1B53A 1EYCA 3H09A 4EVOA 4E6IA 2J7ZA 1R9TB 4OGQC 1H9MA 3P1HA 5IGBA 1F2LA 1R4QB 1JE4A 3D6CA 2X6GA 1I4XA 1RODA 3E6ZX 2G9HD 4QB4A 4C1NK 3DWAA 2EYFA 3BVZA 4IFDG 1G8ZD 3I4NB 5J39A 3RMHA 4QCLA 4IALA 1CQFA 3UI2A 2BCOA 1UAPA 3CQZB 5F2DA 2Y0SB 3K6OA 3EA6A 1AW7A 4K8JA 4BBSB 1M8AA 1U9RA 2PZWA 5CORA 3BDOA 4O1NA 1IW7D 4DA2A 3HOYB 3P20A 3NUCA 3KUPA 4KJOA 4RWSC 1WTQA 1PTOF 3NTKA 4HAEA 3VA5A 3GO5A 4K5VA 1II3A 2F0WA 5E3FA 1AEXA 3DUZA 2F0LA 3N6RA 3RZOB 5T1GA 4FXGC 4NMZA 1K8MA 2D62A 3H6MA 4RHRA 3KBGA 2LS01 2NWGA 1GUWA 5EPKA 3K5MA 3LNNA 3CRKC 4CJ0B 2PNRC 4U68A 2PPBC 1UNSA 1DD2A 3K0YA 1IKMA 2QCPX 2OF1A 1U4PA 4C56C 5C3WA 1UEAB 2CVRA 1G2SA 2EVBA 2KA7A 4XYQA 3ONAB 3DWQA 1G291 1D5ZC 1U4LA 4A3EB 3BDLA 2EYHA 4QUFA 5C3EB 1KTKA 2KQ3A 3PIP3 1C8CA 1SFOB 1F2YA 3J80L 1TVXA 1B50A 1AN8A 3NE5B 1Y1VB 3T51B 4FF3A 1OXUA 3M3YB 2L12A 2PCFB 3PO3B 5E1FA 3TBIB 1U4RA 3NHHA 1TQOA 1BUVT 3SEBA 2ID0A 3L7ZC 2DNEA 2AUKA 1XXGA 5EGTA 2XNAC 3A7AB 3I91A 1WCMB 1SE2A 1H9SB 1TWCB 1STEA 2E75C 4DXGA 5LHY1 2Z1CA 3M4YA 3S2HB 1HUMA 3TDQA 3SE0A 3NP8A 1PFNA 2A73B 2K01A 5JEAG 3RD4A 4DK1A 1CFMA 1GJXA 2K04A 2ZXOA 5IT9E 3A56A 5IOCA 4DN4M 5JEAH 1HFGA 3BZDB 4FF2A 4OHJA 5I9OA 5C0XJ 3H3VC 3EFXD 1LTBD 4CKCA 3C2PA 4KMUC 3TSSA 3OHXC 3OOCA 3C46A 2B2TC 5CGKA 1L0XB 3DHQA 2SNMA 4EQNA 1TR5A 1GXDC 1Z6HA 3Q23A 2RDGA 4BWGB 1WVLA 3PIO3 4IQZA 1V1PA 3VR5A 2L5TA 1HPCA 4PV1C 4ZUIA 1BQQT 2E2DC 2F0GA 3KK7A 4J8QA 5J1ZA 5KGUA 2F0EA 2C9OA 3O13A 3QWNA 1FNUA 4ZYSA 1KNAA 1C4QA 3T4AC 2NVTB 3HP3A 1V1OA 2LKVA 1EYDA 4C3JB 3S1RB 1F9RA 1EOTA 2CW0C 4H7BA 1GUGA 1LO5D 2AWOA 3SK4A 1ML0D 1MI2A 3RUZA 2WV6D 3R2TA 4M1UB 4C3IG 3WOFA 3LWUA 3J7AV 1CTMA 1TS5A 4BY7B 1IL8A 2EYPA 4IUUA 3MHBA 4WFN3 2IL8A 5CR3A 1F77A 2KEDA 5M3MB 3BVGA 5A2QL 2IW3A 1Q12A 5M9OA 1O7YA 2F0UA 1RKNA 2K28A 2D9UA 4RGNA 5BN3A 2R7ZB 5C44B 4A93B 2EJMA 5KEEA 4Z9CB 4WRDA 1STAA 5I6YA 5DM63 5JAVA 3OSOA 2ENBA 1O7LA 1JOOA 3E0JA 3NBHA 4R9WA 2EYMA 1TY0A 3OWEB 2VB3X 2K33A 3S16B 2EZVA 5K36H 2WB1B 1JWMD 1RD9D 4IFDJ 1U4MA 2EDGA 1CZGA 5CYUA 1ENFA 3MXUA 2K05A 5E4WC 3VR2A 2A5HA 4OO1G 3W3AA 3BDCA 2LMCB 3SK6A 3S15B 4K5XA 4HTHA 4OO1H 3S1MB 2CW0D 1LT3D 1TWGB 1I4HA 1A2UA 4ZRZA 3D4WA 3M4OB 2SOBA 5CV6A 3HOZB 1I4GA 3HOWB 1S5ED 3PV0A 1Q3LA 4LAAA 1OXXK 1QG7A 4ILWA 1JOKA 4DAYA 2RDFA 1XX8A 2I46A 1PRTD 3K58A 2WACA 1SNOA 2E76C 4CKEA 2CHBD 3QB3A 2NTSA 4OIJA 1WD0A 2ZXRA 2VXWA 4RGOS 3DMUA 4KD4A 1F9PA 5I2XA 1OXSC 4AYBB 1K83B 3D31A 1HTPA 2WP8J 1AP0A 5I9PA 4DF7A 3K57A 5KNDA 4HR7B 1DCZA 1KABA 1QILA 4DAVA 1SMYC 5C3XA 1HQMC 1PZKD 3U9OA 1PMRA 2F0IA 1Y8PB 3U9SA 1A15A 1LTTD 1YNJC 1STHA 4XDXA 1I6HB 1DXMA 2NN6G 4DK0A 3GTJB 2F0VA 3FDTA 2Q8IB 1MD2D 2A69C 3X3NA 2F4IA 4C3HB 3AMUA 1ILQA 3GTPB 4IUVA 2C5CA 5M5WB 2JP1A 2ZXPA 3FVQA 2NB0A 2EYOA 5KNCA 3GTGB 5EBDA 1B1ZA 2NVXB 3F2UA 1VMCA 2WAQB 1FR3A 5IIFA 2EY5A 5JEAJ 1ET9A 4EQOA 2MGSA 1LT4D 4N9TA 2NTTA 2PYKA 3OPOA 1TS3A 3HOVB 1FGBD 2HDMA 5E4XA 4X3SA 2QEJC 3RLFA 5FOBB 1MBYA 1V8QA 3GD7A 3P7JA 4KJNA 2L9HA 1EQVA 1I50B 1D1IA 4TKOB 3FRPB 2K6AA 3S14B 4GZYC 2R92B 5D65A 4HCEA 4FP5D 3SVMA 5KYIA 1IYUA 4IFDH 1SMYD 3PUYA 5C5MA 1SE4A 3HOUB 4TQUS 5M3FB 5FK9C 3DWPA 4F88A 3TP5A 1OXTA 2K5DA 1NCVA 4J6HA 1NR4A 2XWJB 2FFKB 3OMGA 4QUCA 1YNJD 2BDNA 4L6TB 2HCIA 1ONLA 3J81E 4H13C 2F03A 1I4RA 4BY1B 2KUMA 2O4XA 2XVSA 3HZXA 2EY6A 4HMIA 4KHZA 4RKLA 5FO8B 2E2JB 1E2VA 2A69D 4FF1A 1S5CD 2G9DA 1DYQA 4ZUJA 4HSPA 3OW7A 4IFDI 3S1NB 2B2TA 1O80A 2Z8LA 1TS2A 5IGCA 3KF8A 2EY2A 1QWYA 4DAPA 1ILPA 5IGDA 3I8ZA 2DN8A 2KCCA 1QNUA 5KRUA 4H44C 3T16A 1EY6A 2IX0A 4ZK9B 2B8FA 4WORA 1EEFD 4XQNA 2B39A 1JOQA 5CBAE 1VF5C 4DXFA 2L1BA 1DZ1A 2A6EC 1F2MA 2K1BA 4X3KA 1L0YB 1Q1BA 1LACA 5CV8A 4TSSA 1EQTA 3IFDA 3E5SA 3BVMA 1TWFB 1ZXTA 4BS9A 1ESFA 1RCVD 3IAYA 1SAPA 2TSSA 1IKLA 2A74C 1AZPA 2FMCA 3JAML 3MXPA 3RZDB 1DOLA 1SNPA 3NWSA 4DNRB 1NR2A 1R4PB 2DNCA 1SSOA 3PO2B 1D6EC 3K59A 1EFID 3TZUA 1PRTF 3TMEA 3D4DA 1ESRA 2B2VC 2VUMB 4KK7A 2TMPA 2QKIC 3G6JB 1LTGD 3NWTA 2F3VA 3MA2B 2B2UC 1B44D 1RF2D 1QE6A 5DAUA 1BO0A 1FNVA 4OL7A 3CU7A 1JC7A 3R3OA 5BN5A 1SNMA 3H91A 1HRJA 3FPPA 3BS1A 2BOSA 3I4LA 4RAUC 2JXMB 4NW2A 1LABA 1Q1EA 2K32A 1SYCA 2RSOA 2CQAA 3LWEA 2WKDA 2F0TA 2WKCA 2BA0A 2ICEC 1KLGD 2E2IB 2A6ED 2ZT9C 4BA2I 2IX3A 1SXTA 4CJ1B 5CC4A 4Y7NB 4RHSA 3Q22A 2PW7A 3K7AB 1A3TA 3A7LA 3AB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RA8 A;  1DOM A;  5EPJ A;  1A15 A;  2N55 A;  3R93 A;  4MHE A;  1HUN A;  1F9R A;  1EOT A;  2X6L A;  1E0B A;  1NR2 A;  1NCV A;  4X3U A;  5JJZ A;  1SSO A;  1DON A;  1HUM A;  1NR4 A;  4XDX A;  2L11 A;  1VMP A;  5T1G A;  2FFK B;  1NAP A;  2B2V A;  5D14 A;  4QUC A;  2BDN A;  1ML0 D;  1PFN A;  2FJ2 A;  2B2Y A;  2HCI A;  2FHT A;  2MP1 A;  1MI2 A;  2KEE A;  4HCS A;  1XYI A;  2K01 A;  4IUR A;  4ZKC B;  2EOT A;  4O42 A;  2RVL A;  1F9S A;  1ICW A;  1QNK A;  2NWG A;  2HCC A;  1GUW A;  5EPK A;  1ESR A;  3FDT A;  3MWY W;  2K04 A;  4IUQ A;  2KUM A;  2B2U A;  2B2V C;  1MSG A;  1WTW A;  1EL0 A;  1X3Q A;  2DY8 A;  2K03 A;  5EKI A;  2B2W A;  1O7Z A;  4R8I A;  1B53 A;  4HED A;  3DEO A;  1EIG A;  2FMM A;  4DN4 M;  4ZKB B;  4CJ0 B;  2M2L A;  1ILQ A;  3TZD A;  1IL8 A;  4IUV A;  1WTV A;  3I90 A;  1HFG A;  2N88 A;  2NYZ D;  4X3T A;  4U68 A;  2B2U C;  4ZAI A;  2J7Z A;  2JP1 A;  1X3P A;  4IUU A;  1IKM A;  1Q3L A;  4OIK A;  1HFN A;  2B2W C;  3DM1 A;  1WTO A;  1BF4 A;  1QE6 A;  1BO0 A;  1BNZ A;  1DOK A;  1CM9 A;  1QG7 A;  2RSN A;  1F2L A;  2B2T A;  2IL8 A;  3G7L A;  1JE4 A;  2NZ1 D;  1O80 A;  2Q8T A;  1RHP A;  1U4P A;  3H91 A;  5EJW A;  5CMD A;  1HRJ A;  1MGS A;  2KED A;  1F9Q A;  2CVR A;  1G2S A;  1XX8 A;  3ONA B;  