1GA3A

Nmr structure of interleukin-13
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
b'GGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-13
publication title Solution structure of interleukin-13 and insights into receptor engagement
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 21
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2000-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1ga3A00
5E4EA 1F6FA 1BUYA 1Z7CA 1V7MV 3N06A 5D70A 1HIJA 1M4BA 1Y6ML 1EVSA 3EW3A 4O6KA 1D9CA 1PVHB 1EKUA 1HWHA 3DGCL 3QB1A 5D28B 1D9GA 2Q98A 3D85C 1M47A 1Y6NL 2B90A 3QAZA 4PS4A 1SCFA 5C7XA 4ZF7A 1M4CA 1KF9A 1M4RA 3NCFA 1ILKA 2D9QA 1YKBA 1IL6A 1J7VL 2ERJD 3QT2C 2O27A 3D87A 4X51A 4J4LC 5D72A 3QB7A 1HULA 3L5WI 1M48A 3Q1SI 1IK0A 1BGEA 1IJZA 2HYMB 3NCCA 5FHXA 1PW6A 1EXZA 5D71A 3NCBA 3SE3B 1QVNA 4NI7A 1LQSL 1ALUA 2INTA 1RW5A 1IRLA 3EJJA 1I1RB 4ZS7A 3HHRA 1N1FA 3DLQI 3SE4B 3B5KA 3UEZE 2O26A 2GMFA 3HMXB 1CD9A 3MZGA 3LB6B 3BPLA 3LB6A 2E9WC 3VA2A 1CNT1 4GRWA 2B8XA 2L3OA 2B8UA 4YQXA 1VLKA 1A22A 1AU1A 2CYKA 3QWRB 1B5LA 1HZIA 4NEJA 1EERA 1RFBA 4WRLB 1AX8A 1LK3A 4RS1A 3G6DA 3PIVA 2LMSA 1ITMA 1LKIA 1JLIA 1V7NV 3UF2A 2IL6A 1Z92A 3INKC 1HUWA 4YUEC 1GA3A 1ITIA 1PY2A 4NI9A 1CSGA 1INRA 1NBPA 1PGRA 5FUCA 2Q7NB 4I77Z 3N0PA 1ITLA 1M49A 1IARA 4MHLA 1EMRA 2B91A 3BPNA 2ILKA 3UF5A 4DOHA 1HWGA 5L6YC 5KNHI 1M4AA 1WU3I 1BP3A 3DUHC 1RHGA 4O9HA 5LQBA 4CNIC 1ETEA 4NKQC 2B8YA 2LAGA 1BGDA 4YDYI 3L5XA 1Y6KL 1GNCA 3UX9A 4FA8E 1CN4C 1A7MA 2L3YA 3BESL 1HIKA 3WCYI 1BBNA 3PIWA 3D48P 4YPGC 1ITFA 2D48A 1BCNA 1CYLA 5D22A 3S9DA 1FG9A 2KZ1A 2B5IA 3NCEA 4NEMA 2B8ZA 1BGCA 1RCBA 3BPOA 3G9VB 1P9MB 1F45B 1HGUA 1AXIA 2H24A 3OQ3A 4Z5RD 1FYHA 3NPZA
chains in the Genus database with same CATH superfamily