3F2U A;  1RJT A;  1RTN A;  1VMC A;  2X6G A;  1B2T A;  4MN3 A;  1ROD A;  1SDF A;  2B2T C;  3IL8 A;  5AFW A;  2MJ8 A;  5T1I A;  1O7Y A;  3TN2 A;  2HUG A;  1ILP A;  5COY A;  2K28 A;  3QO2 A;  3I8Z A;  1WD1 A;  2KOL A;  2D9U A;  2MGS A;  1U4L A;  4RAU C;  1WTR A;  1J8I A;  1G91 A;  4OIJ A;  2RA4 A;  4NW2 A;  4QUF A;  1B3A A;  3MTS A;  5DNF A;  1WD0 A;  1PFM A;  1PFB A;  1EIH A;  2VXW A;  2EPB A;  4ZK9 B;  4LMQ D;  1HHV A;  2FIN B;  5EPL A;  3UI2 A;  2HDM A;  2RSO A;  3GV3 A;  5E4X A;  1WVL A;  4X3S A;  2H1E A;  4IUP A;  2XIW A;  5CBA E;  1C8C A;  1F9P A;  2MPM A;  2X69 A;  2L1B A;  3LWE A;  2L4N A;  3P7J A;  1DZ1 A;  2EE1 A;  1LV9 A;  2L9H A;  5EQ0 A;  1PLF A;  1TVX A;  2K1B A;  1B50 A;  1JIC A;  1BBX C;  4X3K A;  1G2T A;  4UAI A;  1WTX A;  1WTP A;  1AP0 A;  4HSV A;  4IUT A;  5CBE E;  4R9W A;  1M8A A;  4CJ2 C;  1G6Z A;  5D65 A;  1KNE A;  2L12 A;  1MSH A;  2Q8R E;  5COR A;  1B4O A;  4XT1 B;  2DY7 A;  2SDF A;  1U4R A;  2KVM A;  1EQT A;  2KEC A;  3KBX A;  2JYO A;  3IFD A;  3N52 A;  4ZLT F;  3Q6S A;  3SVM A;  4CJ1 B;  1AZQ A;  1ZXT A;  1S4Z A;  1CA6 A;  3I3C A;  4XT3 B;  3KUP A;  1U4M A;  4RWS C;  3GV6 A;  1X32 A;  3FPU B;  1SAP A;  2K05 A;  1KNA A;  5E4W C;  3I91 A;  2HDL A;  3DEP A;  1WTQ A;  1RTO A;  2B2Y C;  2R3Z A;  3HP3 A;  1IKL A;  1J9O A;  1AZP A;  3D6W A;  1HA6 A;  4HAE A;  1CA5 A;  1DOL A;  1PDQ A; 
#chains in the Genus database with same CATH topology
 1DOM A;  4BXX G;  1F2Z A;  4P2C B;  1Z7T A;  2IPK D;  4JI1 L;  3ICE A;  2X6L A;  5FLM H;  3SR1 A;  4EQP A;  4JI3 Q;  3M4O H;  2IWH A;  3GTK B;  4LF8 L;  4B3M Q;  4Q0F A;  1PYS B;  1SJH D;  2OWO A;  2JJQ A;  3HOZ H;  2BA1 A;  1EY5 A;  5D14 A;  2LY7 A;  2MP1 A;  1C48 A;  4A3F G;  4DUZ L;  4RCN A;  1L1O C;  1F9S A;  1LLR D;  1ICW A;  2HCC A;  1LT6 D;  4XTC S;  1EL0 A;  1CQV A;  1EU3 A;  3G6E A;  2YU9 B;  1Y8O B;  5IGE A;  1GUO A;  1EUJ A;  1NUC A;  4A3K H;  4V0B A;  2NYZ D;  4ZAI A;  3HGB A;  1L1O B;  2AQ3 B;  5IY0 A;  1KIX A;  4G4K A;  3CXC A;  3HRZ C;  3ERQ A;  3K5L A;  1DOK A;  4OWT B;  1UWV A;  3G7L A;  1Y1W B;  3M7N A;  3L9A X;  4ME5 A;  3MAQ A;  4DV2 L;  1VF7 A;  3CPW A;  4X66 L;  4XXE A;  2MFI A;  5IYC G;  1JCK B;  1HNX Q;  1VDZ A;  1PH7 A;  2PQA A;  3GTO B;  1KLU D;  2Z9H A;  2J4X A;  3K5O A;  3I2Z A;  1BBU A;  5TSS A;  1WTR A;  4C3I H;  3SGI A;  1LT5 D;  2JEB I;  4B08 A;  1PFM A;  1VQ9 A;  2JA7 B;  5D3I B;  4A76 A;  3ZYY X;  1I3Q B;  4H0L C;  1PRT C;  2FIN B;  3ULL A;  1STY A;  3GV3 A;  2H1E A;  3QJY A;  4KY7 A;  5KNB A;  1WJJ A;  1LV9 A;  1EY8 A;  3VYS A;  4FVM A;  1C0A A;  1T9H A;  3VR3 A;  1BBX C;  1WTX A;  5C4J B;  2ICI A;  4HMJ A;  1PRT B;  1VQF A;  3CCQ A;  3H15 A;  2JA6 G;  1GUT A;  1BXT A;  2PZU A;  2SDF A;  1N34 Q;  3D3R A;  5LMN L;  5ELD A;  2HHH Q;  5CV7 A;  5K5P A;  1Y14 B;  2JA6 H;  1TWH B;  3NXW A;  4J15 A;  3FPU B;  5EAY A;  5LL6 S;  4JBK A;  2D2C C;  2R3Z A;  1MIU A;  5LMN W;  4CDF C;  4A3M H;  3ERO A;  4KHV A;  1PH1 A;  5C4H A;  1LTA D;  1YVC A;  3HKZ G;  4F8M A;  4X65 L;  4G7H C;  1SLJ A;  5A2Q E;  4ABN A;  4HN7 A;  4K5W A;  3S1Q H;  1CT1 D;  1HTL D;  4IPD A;  1B3Q A;  4A3J H;  2FJ2 A;  2MQH A;  2B2Y A;  4HJA A;  3T56 B;  2RVL A;  2R93 G;  4RH6 A;  1KC8 C;  4TRD A;  4LFA Q;  3F2D A;  2PQE A;  5DEH A;  4DR2 Q;  4MTN A;  3DEO A;  5C4X B;  2DGY A;  2MUY A;  3I90 A;  4UDU C;  1X3P A;  2A8V A;  2AQ1 B;  2B63 H;  1KRT A;  1BNZ A;  2YV5 A;  2R7F A;  2QDB A;  3HKS A;  2NVY B;  2JEA I;  1SMX A;  4R4I A;  4JCV E;  2F52 A;  4DV5 Q;  5FLX L;  3Q24 A;  4WJW A;  4AIM A;  3T1Y Q;  1D5M C;  4NXM L;  3KDF A;  4DNT B;  1S72 A;  1I50 H;  3S17 H;  4GKJ Q;  4DV6 Q;  3BYY B;  5GAD C;  1DM0 B;  3EJI A;  1X56 A;  1V1P B;  3S14 H;  2RKS A;  2OXP A;  3SK8 A;  2PMZ B;  4A3K B;  3S9W A;  4KN4 C;  1OO9 B;  2Z4I A;  3K8A A;  5CV4 A;  2EJG C;  2IX1 A;  4OX9 L;  1FD7 D;  3D0F A;  3OMC A;  5C0X G;  3F2B A;  1WTP A;  1JQY D;  3I4N G;  5BR8 Q;  4OO1 I;  3NBI A;  3R2I A;  1KD1 C;  2O5J C;  4F87 A;  1FNW A;  4IO9 A;  3PUV A;  3VYR A;  3FEW X;  2KEC A;  1YHB A;  2K5W A;  3Q6S A;  1AZQ A;  4KKU A;  5IWA Q;  1S4Z A;  2JE6 I;  1CA6 A;  2ZJP A;  1D5X C;  3GV6 A;  3AEV A;  5EBC A;  4C3I B;  3DEP A;  2F0J A;  1NSN S;  4AQY Q;  1BOS A;  1Q90 A;  4DU9 A;  4BBS G;  3EIV A;  3RNU A;  3FHW A;  5JPN C;  2Z6K C;  5ELE A;  1TWA B;  1SNQ A;  2L11 A;  3CMA A;  3HOY G;  3F8T A;  1HNW Q;  2FHT A;  4IJH A;  1LTI D;  3OWF A;  1STN A;  1PXU A;  4ZKC B;  4O42 A;  4UP9 A;  1EYA A;  3NEM A;  2P5Z X;  3M85 A;  3E9I A;  1WFQ A;  3MXN A;  2Q2I A;  3A74 A;  3KOJ A;  5ISR A;  1FJG L;  4B3R Q;  2F0K A;  3SXH A;  4DK6 C;  4K8I A;  3DXJ C;  1CHQ D;  1W6J A;  1ET6 A;  3S2D H;  4QMG A;  2JA6 B;  2EXD A;  2B2W C;  4JOI A;  4A3M B;  5I6W A;  1JR0 D;  1E1O A;  2F0D A;  4A3I H;  2NZ1 D;  3CKI B;  4RKB A;  2UU9 Q;  1QB5 D;  1RJT A;  4DR3 Q;  2NN6 H;  4BBR H;  1YHQ A;  1SDF A;  3M4P A;  3IL8 A;  4KTA A;  4LF9 L;  5T1I A;  1EQQ A;  3S1Q B;  4JYA L;  3AU7 A;  4A3J B;  3QO2 A;  1AE2 A;  2A68 C;  2O5I C;  2RBM A;  1EEI D;  1VQE A;  2NVQ H;  3WWV A;  2M00 A;  3MTS A;  2ZM6 L;  1QZG A;  1BDO A;  5JVG 3;  4CKB A;  3W5O A;  2EXZ A;  3W1B A;  4DR5 Q;  2K4K A;  5EPL A;  4DR7 Q;  1K8A C;  3LGJ A;  3CCS A;  2VQF Q;  2HQE A;  2XIW A;  1AE3 A;  3DM3 A;  4NXN L;  4KLK A;  2F0F A;  3J7Y W;  5EQ0 A;  4QGU A;  1I5F A;  2JA8 G;  2M9V A;  1NY4 A;  2B63 B;  3GTL H;  2UUA L;  1H9J A;  3URY A;  2AWN A;  2IY5 B;  4A3E G;  1L2F A;  3PUX A;  4CJ2 C;  1E1T A;  3VR6 A;  1G6Z A;  1MSH A;  3P75 A;  4LJZ C;  5IGG A;  3KBX A;  4DV7 Q;  2Z6B A;  3N52 A;  4MTK A;  5DM7 3;  4X62 Q;  2LFN A;  2NN6 I;  3HKZ E;  4XT3 B;  3U58 A;  5JOB A;  3Q0A A;  3U4Z A;  1B7Y B;  1CUK A;  1K3R A;  5A35 A;  2QF7 A;  3A8I E;  2ASB A;  3S17 B;  4JI4 L;  1K8O A;  1Y1V G;  1H9S A;  1HQR D;  1LYL A;  1STG A;  1I94 L;  1CKN B;  1ZEQ X;  3KFU A;  1NTG A;  2VUM H;  4HID A;  2B2V A;  4DUY Q;  4JG2 A;  2D0P A;  4QIW E;  3I4M H;  1CKO A;  2WII B;  1JE5 A;  3VA7 A;  2B2U A;  2XSC A;  1MSG A;  2XWB B;  2JSO A;  1VQ6 A;  2KCN A;  2PZT A;  2KCM A;  3MXG A;  3G4S A;  4R8I A;  4JI0 L;  5IP9 H;  1HZA A;  1YNX A;  3J81 L;  4PMB A;  1EZ6 A;  3I55 A;  3MEH A;  3TZD A;  5HUR A;  3CD6 A;  1SYG A;  1T5X D;  3J7Z C;  4X64 Q;  1WTO A;  3ULP A;  4KY6 A;  1V1Q A;  3WDN A;  2LSS A;  1H9R A;  2V4D A;  1E3P A;  1SYF A;  5EJW A;  4L63 B;  2JA5 H;  1E22 A;  4R4O A;  5D3D A;  1EIY B;  3NSW A;  4A3B G;  2K5N A;  1JWS D;  1A3V A;  2ALY B;  2K5H A;  1B2T A;  4MN3 A;  2F4V L;  2MJ8 A;  3CRL C;  1SNC A;  3OYY A;  5COY A;  2F0N A;  2EJF C;  3UE0 A;  1KDB A;  3ITP A;  4A3G H;  3A54 A;  3HOX H;  1XMQ Q;  4YWM A;  2E74 C;  3SK5 A;  4DV1 Q;  3WOE A;  4A3B H;  2E5L L;  3C3L A;  4RGM A;  2YTY A;  1B3A A;  1X3E A;  5IOD A;  1GUS A;  2A68 D;  1EIH A;  1D2B A;  3GP7 A;  4LMQ D;  1BCP C;  1B9N A;  5ELN A;  1TU2 B;  2JN4 A;  2E2I H;  3I73 A;  1ENA A;  3L3O C;  2YYZ A;  1EY7 A;  2MPM A;  1Y8N B;  3UE1 A;  2L4N A;  4A3D H;  1FVI A;  3S2D B;  4LUO A;  2VB2 X;  2EY1 A;  4K0K Q;  3X3M A;  2R7D A;  3VYT A;  3HEJ A;  1G2T A;  1SRO A;  4P72 A;  1PH6 A;  1BCP B;  5I4D A;  4HSV A;  4DV3 L;  1S5F D;  4TVA B;  5CBE E;  4A3I B;  2Y0S E;  1QJO A;  1XTD A;  4DKA C;  2ZJR A;  2OT2 A;  4C2M H;  3BG3 A;  4XT1 B;  1SYE A;  1EWI A;  4GN4 B;  1Q7Y C;  3A55 A;  4BBR B;  2Q2U A;  1A63 A;  5G3L D;  5IP7 G;  1E24 A;  5EKL A;  1PTO H;  1QCB D;  3GTK H;  4HJ8 A;  3JAM c;  2NVQ B;  1Q8K A;  1HA5 A;  3D6W A;  1QOH A;  1PHJ A;  4L5R C;  2UUB L;  3I56 A;  3R93 A;  1XWE A;  4XIG S;  4KKT A;  3FKI H;  3LX0 A;  4V19 0;  3HS0 C;  3K7U C;  2N78 A;  1XNR Q;  1SYD A;  4HIK A;  4K6L A;  3G71 A;  1GHJ A;  4ZKB B;  1PZI D;  4MIU A;  4ODG A;  3GTL B;  1NBW A;  3CCM A;  2K7V A;  1JJC B;  4G7Z C;  4QF4 A;  4FXK C;  2VNU D;  3FMC A;  3ER0 A;  4B3S Q;  4JI8 Q;  2DY8 A;  2K03 A;  5NUC A;  3A8K E;  4C3J G;  2JA8 B;  5FO9 B;  1ENC A;  1VQ7 A;  1X55 A;  1TT2 A;  4C1N I;  3B6Y A;  1HFN A;  3QOJ A;  1BF4 A;  2VQE L;  1LM0 A;  4G57 A;  1CM9 A;  4JI3 L;  4I65 A;  1EY9 A;  4DK3 C;  5LL6 X;  4B3M L;  4FXD A;  1MGS A;  3CP0 A;  1F9Q A;  1S40 A;  3F1Z A;  1RTN A;  1ZKO A;  4K2L A;  1KAA A;  3TN2 A;  2K5Q A;  4BY7 G;  4JI2 Q;  1TII D;  4WJ4 A;  1WD1 A;  4DNI A;  1O78 A;  3I4M B;  3EVQ A;  3MFY A;  2E2H H;  2RA4 A;  1WYD A;  1CSQ A;  3MVV A;  3J80 E;  5IT9 L;  1STB A;  1VQG A;  3JAM E;  3MFG A;  1RDP D;  3I72 A;  5H1S E;  5C4J H;  1HHV A;  1X3G A;  4NP5 A;  4LF7 Q;  5IGF A;  1KDA A;  5M3M G;  1UUP A;  3TP8 A;  5LMU Q;  2X69 A;  3M7G A;  1P8L A;  4LUZ A;  1SND A;  5GRO A;  2AQ2 B;  2B8G A;  1BCP D;  2VS1 A;  3CHB D;  1JIC A;  3IKJ A;  5HGT A;  1JMC A;  5M5X H;  4YCW A;  3NK9 A;  5CV9 A;  1GUN A;  2KHS A;  4QL5 A;  4A93 G;  2JA5 B;  4B9X A;  1TY2 A;  1PH9 A;  2DY7 A;  3RN2 A;  3VR4 A;  1HCZ A;  1XPO A;  2JYO A;  1KL9 A;  1SE8 A;  4LF5 Q;  4RFB A;  2YTV A;  1VQO A;  2SEB D;  4A3G B;  2I07 B;  3JC6 6;  1B9M A;  1EZ8 A;  3EQL C;  3HOX B;  4A3B B;  1E2Z A;  4P73 A;  4MHE A;  2WIN B;  4GLV B;  3G48 A;  3OIQ A;  4X3U A;  1LTR D;  2BE5 C;  2NBF A;  4YY3 L;  3ND8 A;  1JJG A;  2XRQ D;  4RCO A;  4A3D B;  4NPS A;  4GLA C;  1S3O A;  1TXY A;  4QJF A;  2KEE A;  4R4C A;  1YIT A;  2Q2H A;  2PO4 A;  4IUR A;  1Q81 C;  1DJR D;  4LF4 L;  1GHK A;  4ZQ3 A;  1QNK A;  2F0S A;  1PTO C;  2R6G A;  4YIJ A;  5J22 A;  2UXC Q;  3MWY W;  4LWC A;  3QOL A;  1X3Q A;  3PUZ A;  1SBB B;  4C2M B;  3V2T A;  4JBW A;  4KV6 A;  1EIG A;  2FMM A;  1HXY D;  2F0P A;  4ME3 A;  2M2L A;  2NVY H;  4L8J A;  1PTO B;  2F1M A;  3I70 A;  4OIK A;  3H0G H;  1FL0 A;  1YNN C;  1IHZ A;  2F0O A;  2RSN A;  4F7X A;  4BXX H;  1CK1 A;  5EKK A;  4K14 A;  5CMD A;  2F0H A;  4ULL A;  1IBM Q;  5M5Y H;  4CHT B;  2EYJ A;  1HZC A;  1Q8I A;  2AMC B;  5C6A A;  3FKI B;  5E7N A;  3OIP A;  5AFW A;  1YJW A;  5ELF A;  4A3F H;  2BDO A;  3A0J A;  1PYW D;  2KOL A;  3NQI A;  3HOW G;  1BVS A;  4RGT A;  4LFA L;  4MNO A;  4S3S A;  3R8B A;  2QEX A;  1W6K A;  4DR2 L;  3C1F A;  3BZC A;  5DNF A;  1PFB A;  4A3C G;  1J5E Q;  1PA6 A;  2EPB A;  1ASY A;  5ELB A;  1H9K A;  1XJV A;  1SEB D;  3Q8D A;  4O2D A;  2EYL A;  2R61 A;  2DUD A;  4A3L G;  4DV0 Q;  3SDZ A;  2SNS A;  2Q8R E;  2D5D A;  1H95 A;  5IYC H;  2A6H C;  2H4O A;  3D8G A;  5JVH 3;  1VQD A;  2MHV A;  1Y69 U;  4XQJ A;  4NDX A;  1AFP A;  1RL2 A;  1M1K C;  4AYB G;  2J0T D;  3AYH B;  3PQI A;  1TWA H;  4GKJ L;  2ES2 A;  2E2H B;  2Z6K A;  4DV6 L;  1J9O A;  1N32 L;  3NQT A;  1M4V A;  4XQQ A;  2IT1 A;  5EPJ A;  2PW5 A;  1TS4 A;  3IFT A;  1SYB A;  1HUN A;  4R8N A;  1BR9 A;  1ASZ A;  3MC0 B;  1E0B A;  1GOZ A;  2CKZ B;  1TKW B;  2QA4 A;  4FF4 A;  1S5D D;  1NAP A;  4HCS A;  5BR8 L;  2BE5 D;  5M5X B;  4KN7 C;  2OEO A;  1JB7 A;  4JV5 L;  2F0Q A;  4ID6 A;  4J1M A;  2XRS D;  4JK1 C;  1IL2 A;  1WTW A;  4DGZ A;  3J7A F;  1LUZ A;  1IBL Q;  4NKL A;  2B2W A;  1O7Z A;  4FDB A;  4HED A;  5KYL A;  3GTM H;  1T5E A;  1PTO D;  2F0M A;  4Q5V A;  1WTV A;  4X3T A;  2OQ0 A;  2Z4H A;  3PCO B;  4B3T Q;  4PQX A;  3GTQ H;  1SR3 A;  2F3W A;  4LW1 A;  4XYO A;  4BA1 I;  1XNQ Q;  2Q8T A;  1RHP A;  2CWP A;  1A3U