4IKWA 1F6FA 1V7MV 3N06A 1HIJA 5C3ED 3DGCL 4XNIA 2OQPA 5C7XA 4PS4A 4ZF7A 1ILKA 4JREA 3D87A 5D72A 1HULA 5D6KA 5IYDD 3H3VE 4TPJA 2Z3QA 4U4VA 1IRLA 1Y1VD 4BY1D 2O26A 4U4TA 4ZWCA 3MZGA 3HOWD 5A2OA 3LB6A 4TPHA 4GRWA 2L3OA 4YQXA 2CYKA 1B5LA 1HZIA 3PIVA 4LRLA 5D59A 3O7QA 2IL6A 4PYPA 1HUWA 1CSGA 4I77Z 4ZWBA 1HWGA 4QIQA 2R93D 1ETEA 2B8YA 1Y6KL 5EQIA 2V8NA 5D58A 1GNCA 2R92D 1CN4C 1HIKA 3D48P 4NN7A 2KZ1A 4XNJA 1BGCA 1RCBA 1F45B 3OQ3A 4Z5RD 4YB9D 4D2DA 5E4EA 2Q14A 1Y6ML 3EW3A 5D28B 1D9CA 1PVHB 1D9GA 2Q98A 3D85C 1Y6NL 2B90A 3H0GD 1KF9A 1M4RA 4IKXA 2O27A 3L5WI 1IK0A 4DKFA 5D71A 4IU8A 1QVNA 4D2BA 2R7ZD 1ALUA 2INTA 3EJJA 2JA8D 1I1RB 2GMFA 4A3ID 3HMXB 1CD9A 3LB6B 3BPLA 3VA2A 4W6VA 4ZYRA 2JA6D 1VLKA 1A22A 3QWRB 1EERA 1RFBA 1AX8A 4JR9A 1LK3A 5C44D 2Z3RA 2LMSA 4A3LD 3INKC 1PV7A 4YUEC 1ITIA 1PY2A 4NI9A 1INRA 3N0PA 4EXNA 1ITLA 1IARA 3AYHA 4MHLA 4DOHA 3BPNA 1M4AA 1WU3I 3DUHC 1RHGA 4O9HA 2LAGA 4IKZA 4FA8E 4IU9A 2VUMD 3O7PA 2JA7D 1BBNA 1ITFA 2PSMA 2D48A 3TGXB 4NN6A 3PO3D 1Y1WD 4A3CD 4NN5A 2B8ZA 3BPOA 3HOYD 4IKVA 4GC0A 1FYHA 3NPZA 4A3ED 4EXPA 4UVMA 1M4BA 1EVSA 1PV6A 2CFQA 1M47A 3NCFA 4JA3A 2D9QA 4YBQA 1YKBA 4U4WA 1J7VL 2ERJD 4X51A 4J4LC 3QB7A 5IYBD 3OG4A 4A3KD 3NCCA 3HOUD 5FHXA 4LEPA 1PW6A 1EXZA 4OAAA 3NCBA 3SE3B 1RW5A 4OH3A 1N1FA 3UEZE 3SE4B 5IP7D 4D2CA 1CNT1 2B8XA 2B8UA 4NEJA 4DKCA 4WRLB 5C65A 3G6DA 3WDOA 5GXBA 4J05A 1LKIA 3UF2A 1GA3A 3HOVD 1PGRA 5TS9A 3I4ND 2Q7NB 5A2NA 1EMRA 3UF5A 5KNHI 1BP3A 4CNIC 3PO2D 4NKQC 4A3GD 2XQBA 3UX9A 3HOZD 1A7MA 2L3YA 2CFPA 3HHCA 1CYLA 5D22A 3S9DA 1FG9A 4A3FD 5EQHA 2B5IA 4NEMA 3DI2A 4BBRD 1HGUA 1AXIA 2H24A 3DI3A 1BUYA 1Z7CA 5D70A 4O6KA 4GBZA 3QB1A 1EKUA 1HWHA 3QAZA 1SCFA 1M4CA 4GS7A 1IL6A 3QT2C 3Q1SI 1M48A 1BGEA 1IJZA 2HYMB 2C35A 4GBYA 3IRHA 4IKYA 4A3BD 4NI7A 5IYCD 1LQSL 2Y5YA 4BY7D 4TPGA 2B63D 4ZS7A 3HHRA 5IP9D 5FLMD 3DLQI 3B5KA 4Q65A 2E9WC 2XUTA 1AU1A 4ZW9A 1WCMD 4RS1A 1Y14A 1ITMA 3HOXD 1V7NV 1JLIA 1Z92A 4BXXD 4A3MD 1NBPA 5FUCA 3I4MD 1M49A 2B91A 2ILKA 5L6YC 4LDSA 4A3JD 4APSA 1PW4A 5LQBA 1BGDA 2JA5D 4YDYI 4A3DD 3L5XA 3OG6A 4BBSD 4A93D 3FKID 3BESL 3WCYI 4YPGC 3PIWA 5EQGA 1BCNA 4DKEA 5C4XD 3NCEA 4DKDA 2O6IA 3G9VB 1P9MB