A;  4JI1 Q;  4IZ8 A;  5FO7 B;  1YNN D;  1EY0 A;  4IPC A;  1SJE D;  1A8V A;  2OCE A;  5FLX c;  5K36 G;  4C3H G;  1YHA A;  5C4Z A;  1SE3 A;  3TP7 A;  1VQA A;  1EWC A;  4DFA A;  2R93 H;  1PZJ D;  2L55 A;  5FKA C;  3VYU A;  5G3L F;  4GNX C;  3KLR A;  3I4O A;  3K5N A;  2RQX A;  3GQB A;  1IYJ B;  1VQL A;  3QIA A;  3A5U A;  1HZB A;  4KY5 A;  4G7O C;  2EE1 A;  5GQO A;  1FYC A;  3H0G B;  4GNX B;  1QUQ B;  1EU4 A;  1XTC D;  4UAI A;  4PMW A;  5BN4 A;  1CKN A;  1VQB A;  2MO0 A;  1CHP D;  2O2L D;  3CC7 A;  4DV2 Q;  1KNE A;  4IOA A;  5M5Y B;  4X66 Q;  3BYT B;  1B4O A;  3T13 A;  3TEH B;  4JI5 Q;  2KVM A;  4ZLT F;  2JQO A;  1GD7 A;  2Z0S A;  3I3C A;  4A3F B;  1R9T H;  3C1E A;  5C5L A;  5IYB G;  2K5V A;  1JB3 A;  2WB1 E;  1I4P A;  2A6H D;  4CDD C;  4DR6 L;  4IN3 A;  2HDL A;  4EGV A;  2LXJ A;  3E9H A;  1CA5 A;  1OXV A;  4LFB Q;  2GVA A;  3VDY A;  2R92 G;  1ZYR C;  3MZ5 A;  1VQ4 A;  1CZW A;  4PMC A;  1DON A;  1NMF A;  2DJG C;  2L0C A;  5C0X H;  3SHL A;  3PMF A;  3NTH A;  1VCI A;  4CGY B;  5FLX E;  4M8A A;  1XYI A;  3KLS X;  3I4N H;  3A8J E;  1I6V C;  4PNY A;  4IPH A;  4IUQ A;  4DV7 L;  2Y0S G;  1KHI A;  3HOU G;  2RF4 A;  4UPA A;  5CV5 A;  1CI3 M;  4X62 L;  1Z47 A;  5M3F G;  3NTI A;  3CQZ H;  2N88 A;  5HGQ A;  4N9P A;  4O0A A;  1HH2 P;  3DM1 A;  3HG9 A;  4JBM A;  1D1K A;  3T53 B;  3PUW A;  2F3I A;  4BBS H;  1BCP F;  4BY1 G;  4YCV A;  4DR1 Q;  4U67 3;  1QZH A;  4KI0 A;  2AUJ D;  4K6D A;  4X65 Q;  3TRE A;  5KIX A;  4DUY L;  3H94 A;  3J81 i;  2HUG A;  3HOY H;  4N8X 1;  1S5B D;  1A6X A;  2RDH A;  5C0X I;  2DJF C;  1A2T A;  1J8I A;  1G91 A;  2XN9 C;  4I7Z C;  3QR8 A;  4OXP A;  1I4Q A;  5JJI A;  1U0L A;  1V43 A;  1EY4 A;  4KHP L;  1IYV A;  3GTM B;  1KQS A;  1N33 L;  5ELC A;  4IUP A;  3W2D A;  4L5S A;  4IUN A;  4PG3 A;  4X64 L;  1E2W A;  3RZO H;  2IJ0 A;  2NUC A;  1PLF A;  4B9W A;  1JT8 A;  3GTQ B;  1LTS D;  1PH4 A;  3KLS A;  4PZ6 A;  2KHI A;  2RHQ B;  1JWU D;  4GOP C;  2BH8 A;  4A4I A;  4FNF A;  2GA4 B;  3HFZ B;  4AYB E;  4IUT A;  1IBK L;  1IW7 C;  2JK8 A;  4K2K A;  1VQ8 A;  3RR5 A;  3HKZ B;  5AJ3 Q;  1JOR A;  3QG1 A;  2QIL A;  1BKB A;  3V96 A;  1XMQ L;  3CCL A;  4GOP B;  1X32 A;  5JPM C;  2R93 B;  4JBJ A;  3TP6 A;  4LK1 C;  1YJN A;  1RTO A;  2B2Y C;  2L15 A;  3D4R A;  1HA6 A;  3M4Q A;  2KJX A;  1PDQ A;  4RA8 A;  3V05 A;  4CBV A;  1SN8 A;  2K75 A;  2N55 A;  3ND9 A;  4LF6 L;  2PNH A;  3NBH B;  5JJZ A;  4QIW B;  5C3E G;  1VMP A;  5I2Y A;  4MZ9 A;  4FYD A;  4OX9 Q;  2JA8 H;  2CH4 A;  1ZYR D;  3OTO Q;  4FO2 A;  4KKS A;  4A3E H;  2EOT A;  2A1A A;  3ULJ A;  1PYB A;  5IYD G;  1G51 A;  1EWH A;  4GS3 A;  4KD3 A;  3ZJY C;  1KDC A;  3NPP A;  5EKI A;  4LFC Q;  4JI6 L;  1B53 A;  1EYC A;  3H09 A;  4EVO A;  1SFO H;  4E6I A;  3PO2 G;  4APV A;  2J7Z A;  1R9T B;  3PO3 G;  1XMO L;  4OGQ C;  1H9M A;  5GAH C;  1KAW A;  3P1H A;  1MJC A;  1MKH A;  1F2L A;  1GVP A;  1Y1V H;  1R4Q B;  2I5H A;  5IGB A;  1JE4 A;  3M3Y H;  4NB3 A;  1XNR L;  2ZJQ A;  3D6C A;  4YWL A;  1WCM G;  2X6G A;  1I4X A;  1ROD A;  3E6Z X;  2AHO B;  2G9H D;  4QB4 A;  4C1N K;  3DWA A;  4HJ7 A;  5IE8 A;  1YZ6 A;  2EYF A;  3BVZ A;  4IFD G;  1G8Z D;  2WAQ E;  3I4N B;  5J39 A;  3RN5 A;  3RMH A;  1TWC H;  4QCL A;  3BU2 A;  4IAL A;  2UXB L;  1CQF A;  1FJG Q;  3UI2 A;  1N36 Q;  4DAY B;  2BCO A;  3S2H H;  1UAP A;  3CQZ B;  5HY6 A;  5F2D A;  3GDE A;  2EQS A;  1VQN A;  2Y0S B;  1X65 A;  2MNA A;  5FJ8 G;  3K6O A;  3EA6 A;  1AW7 A;  4K8J A;  1X54 A;  4BBS B;  1K0R A;  1M8A A;  1U9R A;  2PZW A;  1WTH A;  5COR A;  3BDO A;  4ZCK A;  4JC0 A;  4O1N A;  1IW7 D;  1E7Z A;  4DA2 A;  3HOY B;  2KCT A;  3P20 A;  3NUC A;  3KUP A;  4KJO A;  4RWS C;  1WTQ A;  1PTO F;  3NTK A;  4HAE A;  2ZM6 Q;  4LF7 L;  3VA5 A;  1VS0 A;  3GO5 A;  4K5V A;  1II3 A;  5LMU L;  2CWA A;  2F0W A;  5E3F A;  1AEX A;  3DUZ A;  2F0L A;  3N6R A;  4OEM B;  2NZO A;  3RZO B;  5T1G A;  4FXG C;  4NMZ A;  3H3V H;  1K8M A;  2D62 A;  3H6M A;  4RHR A;  1K73 C;  3NEL A;  3KBG A;  2LS0 1;  2NWG A;  1GUW A;  5EPK A;  3K5M A;  3E0E A;  3LNN A;  3KYH C;  3CRK C;  3KLW A;  4DV4 L;  3CC2 A;  2QGQ A;  1UE7 A;  4CJ0 B;  5IP7 H;  2PNR C;  4U68 A;  2IHE A;  4LNQ A;  2PPB C;  1UNS A;  4JPB W;  1DD2 A;  3K0Y A;  1IKM A;  1L1O A;  2QCP X;  1PH5 A;  3CW2 C;  3OW2 A;  2N49 A;  1L0W A;  1V9P A;  2OF1 A;  1U4P A;  4C56 C;  1I94 Q;  5C3W A;  1UEA B;  2CVR A;  1G2S A;  1X6O A;  2EVB A;  2KA7 A;  3ONA B;  4XYQ A;  3KJO A;  3DWQ A;  4YHH L;  1G29 1;  4JI7 Q;  1D5Z C;  4DR4 Q;  3H3V I;  2UXC L;  1U4L A;  4A3E B;  3BDL A;  2NVT H;  2EYH A;  5IT9 c;  3KF6 B;  4QUF A;  5C3E B;  4C3J H;  1Y1W G;  3S1R H;  1KTK A;  2KQ3 A;  3PIP 3;  3TS0 A;  1C8C A;  1SFO B;  1F2Y A;  3J80 L;  1TVX A;  2RCF A;  1PH3 A;  1B50 A;  2HIX A;  1AN8 A;  4UP8 A;  3NE5 B;  1Y1V B;  3T51 B;  4FF3 A;  1OXU A;  3M3Y B;  2L12 A;  1EOV A;  2PCF B;  3PO3 B;  5E1F A;  2JA7 G;  3TBI B;  1U4R A;  3NHH A;  1TQO A;  2F4V Q;  1BUV T;  4BY7 H;  3SEB A;  1UE6 A;  2ID0 A;  3L7Z C;  2DNE A;  2AUK A;  1XXG A;  5EGT A;  2XNA C;  3A7A B;  3I91 A;  1WCM B;  1SE2 A;  2E5L Q;  2OTL A;  1H9S B;  1TWC B;  1STE A;  2E75 C;  4DXG A;  4POG A;  4P75 A;  1K28 A;  5LHY 1;  2Z1C A;  5M3M H;  3M4Y A;  2R7Z G;  5C44 G;  3S2H B;  1HUM A;  1HNX L;  2WFW A;  1Q46 A;  3SE0 A;  3NP8 A;  3TDQ A;  4DV0 L;  3J81 j;  1PFN A;  2A73 B;  2K01 A;  5JEA G;  3RD4 A;  4DK1 A;  1CFM A;  5L37 A;  4DV3 Q;  2R7Z H;  4A93 H;  1GJX A;  2K04 A;  1VQK A;  4HIO A;  1B70 B;  2ZXO A;  5IT9 E;  3A56 A;  5IOC A;  2RHS B;  4A75 A;  4DN4 M;  5JEA H;  