chains in the Genus database with same CATH topology
4EXPA 5E4EA 1F6FA 1BUYA 1Z7CA 1V7MV 3N06A 5D70A 2Q14A 1HIJA 1M4BA 1Y6ML 1EVSA 3EW3A 4O6KA 1D9CA 1PVHB 1EKUA 1HWHA 3DGCL 3QB1A 2OQPA 1D9GA 2Q98A 3D85C 1M47A 1Y6NL 2B90A 3QAZA 3H0GD 1SCFA 4PS4A 5C7XA 4ZF7A 1M4CA 1KF9A 1M4RA 3NCFA 4GS7A 1ILKA 2D9QA 1YKBA 1IL6A 1J7VL 2ERJD 3QT2C 2O27A 3D87A 4X51A 4J4LC 5D72A 3QB7A 1HULA 3L5WI 1M48A 3Q1SI 1IK0A 1BGEA 5D28B 5IYBD 3OG4A 1IJZA 2HYMB 5IYDD 4A3KD 3NCCA 3HOUD 2C35A 5FHXA 4DKFA 3H3VE 1PW6A 1EXZA 5D71A 2Z3QA 3NCBA 3SE3B 3IRHA 1QVNA 2R7ZD 4A3BD 4NI7A 5IYCD 1LQSL 1ALUA 2INTA 1RW5A 1IRLA 3EJJA 4BY7D 2B63D 2JA8D 1I1RB 4ZS7A 3HHRA 5IP9D 1Y1VD 5FLMD 1N1FA 4BY1D 3DLQI 3SE4B 3B5KA 3UEZE 2O26A 2GMFA 4A3ID 3HMXB 1CD9A 3MZGA 5IP7D 5C3ED 3LB6B 3HOWD 3BPLA 3LB6A 2E9WC 3VA2A 2JA6D 1CNT1 4GRWA 2B8XA 2L3OA 2B8UA 4YQXA 1VLKA 1A22A 1AU1A 2CYKA 3QWRB 1B5LA 1HZIA 1WCMD 4NEJA 4DKCA 1EERA 1RFBA 4WRLB 1AX8A 1LK3A 4RS1A 5C44D 1Y14A 2Z3RA 3G6DA 3PIVA 2LMSA 4A3LD 1ITMA 3HOXD 4LRLA 1LKIA 1JLIA 1V7NV 3UF2A 2IL6A 1Z92A 3INKC 1HUWA 4YUEC 1GA3A 3HOVD 1ITIA 1PY2A 4BXXD 4NI9A 4A3MD 1CSGA 1INRA 1NBPA 1PGRA 5FUCA 5TS9A 2Q7NB 3I4MD 3I4ND 4I77Z 3N0PA 4EXNA 1ITLA 1M49A 1IARA 3AYHA 4MHLA 1EMRA 2B91A 3BPNA 2ILKA 3UF5A 4DOHA 1HWGA 5L6YC 4A3JD 5KNHI 1M4AA 1WU3I 1BP3A 3DUHC 1RHGA 4O9HA 2R93D 5LQBA 4CNIC 3PO2D 1ETEA 4NKQC 2B8YA 2LAGA 1BGDA 2JA5D 4A3GD 4YDYI 4A3DD 2XQBA 1Y6KL 3L5XA 1GNCA 3OG6A 3UX9A 4FA8E 2R92D 3HOZD 1CN4C 4BBSD 4A93D 3FKID 2VUMD 1A7MA 2L3YA 3BESL 1HIKA 3WCYI 2JA7D 1BBNA 3PIWA 3D48P 4YPGC 1ITFA 2PSMA 2D48A 3HHCA 1BCNA 3TGXB 4NN6A 4DKEA 5D22A 3S9DA 5C4XD 3PO3D 1FG9A 4NN7A 1CYLA 4A3FD 1Y1WD 2KZ1A 4A3CD 2B5IA 4NN5A 3NCEA 4NEMA 2B8ZA 1BGCA 1RCBA 3BPOA 3DI2A 2O6IA 4DKDA 3G9VB 3HOYD 1P9MB 1F45B 4BBRD 1HGUA 1AXIA 2H24A 3OQ3A 4Z5RD 3DI3A 1FYHA 3NPZA 4A3ED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E4E A;  1F6F A;  1BUY A;  1Z7C A;  1V7M V;  3N06 A;  5D70 A;  1HIJ A;  1M4B A;  1Y6M L;  1EVS A;  3EW3 A;  4O6K A;  1D9C A;  1PVH B;  1EKU A;  1HWH A;  3DGC L;  3QB1 A;  5D28 B;  1D9G A;  2Q98 A;  3D85 C;  1M47 A;  1Y6N L;  2B90 A;  3QAZ A;  4PS4 A;  1SCF A;  5C7X A;  4ZF7 A;  1M4C A;  1KF9 A;  1M4R A;  3NCF A;  1ILK A;  2D9Q A;  1YKB A;  1IL6 A;  1J7V L;  2ERJ D;  3QT2 C;  2O27 A;  3D87 A;  4X51 A;  4J4L C;  5D72 A;  3QB7 A;  1HUL A;  3L5W I;  1M48 A;  3Q1S I;  1IK0 A;  1BGE A;  1IJZ A;  2HYM B;  3NCC A;  5FHX A;  1PW6 A;  1EXZ A;  5D71 A;  3NCB A;  3SE3 B;  1QVN A;  4NI7 A;  1LQS L;  1ALU A;  2INT A;  1RW5 A;  1IRL A;  3EJJ A;  1I1R B;  4ZS7 A;  3HHR A;  1N1F A;  3DLQ I;  3SE4 B;  3B5K A;  3UEZ E;  2O26 A;  2GMF A;  3HMX B;  1CD9 A;  3MZG A;  3LB6 B;  3BPL A;  3LB6 A;  2E9W C;  3VA2 A;  1CNT 1;  4GRW A;  2B8X A;  2L3O A;  2B8U A;  4YQX A;  1VLK A;  1A22 A;  1AU1 A;  2CYK A;  3QWR B;  1B5L A;  1HZI A;  4NEJ A;  1EER A;  1RFB A;  4WRL B;  1AX8 A;  1LK3 A;  4RS1 A;  3G6D A;  3PIV A;  2LMS A;  1ITM A;  1LKI A;  1JLI A;  1V7N V;  3UF2 A;  2IL6 A;  1Z92 A;  3INK C;  1HUW A;  4YUE C;  1GA3 A;  1ITI A;  1PY2 A;  4NI9 A;  1CSG A;  1INR A;  1NBP A;  1PGR A;  5FUC A;  2Q7N B;  4I77 Z;  3N0P A;  1ITL A;  1M49 A;  1IAR A;  4MHL A;  1EMR A;  2B91 A;  3BPN A;  2ILK A;  3UF5 A;  4DOH A;  1HWG A;  5L6Y C;  5KNH I;  1M4A A;  1WU3 I;  1BP3 A;  3DUH C;  1RHG A;  4O9H A;  5LQB A;  4CNI C;  1ETE A;  4NKQ C;  2B8Y A;  2LAG A;  1BGD A;  4YDY I;  3L5X A;  1Y6K L;  1GNC A;  3UX9 A;  4FA8 E;  1CN4 C;  1A7M A;  2L3Y A;  3BES L;  1HIK A;  3WCY I;  1BBN A;  3PIW A;  3D48 P;  4YPG C;  1ITF A;  2D48 A;  1BCN A;  1CYL A;  5D22 A;  3S9D A;  1FG9 A;  2KZ1 A;  2B5I A;  3NCE A;  4NEM A;  2B8Z A;  1BGC A;  1RCB A;  3BPO A;  3G9V B;  1P9M B;  1F45 B;  1HGU A;  1AXI A;  2H24 A;  3OQ3 A;  4Z5R D;  1FYH A;  3NPZ A; 
#chains in the Genus database with same CATH topology