1HFG A;  4P74 A;  2D0O A;  3BZD B;  4DPG A;  1RIP A;  4FF2 A;  2V1C C;  3EBE A;  1XPR A;  1VQH A;  4OHJ A;  2WB1 G;  5I9O A;  5C0X J;  3T1H Q;  3H3V C;  1PH2 A;  3CAM A;  5GAE C;  3EFX D;  2AKW B;  1LTB D;  4CKC A;  3C2P A;  4KMU C;  3TSS A;  3OHX C;  3S16 H;  2GN5 A;  3OOC A;  3C46 A;  2B2T C;  5CGK A;  1N34 L;  1L0X B;  3DHQ A;  4GNX A;  3J7A 5;  2SNM A;  2HHH L;  4EQN A;  1K9M C;  1IXR A;  1M90 C;  1TR5 A;  2CFM A;  1GXD C;  4X6A H;  1UEB A;  1EFW A;  2ATW A;  1Z6H A;  3Q23 A;  1IZ6 A;  2HIV A;  2RDG A;  4BWG B;  1WVL A;  5FLM G;  4B3T L;  3PIO 3;  4IQZ A;  1V1P A;  1Q82 C;  3KF8 B;  3VR5 A;  3S15 H;  2L5T A;  1FGU A;  3HOZ G;  1HPC A;  4PV1 C;  4ZUI A;  3S1M H;  3L0O A;  3CCU A;  2VQE Q;  1TWG H;  1XNQ L;  1BQQ T;  4QQB X;  2E2D C;  2UXD Q;  1BBW A;  2F0G A;  3ERS X;  3KK7 A;  4J8Q A;  3IRB A;  5J1Z A;  5KGU A;  3BJU A;  2F0E A;  4YCU A;  2ZTE A;  2C9O A;  3O13 A;  3QWN A;  1FNU A;  5DLQ E;  2ZTC A;  4A3K G;  3PF5 A;  3HOW H;  4WJ3 M;  3K80 C;  4ZYS A;  1KNA A;  1C4Q A;  2KBN A;  3T4A C;  2NVT B;  3HP3 A;  1V1O A;  2LKV A;  4A3C H;  1QVG A;  4UHV A;  2I0Q A;  1EYD A;  4L5Q A;  4C3J B;  2OQK A;  3S1R B;  1F9R A;  1EOT A;  2CW0 C;  4H7B A;  1GUG A;  4POF A;  1LO5 D;  4JVZ A;  4DV5 L;  2AWO A;  3SK4 A;  1ML0 D;  1MI2 A;  2H5X A;  3RUZ A;  4A3L H;  2WV6 D;  3R2T A;  3T1Y L;  1NMG A;  4M1U B;  1HR0 Q;  4C3I G;  4JI5 L;  3K0X A;  3WOF A;  1C7Y A;  2UUC Q;  1HJP A;  3LWU A;  3J7A V;  1CTM A;  1TS5 A;  3F2C A;  1IL8 A;  4HJ5 A;  4BY7 B;  1GO3 E;  3PGZ A;  2EYP A;  4IUU A;  3MHB A;  1K83 H;  4WFN 3;  4IOC A;  3PF4 A;  4LFB L;  2IL8 A;  5CR3 A;  2PI2 A;  1F77 A;  2OTJ A;  4AH6 A;  2KED A;  5M3M B;  3BVG A;  5A2Q L;  4YY3 Q;  1HNZ Q;  2IW3 A;  1Q12 A;  5M9O A;  1O7Y A;  2F0U A;  1RKN A;  2K28 A;  5IWA L;  5ELO A;  3M9B A;  2B29 A;  2D9U A;  4RGN A;  4LF4 Q;  5BN3 A;  2NZH A;  2R7Z B;  5C44 B;  4AQY L;  2LXK A;  2EJM A;  4A93 B;  5KEE A;  4Z9C B;  4A3M G;  4WRD A;  3CCV A;  1STA A;  1NNX A;  4GKK Q;  1YIJ A;  4GOP A;  5I6Y A;  5DM6 3;  3U4V A;  5JAV A;  3OSO A;  1I6H H;  2ENB A;  1EYG A;  4OWW B;  3GTJ H;  4LF8 Q;  4A3J G;  1O7L A;  1HNW L;  1JOO A;  4DR1 L;  4PZ7 A;  1N8R C;  5JJK A;  3E0J A;  3NBH A;  4DUZ Q;  4R9W A;  3CCE A;  4I7A A;  2EYM A;  3NEN A;  1XPU A;  1TY0 A;  3OWE B;  2VB3 X;  2K33 A;  3S16 B;  2EZV A;  5K36 H;  2N3S A;  4C3H H;  2WB1 B;  1JWM D;  3KJP A;  3GTP H;  4B3R L;  2CQO A;  5M5W H;  1RD9 D;  4IFD J;  1U4M A;  4DAM A;  2EDG A;  1CZG A;  4N8F A;  4RMF A;  1ENF A;  3MXU A;  2K05 A;  5CYU A;  5E4W C;  2B63 G;  2WAQ G;  3VR2 A;  2A5H A;  4OO1 G;  3W3A A;  3GTG H;  3BDC A;  2NVX H;  2LMC B;  2UU9 L;  2HT1 A;  3SK6 A;  4DR3 L;  4K5X A;  3S15 B;  3AQQ A;  4HTH A;  3UDX A;  4OO1 H;  3S1M B;  2GVB A;  2CW0 D;  3HOV G;  1LT3 D;  1TWG B;  1I4H A;  1A2U A;  3STB C;  3TRZ A;  4ZRZ A;  4R1J A;  5AJ3 L;  3D4W A;  3M4O B;  2SOB A;  5CV6 A;  3HOZ B;  3U50 C;  4DR5 L;  4OEL B;  3HOV H;  4DR7 L;  1VQI A;  2VQF L;  4YWK A;  1A0I A;  2FXQ A;  1I4G A;  3CC4 A;  3HOW B;  5IYB H;  4LUV A;  1S5E D;  3PV0 A;  1QVC A;  1Q3L A;  4LAA A;  2A19 A;  1OXX K;  1VQC A;  1N32 Q;  2G5D A;  1QG7 A;  2I5M X;  4ILW A;  2R92 H;  1JOK A;  4DAY A;  2RDF A;  1XX8 A;  2I46 A;  1PRT D;  3K58 A;  3OTO L;  2WAC A;  1SNO A;  2E76 C;  4CKE A;  2CHB D;  5LMN Q;  3QB3 A;  2NTS A;  2VZA A;  1UE1 A;  4OIJ A;  4JV5 Q;  4LFC L;  2QDL A;  4IPG A;  1WD0 A;  3HOU H;  2ZXR A;  3K81 C;  5M3F H;  2VXW A;  4RGO S;  3DMU A;  4KD4 A;  1F9P A;  5I2X A;  1OXS C;  4AYB B;  1CSP A;  1K83 B;  3D31 A;  1HTP A;  2PQA B;  2PMZ E;  2WP8 J;  1O7I A;  2KHJ A;  2K14 A;  1AP0 A;  5I9P A;  4DF7 A;  3K57 A;  5KND A;  4HR7 B;  4BY1 H;  1DCZ A;  1KAB A;  1QIL A;  4EQ5 A;  1YI2 A;  4DAV A;  1SMY C;  5C3X A;  1HQM C;  1PZK D;  2E2J H;  2Q2T A;  4GN5 A;  3U9O A;  1PMR A;  1EQR A;  1VQP A;  3CF5 A;  2F0I A;  3S1N H;  1K0S A;  1Y8P B;  3U9S A;  1N36 L;  4R4T A;  2XGT A;  1A15 A;  4A3I G;  1LTT D;  1YNJ C;  1STH A;  4XDX A;  1I6H B;  1DXM A;  2NN6 G;  4BBR G;  4DK0 A;  5JJL A;  3GTJ B;  3S24 A;  3CCR A;  3I7F A;  4DV1 L;  1GM5 A;  2F0V A;  1D8L A;  3FDT A;  2Q8I B;  1MD2 D;  2A69 C;  3X3N A;  3A5Z B;  2F4I A;  4NXM Q;  4CDE C;  3STB D;  2EIF A;  4C3H B;  3AMU A;  1ILQ A;  3GTP B;  4IUV A;  2C5C A;  5M5W B;  2JP1 A;  4DR6 Q;  2ZXP A;  3FVQ A;  3KF6 A;  2NB0 A;  4K0K L;  2EYO A;  1Q86 C;  5KNC A;  2MO1 A;  2RCN A;  1G6P A;  3AFQ A;  2XTI A;  2K50 A;  3GTG B;  2QW7 A;  5EBD A;  1X9N A;  1B1Z A;  2NVX B;  2PI2 E;  2VL6 A;  3F2U A;  1VMC A;  5C3E H;  2WAQ B;  1TWF H;  1FR3 A;  5IIF A;  3J81 c;  2EY5 A;  5JEA J;  1ET9 A;  4EQO A;  1A62 A;  2MGS A;  5IYD H;  2IHF A;  3PSI A;  3RZD H;  1LT4 D;  4HIM A;  4N9T A;  2NTT A;  2PYK A;  3OPO A;  1TS3 A;  3HOV B;  1FGB D;  2HDM A;  5E4X A;  2C35 B;  4X3S A;  2QEJ C;  3RLF A;  3PO2 H;  5FOB B;  1MBY A;  1V8Q A;  3GD7 A;  2VY3 A;  3P7J A;  3PO3 H;  4KJN A;  2L9H A;  2VUM G;  1EQV A;  1I50 B;  1D1I A;  2YTX A;  4TKO B;  3FRP B;  2K6A A;  4OWX B;  3I4M G;  3S14 B;  4GZY C;  4PZ8 A;  2R92 B;  4OON A;  4B3S L;  3KDF B;  5D65 A;  1WCM H;  4JI8 L;  4HCE A;  4L5T A;  4FP5 D;  5IP9 G;  4JI7 L;  4DR4 L;  3SVM A;  2I5L X;  3RLN A;  5KYI A;  1D7Q A;  1IYU A;  2N8N A;  4IFD H;  1SMY D;  3J80 i;  3PUY A;  5C5M A;  3JAM i;  2VW9 A;  1SE4 A;  3PIP A;  1JJ2 A;  3TQY A;  3HOU B;  4TQU S;  5M3F B;  5FK9 C;  1W2B A;  3DWP A;  4KHP Q;  4F88 A;  3CCJ A;  3TP5 A;  1OXT A;  2JA5 G;  2K5D A;  1N33 Q;  1NCV A;  4J6H A;  1NR4 A;  2XWJ B;  1PH8 A;  1VQJ A;  1MJE A;  2FFK B;  3OMG A;  4JI2 L;  1MHW C;  4QUC A;  1YNJ D;  2BDN A;  4LF9 Q;  4L6T B;  5FJ8 H;  5GAG C;  2HCI A;  4A3G G;  1ONL A;  4JYA Q;  3J81 E;  4H13 C;  3HOX G;  2F03 A;  3RLO A;  1I4R A;  1IBK Q;  4BY1 B;  2KUM A;  2O4X A;  2XVS A;  3HZX A;  2EY6 A;  4HMI A;  3UDF A;  4KHZ A;  4RKL A;  3L2P A;  5FO8 B;  2E2J B;  1E2V A;  2A69 D;  4FF1 A;  5J3B A;  4A3D G;  1S5C D;  2G9D A;  1DYQ A;  4ZUJ A;  4HSP A;  3OW7 A;  4H02 A;  4NXN Q;  3AFP A;  4IFD I;  3S1N B;  2B2T A;  4IJL A;  1C9O A;  1O80 A;  2Z8L A;  2UUA Q;  4LF6 Q;  1TS2 A;  5IGC A;  4JOI C;  3KF8 A;  2HQL A;  2EY2 A;  4ALP A;  1PVO A;  3MXN B;  1KRS A;  1QWY A;  4DAP A;  1ILP A;  5IGD A;  4Y7N H;  4LF5 L;  3I8Z A;  4P71 A;  2DN8 A;  2KCC A;  1QNU A;  3EN2 A;  3K7A H;  1VQM A;  1X3F A;  5KRU A;  1KXL A;  4H44 C;  3T16 A;  1EY6 A;  2IX0 A;  1CKM A;  1NJI C;  2KEN A;  1N9W A;  4ZK9 B;  4JI6 Q;  2B8F A;  4WOR A;  1EEF D;  1B8A A;  4XQN A;  4JI4 Q;  2B39 A;  1JOQ A;  3FKI G;  5CBA E;  2JA9 A;  1VF5 C;  3J80 c;  1YBY A;  2L1B A;  4DXF A;  1DZ1 A;  4GLX A;  3T1H L;  2A6E C;  1F2M A;  1XMO Q;  4UY8 C;  2K1B A;  1K8G A;  4X3K A;  1L0Y B;  1Q1B A;  3E3X A;  1LAC A;  2YU9 H;  5CV8 A;  4TSS A;  2K52 A;  1EQT A;  3IFD A;  3CME A;  3E5S A;  3BVM A;  4EX5 A;  1PFS A;  1TWF B;  1ZXT A;  4BS9 A;  1ESF A;  1PV4 A;  2B3G A;  4JI0 Q;  4JW0 A;  1RCV D;  3IAY A;  3PIO A;  1SAP A;  1DGS A;  2TSS A;  3DLL A;  4Y52 H;  1IKL A;  2A74 C;  1AZP A;  2FMC A;  3JAM L;  3MXP A;  1W3S A;  3RZD B;  1DOL A;  1SNP A;  1Y1W H;  3NWS A;  1VQ5 A;  4QY7 A;  2UXB Q;  1AH9 A;  1IBM L;  4DNR B;  4CDC C;  1NR2 A;  1R4P B;  1WOC A;  1SSO A;  2DNC A;  3UDI A;  1P16 A;  3PO2 B;  1HZ9 A;  3GTO H;  1D6E C;  3MEF A;  3K59 A;  3FP9 A;  1EFI D;  3TZU A;  1PRT F;  2UXD L;  3TME A;  3D4D A;  1EIF A;  1ESR A;  2B2V C;  1QVF A;  2JA7 H;  2VUM B;  1J5E L;  4KK7 A;  1I3Q H;  2TMP A;  2QKI C;  3TS2 A;  3G6J B;  1LTG D;  3NWT A;  2F3V A;  3MA2 B;  2B2U C;  1B44 D;  1RF2 D;  1QE6 A;  5DAU A;  1BO0 A;  1FNV A;  1YJ9 A;  2BH2 A;  2CH4 W;  4OL7 A;  4UP7 A;  3CU7 A;  3R3O A;  1JC7 A;  5BN5 A;  1WI5 A;  1SNM A;  3H91 A;  1HRJ A;  5C44 H;  1GKH A;  3FPP A;  1U5K A;  3BS1 A;  1HR0 L;  3UDG A;  1TWH H;  2BOS A;  3I4L A;  4RAU C;  1NE3 A;  2JXM B;  4NW2 A;  2UUC L;  1LAB A;  1K3B C;  1Q1E A;  4DV4 Q;  1HR0 W;  2K32 A;  1UE5 A;  3CPF A;  1OTC A;  1SYC A;  2RSO A;  2CCZ A;  2UUB Q;  1J6Q A;  2CQA A;  3LWE A;  2WKD A;  2F0T A;  4RG1 A;  2WKC A;  1Z9F A;  1YEZ A;  5C4X G;  1QUQ A;  2BA0 A;  2ICE C;  3W1G A;  1KLG D;  2E2I B;  2HD3 A;  2A6E D;  1ICF B;  1HNZ L;  4GN3 B;  2ZT9 C;  4BA2 I;  2IX3 A;  1IBL L;  5C4X H;  1SXT A;  4R4Q A;  4CJ1 B;  5CC4 A;  2ZTD A;  4HJ9 A;  4YHH Q;  4Y7N B;  4RHS A;  1SRU A;  3Q22 A;  2PW7 A;  3BZK A;  3H0G G;  3K7A B;  2E8G A;  1LTL A;  1A3T A;  3A7L A;  4GKK L;  3AB9 A; 
#chains in the Genus database with same CATH homology
 1DOM A;  1F2Z A;  4P2C B;  1Z7T A;  2IPK D;  2X6L A;  3SR1 A;  4EQP A;  2IWH A;  3GTK B;  4Q0F A;  1SJH D;  2BA1 A;  1EY5 A;  5D14 A;  2LY7 A;  2MP1 A;  1C48 A;  4RCN A;  1F9S A;  1LLR D;  1ICW A;  2HCC A;  1LT6 D;  4XTC S;  1EL0 A;  1CQV A;  1EU3 A;  2YU9 B;  1Y8O B;  5IGE A;  1GUO A;  1NUC A;  4V0B A;  2NYZ D;  4ZAI A;  3HGB A;  2AQ3 B;  4G4K A;  3HRZ C;  3ERQ A;  3K5L A;  1DOK A;  3G7L A;  1Y1W B;  3M7N A;  3L9A X;  4ME5 A;  3MAQ A;  1VF7 A;  4XXE A;  1JCK B;  1VDZ A;  3GTO B;  1KLU D;  2J4X A;  3K5O A;  5TSS A;  1WTR A;  1LT5 D;  2JEB I;  4B08 A;  1PFM A;  2JA7 B;  5D3I B;  3ZYY X;  1I3Q B;  4H0L C;  1PRT C;  2FIN B;  1STY A;  3GV3 A;  2H1E A;  3QJY A;  4KY7 A;  5KNB A;  1LV9 A;  1EY8 A;  3VYS A;  4FVM A;  3VR3 A;  1BBX C;  1WTX A;  5C4J B;  2ICI A;  4HMJ A;  1PRT B;  1GUT A;  1BXT A;  2PZU A;  2SDF A;  3D3R A;  5ELD A;  5CV7 A;  5K5P A;  1TWH B;  3NXW A;  3FPU B;  5LL6 S;  2D2C C;  2R3Z A;  3ERO A;  4KHV A;  5C4H A;  1LTA D;  4F8M A;  4G7H C;  5A2Q E;  4ABN A;  4HN7 A;  4K5W A;  1CT1 D;  1HTL D;  2FJ2 A;  2B2Y A;  3T56 B;  2RVL A;  4RH6 A;  4TRD A;  2PQE A;  5DEH A;  3DEO A;  5C4X B;  2MUY A;  3I90 A;  4UDU C;  1X3P A;  2AQ1 B;  1BNZ A;  2QDB A;  2NVY B;  2JEA I;  5FLX L;  3Q24 A;  4WJW A;  1D5M C;  4DNT B;  3BYY B;  1DM0 B;  3EJI A;  1V1P B;  2RKS A;  2OXP A;  3SK8 A;  2PMZ B;  4A3K B;  3S9W A;  4KN4 C;  1OO9 B;  2Z4I A;  5CV4 A;  2EJG C;  2IX1 A;  1FD7 D;  3OMC A;  5C0X G;  1WTP A;  1JQY D;  4OO1 I;  3NBI A;  3R2I A;  2O5J C;  4F87 A;  1FNW A;  3PUV A;  3VYR A;  3FEW X;  2KEC A;  2K5W A;  3Q6S A;  1AZQ A;  4KKU A;  1S4Z A;  2JE6 I;  1CA6 A;  1D5X C;  3GV6 A;  5EBC A;  4C3I B;  3DEP A;  2F0J A;  1NSN S;  1BOS A;  1Q90 A;  4DU9 A;  5JPN C;  5ELE A;  1TWA B;  1SNQ A;  2L11 A;  2FHT A;  1LTI D;  3OWF A;  1STN A;  1PXU A;  4ZKC B;  4O42 A;  1EYA A;  3M85 A;  3MXN A;  5ISR A;  2F0K A;  3SXH A;  4K8I A;  3DXJ C;  1CHQ D;  1W6J A;  1ET6 A;  4QMG A;  2JA6 B;  2B2W C;  4A3M B;  5I6W A;  1JR0 D;  2F0D A;  2NZ1 D;  3CKI B;  4RKB A;  1QB5 D;  1RJT A;  2NN6 H;  1SDF A;  3IL8 A;  4KTA A;  5T1I A;  3S1Q B;  3AU7 A;  4A3J B;  3QO2 A;  2A68 C;  2O5I C;  2RBM A;  1EEI D;  2M00 A;  3MTS A;  1BDO A;  5JVG 3;  4CKB A;  2EXZ A;  5EPL A;  2HQE A;  2XIW A;  3J7Y W;  2F0F A;  5EQ0 A;  2M9V A;  2B63 B;  1H9J A;  3URY A;  2AWN A;  3PUX A;  4CJ2 C;  3VR6 A;  1G6Z A;  1MSH A;  3P75 A;  4LJZ C;  5IGG A;  3KBX A;  3N52 A;  5DM7 3;  2LFN A;  2NN6 I;  4XT3 B;  5JOB A;  3Q0A A;  5A35 A;  2QF7 A;  3A8I E;  3S17 B;  1K8O A;  1H9S A;  1HQR D;  1STG A;  1ZEQ X;  2B2V A;  2WII