 4IKW A;  1F6F A;  1V7M V;  3N06 A;  1HIJ A;  5C3E D;  3DGC L;  4XNI A;  2OQP A;  5C7X A;  4PS4 A;  4ZF7 A;  1ILK A;  4JRE A;  3D87 A;  5D72 A;  1HUL A;  5D6K A;  5IYD D;  3H3V E;  4TPJ A;  2Z3Q A;  4U4V A;  1IRL A;  1Y1V D;  4BY1 D;  2O26 A;  4U4T A;  4ZWC A;  3MZG A;  3HOW D;  5A2O A;  3LB6 A;  4TPH A;  4GRW A;  2L3O A;  4YQX A;  2CYK A;  1B5L A;  1HZI A;  3PIV A;  4LRL A;  5D59 A;  3O7Q A;  2IL6 A;  4PYP A;  1HUW A;  1CSG A;  4I77 Z;  4ZWB A;  1HWG A;  4QIQ A;  2R93 D;  1ETE A;  2B8Y A;  1Y6K L;  5EQI A;  2V8N A;  5D58 A;  1GNC A;  2R92 D;  1CN4 C;  1HIK A;  3D48 P;  4NN7 A;  2KZ1 A;  4XNJ A;  1BGC A;  1RCB A;  1F45 B;  3OQ3 A;  4Z5R D;  4YB9 D;  4D2D A;  5E4E A;  2Q14 A;  1Y6M L;  3EW3 A;  5D28 B;  1D9C A;  1PVH B;  1D9G A;  2Q98 A;  3D85 C;  1Y6N L;  2B90 A;  3H0G D;  1KF9 A;  1M4R A;  4IKX A;  2O27 A;  3L5W I;  1IK0 A;  4DKF A;  5D71 A;  4IU8 A;  1QVN A;  4D2B A;  2R7Z D;  1ALU A;  2INT A;  3EJJ A;  2JA8 D;  1I1R B;  2GMF A;  4A3I D;  3HMX B;  1CD9 A;  3LB6 B;  3BPL A;  3VA2 A;  4W6V A;  4ZYR A;  2JA6 D;  1VLK A;  1A22 A;  3QWR B;  1EER A;  1RFB A;  1AX8 A;  4JR9 A;  1LK3 A;  5C44 D;  2Z3R A;  2LMS A;  4A3L D;  3INK C;  1PV7 A;  4YUE C;  1ITI A;  1PY2 A;  4NI9 A;  1INR A;  3N0P A;  4EXN A;  1ITL A;  1IAR A;  3AYH A;  4MHL A;  4DOH A;  3BPN A;  1M4A A;  1WU3 I;  3DUH C;  1RHG A;  4O9H A;  2LAG A;  4IKZ A;  4FA8 E;  4IU9 A;  2VUM D;  3O7P A;  2JA7 D;  1BBN A;  1ITF A;  2PSM A;  2D48 A;  3TGX B;  4NN6 A;  3PO3 D;  1Y1W D;  4A3C D;  4NN5 A;  2B8Z A;  3BPO A;  3HOY D;  4IKV A;  4GC0 A;  1FYH A;  3NPZ A;  4A3E D;  4EXP A;  4UVM A;  1M4B A;  1EVS A;  1PV6 A;  2CFQ A;  1M47 A;  3NCF A;  4JA3 A;  2D9Q A;  4YBQ A;  1YKB A;  4U4W A;  1J7V L;  2ERJ D;  4X51 A;  4J4L C;  3QB7 A;  5IYB D;  3OG4 A;  4A3K D;  3NCC A;  3HOU D;  5FHX A;  4LEP A;  1PW6 A;  1EXZ A;  4OAA A;  3NCB A;  3SE3 B;  1RW5 A;  4OH3 A;  1N1F A;  3UEZ E;  3SE4 B;  5IP7 D;  4D2C A;  1CNT 1;  2B8X A;  2B8U A;  4NEJ A;  4DKC A;  4WRL B;  5C65 A;  3G6D A;  3WDO A;  5GXB A;  4J05 A;  1LKI A;  3UF2 A;  1GA3 A;  3HOV D;  1PGR A;  5TS9 A;  3I4N D;  2Q7N B;  5A2N A;  1EMR A;  3UF5 A;  5KNH I;  1BP3 A;  4CNI C;  3PO2 D;  4NKQ C;  4A3G D;  2XQB A;  3UX9 A;  3HOZ D;  1A7M A;  2L3Y A;  2CFP A;  3HHC A;  1CYL A;  5D22 A;  3S9D A;  1FG9 A;  4A3F D;  5EQH A;  2B5I A;  4NEM A;  3DI2 A;  4BBR D;  1HGU A;  1AXI A;  2H24 A;  3DI3 A;  1BUY A;  1Z7C A;  5D70 A;  4O6K A;  4GBZ A;  3QB1 A;  1EKU A;  1HWH A;  3QAZ A;  1SCF A;  1M4C A;  4GS7 A;  1IL6 A;  3QT2 C;  3Q1S I;  1M48 A;  1BGE A;  1IJZ A;  2HYM B;  2C35 A;  4GBY A;  3IRH A;  4IKY A;  4A3B D;  4NI7 A;  5IYC D;  1LQS L;  2Y5Y A;  4BY7 D;  4TPG A;  2B63 D;  4ZS7 A;  3HHR A;  5IP9 D;  5FLM D;  3DLQ I;  3B5K A;  4Q65 A;  2E9W C;  2XUT A;  1AU1 A;  4ZW9 A;  1WCM D;  4RS1 A;  1Y14 A;  1ITM A;  3HOX D;  1V7N V;  1JLI A;  1Z92 A;  4BXX D;  4A3M D;  1NBP A;  5FUC A;  3I4M D;  1M49 A;  2B91 A;  2ILK A;  5L6Y C;  4LDS A;  4A3J D;  4APS A;  1PW4 A;  5LQB A;  1BGD A;  2JA5 D;  4YDY I;  4A3D D;  3L5X A;  3OG6 A;  4BBS D;  4A93 D;  3FKI D;  3BES L;  3WCY I;  4YPG C;  3PIW A;  5EQG A;  1BCN A;  4DKE A;  5C4X D;  3NCE A;  4DKD A;  2O6I A;  3G9V B;  1P9M B; 
#chains in the Genus database with same CATH homology
 4EXP A;  5E4E A;  1F6F A;  1BUY A;  1Z7C A;  1V7M V;  3N06 A;  5D70 A;  2Q14 A;  1HIJ A;  1M4B A;  1Y6M L;  1EVS A;  3EW3 A;  4O6K A;  1D9C A;  1PVH B;  1EKU A;  1HWH A;  3DGC L;  3QB1 A;  2OQP A;  1D9G A;  2Q98 A;  3D85 C;  1M47 A;  1Y6N L;  2B90 A;  3QAZ A;  3H0G D;  1SCF A;  4PS4 A;  5C7X A;  4ZF7 A;  1M4C A;  1KF9 A;  1M4R A;  3NCF A;  4GS7 A;  1ILK A;  2D9Q A;  1YKB A;  1IL6 A;  1J7V L;  2ERJ D;  3QT2 C;  2O27 A;  3D87 A;  4X51 A;  4J4L C;  5D72 A;  3QB7 A;  1HUL A;  3L5W I;  1M48 A;  3Q1S I;  1IK0 A;  1BGE A;  5D28 B;  5IYB D;  3OG4 A;  1IJZ A;  2HYM B;  5IYD D;  4A3K D;  3NCC A;  3HOU D;  2C35 A;  5FHX A;  4DKF A;  3H3V E;  1PW6 A;  1EXZ A;  5D71 A;  2Z3Q A;  3NCB A;  3SE3 B;  3IRH A;  1QVN