B;  3VA7 A;  2B2U A;  2XSC A;  1MSG A;  2XWB B;  2JSO A;  2KCN A;  2PZT A;  3MXG A;  4R8I A;  3J81 L;  4PMB A;  1EZ6 A;  3MEH A;  3TZD A;  5HUR A;  1SYG A;  1T5X D;  1WTO A;  4KY6 A;  3WDN A;  1H9R A;  2V4D A;  1SYF A;  5EJW A;  4L63 B;  5D3D A;  3NSW A;  1JWS D;  1A3V A;  1B2T A;  4MN3 A;  2MJ8 A;  3CRL C;  1SNC A;  5COY A;  2F0N A;  2EJF C;  1KDB A;  3ITP A;  3A54 A;  2E74 C;  3SK5 A;  3WOE A;  3C3L A;  4RGM A;  1B3A A;  5IOD A;  1GUS A;  2A68 D;  1EIH A;  1D2B A;  3GP7 A;  4LMQ D;  1BCP C;  1B9N A;  1TU2 B;  3I73 A;  1ENA A;  3L3O C;  2YYZ A;  1EY7 A;  2MPM A;  1Y8N B;  2L4N A;  3S2D B;  2VB2 X;  2EY1 A;  3X3M A;  3VYT A;  3HEJ A;  1G2T A;  1BCP B;  5I4D A;  4HSV A;  1S5F D;  5CBE E;  4A3I B;  1QJO A;  2OT2 A;  3BG3 A;  4XT1 B;  1SYE A;  3A55 A;  4BBR B;  5G3L D;  5EKL A;  1PTO H;  1QCB D;  2NVQ B;  1HA5 A;  3D6W A;  1QOH A;  3R93 A;  1XWE A;  4XIG S;  4KKT A;  3LX0 A;  4V19 0;  3HS0 C;  1SYD A;  4K6L A;  1GHJ A;  4ZKB B;  1PZI D;  4MIU A;  4ODG A;  3GTL B;  2K7V A;  4G7Z C;  4QF4 A;  4FXK C;  2VNU D;  3FMC A;  2DY8 A;  2K03 A;  5NUC A;  3A8K E;  4C3J G;  2JA8 B;  5FO9 B;  1ENC A;  1TT2 A;  4C1N I;  1HFN A;  3QOJ A;  1BF4 A;  4G57 A;  1CM9 A;  4I65 A;  1EY9 A;  5LL6 X;  4FXD A;  1MGS A;  1F9Q A;  1RTN A;  1ZKO A;  4K2L A;  1KAA A;  3TN2 A;  2K5Q A;  1TII D;  1WD1 A;  1O78 A;  3I4M B;  3EVQ A;  3MFY A;  2RA4 A;  3MVV A;  3J80 E;  5IT9 L;  1STB A;  3JAM E;  3MFG A;  1RDP D;  3I72 A;  1HHV A;  4NP5 A;  5IGF A;  1KDA A;  1UUP A;  3TP8 A;  2X69 A;  3M7G A;  1SND A;  2AQ2 B;  2B8G A;  1BCP D;  3CHB D;  1JIC A;  3IKJ A;  5HGT A;  3NK9 A;  5CV9 A;  1GUN A;  2KHS A;  2JA5 B;  4B9X A;  1TY2 A;  2DY7 A;  3VR4 A;  1HCZ A;  2JYO A;  4RFB A;  2SEB D;  4A3G B;  2I07 B;  1B9M A;  1EZ8 A;  3EQL C;  3HOX B;  4A3B B;  1E2Z A;  4MHE A;  2WIN B;  3OIQ A;  4X3U A;  1LTR D;  2BE5 C;  2NBF A;  3ND8 A;  2XRQ D;  4RCO A;  4A3D B;  2KEE A;  1GHK A;  2PO4 A;  4IUR A;  1DJR D;  4ZQ3 A;  1QNK A;  2F0S A;  1PTO C;  2R6G A;  4YIJ A;  5J22 A;  3MWY W;  3QOL A;  1X3Q A;  3PUZ A;  1SBB B;  4C2M B;  3V2T A;  4JBW A;  4KV6 A;  1EIG A;  2FMM A;  1HXY D;  2F0P A;  2M2L A;  4L8J A;  1PTO B;  2F1M A;  3I70 A;  4OIK A;  1YNN C;  1IHZ A;  2F0O A;  2RSN A;  4F7X A;  1CK1 A;  5EKK A;  4K14 A;  5CMD A;  2F0H A;  4ULL A;  4CHT B;  2EYJ A;  1Q8I A;  5C6A A;  3FKI B;  3OIP A;  5AFW A;  5ELF A;  2BDO A;  1PYW D;  2KOL A;  3NQI A;  4RGT A;  4S3S A;  3R8B A;  1W6K A;  3C1F A;  5DNF A;  1PFB A;  2EPB A;  5ELB A;  1H9K A;  1SEB D;  2EYL A;  2R61 A;  3SDZ A;  2SNS A;  2Q8R E;  2D5D A;  2A6H C;  2H4O A;  3D8G A;  5JVH 3;  1Y69 U;  2MHV A;  4XQJ A;  4NDX A;  1AFP A;  2J0T D;  2E2H B;  1J9O A;  3NQT A;  1M4V A;  4XQQ A;  2IT1 A;  5EPJ A;  2PW5 A;  1TS4 A;  3IFT A;  1SYB A;  1HUN A;  4R8N A;  1BR9 A;  3MC0 B;  1E0B A;  1GOZ A;  1TKW B;  4FF4 A;  1S5D D;  1NAP A;  4HCS A;  2BE5 D;  5M5X B;  4KN7 C;  2OEO A;  2F0Q A;  4ID6 A;  4J1M A;  2XRS D;  4JK1 C;  1WTW A;  4DGZ A;  3J7A F;  4NKL A;  2B2W A;  1O7Z A;  4HED A;  5KYL A;  1T5E A;  1PTO D;  2F0M A;  4Q5V A;  1WTV A;  4X3T A;  2Z4H A;  4PQX A;  2F3W A;  4XYO A;  4BA1 I;  2Q8T A;  1RHP A;  1A3U A;  4IZ8 A;  5FO7 B;  1YNN D;  1EY0 A;  1SJE D;  5K36 G;  4C3H G;  5C4Z A;  1SE3 A;  3TP7 A;  1EWC A;  4DFA A;  1PZJ D;  2L55 A;  5FKA C;  3VYU A;  5G3L F;  3KLR A;  3K5N A;  2RQX A;  3GQB A;  3QIA A;  4KY5 A;  4G7O C;  2EE1 A;  1FYC A;  3H0G B;  1EU4 A;  1XTC D;  4UAI A;  4PMW A;  5BN4 A;  2O2L D;  1CHP D;  1KNE A;  5M5Y B;  3BYT B;  1B4O A;  3T13 A;  2KVM A;  4ZLT F;  3I3C A;  4A3F B;  3C1E A;  5C5L A;  1JB3 A;  1I4P A;  2A6H D;  4IN3 A;  2HDL A;  4EGV A;  1CA5 A;  1OXV A;  1ZYR C;  3MZ5 A;  1CZW A;  4PMC A;  1DON A;  2L0C A;  5C0X H;  3SHL A;  3PMF A;  3NTH A;  1VCI A;  4CGY B;  5FLX E;  4M8A A;  1XYI A;  3KLS X;  3A8J E;  1I6V C;  4PNY A;  4IUQ A;  5CV5 A;  1CI3 M;  1Z47 A;  3NTI A;  2N88 A;  4N9P A;  3DM1 A;  3HG9 A;  1D1K A;  3T53 B;  3PUW A;  1BCP F;  4U67 3;  4KI0 A;  2AUJ D;  4K6D A;  5KIX A;  3H94 A;  2HUG A;  1S5B D;  1A6X A;  2RDH A;  5C0X I;  1A2T A;  1J8I A;  1G91 A;  2XN9 C;  4I7Z C;  1I4Q A;  1V43 A;  1EY4 A;  1IYV A;  3GTM B;  5ELC A;  4IUP A;  3W2D A;  4IUN A;  1E2W A;  2IJ0 A;  2NUC A;  1PLF A;  4B9W A;  3GTQ B;  1LTS D;  3KLS A;  1JWU D;  4FNF A;  2GA4 B;  4IUT A;  1IW7 C;  4K2K A;  3HKZ B;  1JOR A;  3QG1 A;  2QIL A;  3V96 A;  1X32 A;  5JPM C;  2R93 B;  3TP6 A;  4LK1 C;  1RTO A;  2B2Y C;  3D4R A;  1HA6 A;  2KJX A;  1PDQ A;  4RA8 A;  3V05 A;  4CBV A;  3ND9 A;  2N55 A;  5JJZ A;  4QIW B;  1VMP A;  5I2Y A;  4FYD A;  1ZYR D;  4FO2 A;  4KKS A;  2EOT A;  1EWH A;  4KD3 A;  1KDC A;  3NPP A;  5EKI A;  1B53 A;  1EYC A;  3H09 A;  4EVO A;  4E6I A;  2J7Z A;  1R9T B;  4OGQ C;  1H9M A;  3P1H A;  5IGB A;  1F2L A;  1R4Q B;  1JE4 A;  3D6C A;  2X6G A;  1I4X A;  1ROD A;  3E6Z X;  2G9H D;  4QB4 A;  4C1N K;  3DWA A;  2EYF A;  3BVZ A;  4IFD G;  1G8Z D;  3I4N B;  5J39 A;  3RMH A;  4QCL A;  4IAL A;  1CQF A;  3UI2 A;  2BCO A;  1UAP A;  3CQZ B;  5F2D A;  2Y0S B;  3K6O A;  3EA6 A;  1AW7 A;  4K8J A;  4BBS B;  1M8A A;  1U9R A;  2PZW A;  5COR A;  3BDO A;  4O1N A;  1IW7 D;  4DA2 A;  3HOY B;  3P20 A;  3NUC A;  3KUP A;  4KJO A;  4RWS C;  1WTQ A;  1PTO F;  3NTK A;  4HAE A;  3VA5 A;  3GO5 A;  4K5V A;  1II3 A;  2F0W A;  5E3F A;  1AEX A;  3DUZ A;  2F0L A;  3N6R A;  3RZO B;  5T1G A;  4FXG C;  4NMZ A;  1K8M A;  2D62 A;  3H6M A;  4RHR A;  3KBG A;  2LS0 1;  2NWG A;  1GUW A;  5EPK A;  3K5M A;  3LNN A;  3CRK C;  4CJ0 B;  2PNR C;  