A;  2R7Z D;  4A3B D;  4NI7 A;  5IYC D;  1LQS L;  1ALU A;  2INT A;  1RW5 A;  1IRL A;  3EJJ A;  4BY7 D;  2B63 D;  2JA8 D;  1I1R B;  4ZS7 A;  3HHR A;  5IP9 D;  1Y1V D;  5FLM D;  1N1F A;  4BY1 D;  3DLQ I;  3SE4 B;  3B5K A;  3UEZ E;  2O26 A;  2GMF A;  4A3I D;  3HMX B;  1CD9 A;  3MZG A;  5IP7 D;  5C3E D;  3LB6 B;  3HOW D;  3BPL A;  3LB6 A;  2E9W C;  3VA2 A;  2JA6 D;  1CNT 1;  4GRW A;  2B8X A;  2L3O A;  2B8U A;  4YQX A;  1VLK A;  1A22 A;  1AU1 A;  2CYK A;  3QWR B;  1B5L A;  1HZI A;  1WCM D;  4NEJ A;  4DKC A;  1EER A;  1RFB A;  4WRL B;  1AX8 A;  1LK3 A;  4RS1 A;  5C44 D;  1Y14 A;  2Z3R A;  3G6D A;  3PIV A;  2LMS A;  4A3L D;  1ITM A;  3HOX D;  4LRL A;  1LKI A;  1JLI A;  1V7N V;  3UF2 A;  2IL6 A;  1Z92 A;  3INK C;  1HUW A;  4YUE C;  1GA3 A;  3HOV D;  1ITI A;  1PY2 A;  4BXX D;  4NI9 A;  4A3M D;  1CSG A;  1INR A;  1NBP A;  1PGR A;  5FUC A;  5TS9 A;  2Q7N B;  3I4M D;  3I4N D;  4I77 Z;  3N0P A;  4EXN A;  1ITL A;  1M49 A;  1IAR A;  3AYH A;  4MHL A;  1EMR A;  2B91 A;  3BPN A;  2ILK A;  3UF5 A;  4DOH A;  1HWG A;  5L6Y C;  4A3J D;  5KNH I;  1M4A A;  1WU3 I;  1BP3 A;  3DUH C;  1RHG A;  4O9H A;  2R93 D;  5LQB A;  4CNI C;  3PO2 D;  1ETE A;  4NKQ C;  2B8Y A;  2LAG A;  1BGD A;  2JA5 D;  4A3G D;  4YDY I;  4A3D D;  2XQB A;  1Y6K L;  3L5X A;  1GNC A;  3OG6 A;  3UX9 A;  4FA8 E;  2R92 D;  3HOZ D;  1CN4 C;  4BBS D;  4A93 D;  3FKI D;  2VUM D;  1A7M A;  2L3Y A;  3BES L;  1HIK A;  3WCY I;  2JA7 D;  1BBN A;  3PIW A;  3D48 P;  4YPG C;  1ITF A;  2PSM A;  2D48 A;  3HHC A;  1BCN A;  3TGX B;  4NN6 A;  4DKE A;  5D22 A;  3S9D A;  5C4X D;  3PO3 D;  1FG9 A;  4NN7 A;  1CYL A;  4A3F D;  1Y1W D;  2KZ1 A;  4A3C D;  2B5I A;  4NN5 A;  3NCE A;  4NEM A;  2B8Z A;  1BGC A;  1RCB A;  3BPO A;  3DI2 A;  2O6I A;  4DKD A;  3G9V B;  3HOY D;  1P9M B;  1F45 B;  4BBR D;  1HGU A;  1AXI A;  2H24 A;  3OQ3 A;  4Z5R D;  3DI3 A;  1FYH A;  3NPZ A;  4A3E D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...