4U68 A;  2PPB C;  1UNS A;  1DD2 A;  3K0Y A;  1IKM A;  2QCP X;  2OF1 A;  1U4P A;  4C56 C;  5C3W A;  1UEA B;  2CVR A;  1G2S A;  2EVB A;  2KA7 A;  4XYQ A;  3ONA B;  3DWQ A;  1G29 1;  1D5Z C;  1U4L A;  4A3E B;  3BDL A;  2EYH A;  4QUF A;  5C3E B;  1KTK A;  2KQ3 A;  3PIP 3;  1C8C A;  1SFO B;  1F2Y A;  3J80 L;  1TVX A;  1B50 A;  1AN8 A;  3NE5 B;  1Y1V B;  3T51 B;  4FF3 A;  1OXU A;  3M3Y B;  2L12 A;  2PCF B;  3PO3 B;  5E1F A;  3TBI B;  1U4R A;  3NHH A;  1TQO A;  1BUV T;  3SEB A;  2ID0 A;  3L7Z C;  2DNE A;  2AUK A;  1XXG A;  5EGT A;  2XNA C;  3A7A B;  3I91 A;  1WCM B;  1SE2 A;  1H9S B;  1TWC B;  1STE A;  2E75 C;  4DXG A;  5LHY 1;  2Z1C A;  3M4Y A;  3S2H B;  1HUM A;  3TDQ A;  3SE0 A;  3NP8 A;  1PFN A;  2A73 B;  2K01 A;  5JEA G;  3RD4 A;  4DK1 A;  1CFM A;  1GJX A;  2K04 A;  2ZXO A;  5IT9 E;  3A56 A;  5IOC A;  4DN4 M;  5JEA H;  1HFG A;  3BZD B;  4FF2 A;  4OHJ A;  5I9O A;  5C0X J;  3H3V C;  3EFX D;  1LTB D;  4CKC A;  3C2P A;  4KMU C;  3TSS A;  3OHX C;  3OOC A;  3C46 A;  2B2T C;  5CGK A;  1L0X B;  3DHQ A;  2SNM A;  4EQN A;  1TR5 A;  1GXD C;  1Z6H A;  3Q23 A;  2RDG A;  4BWG B;  1WVL A;  3PIO 3;  4IQZ A;  1V1P A;  3VR5 A;  2L5T A;  1HPC A;  4PV1 C;  4ZUI A;  1BQQ T;  2E2D C;  2F0G A;  3KK7 A;  4J8Q A;  5J1Z A;  5KGU A;  2F0E A;  2C9O A;  3O13 A;  3QWN A;  1FNU A;  4ZYS A;  1KNA A;  1C4Q A;  3T4A C;  2NVT B;  3HP3 A;  1V1O A;  2LKV A;  1EYD A;  4C3J B;  3S1R B;  1F9R A;  1EOT A;  2CW0 C;  4H7B A;  1GUG A;  1LO5 D;  2AWO A;  3SK4 A;  1ML0 D;  1MI2 A;  3RUZ A;  2WV6 D;  3R2T A;  4M1U B;  4C3I G;  3WOF A;  3LWU A;  3J7A V;  1CTM A;  1TS5 A;  4BY7 B;  1IL8 A;  2EYP A;  4IUU A;  3MHB A;  4WFN 3;  2IL8 A;  5CR3 A;  1F77 A;  2KED A;  5M3M B;  3BVG A;  5A2Q L;  2IW3 A;  1Q12 A;  5M9O A;  1O7Y A;  2F0U A;  1RKN A;  2K28 A;  2D9U A;  4RGN A;  5BN3 A;  2R7Z B;  5C44 B;  4A93 B;  2EJM A;  5KEE A;  4Z9C B;  4WRD A;  1STA A;  5I6Y A;  5DM6 3;  5JAV A;  3OSO A;  2ENB A;  1O7L A;  1JOO A;  3E0J A;  3NBH A;  4R9W A;  2EYM A;  1TY0 A;  3OWE B;  2VB3 X;  2K33 A;  3S16 B;  2EZV A;  5K36 H;  2WB1 B;  1JWM D;  1RD9 D;  4IFD J;  1U4M A;  2EDG A;  1CZG A;  5CYU A;  1ENF A;  3MXU A;  2K05 A;  5E4W C;  3VR2 A;  2A5H A;  4OO1 G;  3W3A A;  3BDC A;  2LMC B;  3SK6 A;  3S15 B;  4K5X A;  4HTH A;  4OO1 H;  3S1M B;  2CW0 D;  1LT3 D;  1TWG B;  1I4H A;  1A2U A;  4ZRZ A;  3D4W A;  3M4O B;  2SOB A;  5CV6 A;  3HOZ B;  1I4G A;  3HOW B;  1S5E D;  3PV0 A;  1Q3L A;  4LAA A;  1OXX K;  1QG7 A;  4ILW A;  1JOK A;  4DAY A;  2RDF A;  1XX8 A;  2I46 A;  1PRT D;  3K58 A;  2WAC A;  1SNO A;  2E76 C;  4CKE A;  2CHB D;  3QB3 A;  2NTS A;  4OIJ A;  1WD0 A;  2ZXR A;  2VXW A;  4RGO S;  3DMU A;  4KD4 A;  1F9P A;  5I2X A;  1OXS C;  4AYB B;  1K83 B;  3D31 A;  1HTP A;  2WP8 J;  1AP0 A;  5I9P A;  4DF7 A;  3K57 A;  5KND A;  4HR7 B;  1DCZ A;  1KAB A;  1QIL A;  4DAV A;  1SMY C;  5C3X A;  1HQM C;  1PZK D;  3U9O A;  1PMR A;  2F0I A;  1Y8P B;  3U9S A;  1A15 A;  1LTT D;  1YNJ C;  1STH A;  4XDX A;  1I6H B;  1DXM A;  2NN6 G;  4DK0 A;  3GTJ B;  2F0V A;  3FDT A;  2Q8I B;  1MD2 D;  2A69 C;  3X3N A;  2F4I A;  4C3H B;  3AMU A;  1ILQ A;  3GTP B;  4IUV A;  2C5C A;  5M5W B;  2JP1 A;  2ZXP A;  3FVQ A;  2NB0 A;  2EYO A;  5KNC A;  3GTG B;  5EBD A;  1B1Z A;  2NVX B;  3F2U A;  1VMC A;  2WAQ B;  1FR3 A;  5IIF A;  2EY5 A;  5JEA J;  1ET9 A;  4EQO A;  2MGS A;  1LT4 D;  4N9T A;  2NTT A;  2PYK A;  3OPO A;  1TS3 A;  3HOV B;  1FGB D;  2HDM A;  5E4X A;  4X3S A;  2QEJ C;  3RLF A;  5FOB B;  1MBY A;  1V8Q A;  3GD7 A;  3P7J A;  4KJN A;  2L9H A;  1EQV A;  1I50 B;  1D1I A;  4TKO B;  3FRP B;  2K6A A;  3S14 B;  4GZY C;  2R92 B;  5D65 A;  4HCE A;  4FP5 D;  3SVM A;  5KYI A;  1IYU A;  4IFD H;  1SMY D;  3PUY A;  5C5M A;  1SE4 A;  3HOU B;  4TQU S;  5M3F B;  5FK9 C;  3DWP A;  4F88 A;  3TP5 A;  1OXT A;  2K5D A;  1NCV A;  4J6H A;  1NR4 A;  2XWJ B;  2FFK B;  3OMG A;  4QUC A;  1YNJ D;  2BDN A;  4L6T B;  2HCI A;  1ONL A;  3J81 E;  4H13 C;  2F03 A;  1I4R A;  4BY1 B;  2KUM A;  2O4X A;  2XVS A;  3HZX A;  2EY6 A;  4HMI A;  4KHZ A;  4RKL A;  5FO8 B;  2E2J B;  1E2V A;  2A69 D;  4FF1 A;  1S5C D;  2G9D A;  1DYQ A;  4ZUJ A;  4HSP A;  3OW7 A;  4IFD I;  3S1N B;  2B2T A;  1O80 A;  2Z8L A;  1TS2 A;  5IGC A;  3KF8 A;  2EY2 A;  1QWY A;  4DAP A;  1ILP A;  5IGD A;  3I8Z A;  2DN8 A;  2KCC A;  1QNU A;  5KRU A;  4H44 C;  3T16 A;  1EY6 A;  2IX0 A;  4ZK9 B;  2B8F A;  4WOR A;  1EEF D;  4XQN A;  2B39 A;  1JOQ A;  5CBA E;  1VF5 C;  4DXF A;  2L1B A;  1DZ1 A;  2A6E C;  1F2M A;  2K1B A;  4X3K A;  1L0Y B;  1Q1B A;  1LAC A;  5CV8 A;  4TSS A;  1EQT A;  3IFD A;  3E5S A;  3BVM A;  1TWF B;  1ZXT A;  4BS9 A;  1ESF A;  1RCV D;  3IAY A;  1SAP A;  2TSS A;  1IKL A;  2A74 C;  1AZP A;  2FMC A;  3JAM L;  3MXP A;  3RZD B;  1DOL A;  1SNP A;  3NWS A;  4DNR B;  1NR2 A;  1R4P B;  2DNC A;  1SSO A;  3PO2 B;  1D6E C;  3K59 A;  1EFI D;  3TZU A;  1PRT F;  3TME A;  3D4D A;  1ESR A;  2B2V C;  2VUM B;  4KK7 A;  2TMP A;  2QKI C;  3G6J B;  1LTG D;  3NWT A;  2F3V A;  3MA2 B;  2B2U C;  1B44 D;  1RF2 D;  1QE6 A;  5DAU A;  1BO0 A;  1FNV A;  4OL7 A;  3CU7 A;  1JC7 A;  3R3O A;  5BN5 A;  1SNM A;  3H91 A;  1HRJ A;  3FPP A;  3BS1 A;  2BOS A;  3I4L A;  4RAU C;  2JXM B;  4NW2 A;  1LAB A;  1Q1E A;  2K32 A;  1SYC A;  2RSO A;  2CQA A;  3LWE A;  2WKD A;  2F0T A;  2WKC A;  2BA0 A;  2ICE C;  1KLG D;  2E2I B;  2A6E D;  2ZT9 C;  4BA2 I;  2IX3 A;  1SXT A;  4CJ1 B;  5CC4 A;  4Y7N B;  4RHS A;  3Q22 A;  2PW7 A;  3K7A B;  1A3T A;  3A7L A;  3AB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...