1GB1A

A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein G.
pubmed rcsb
source organism Streptomyces griseus
molecule tags Immunoglobulin binding protein
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gb1A00
2JSVX 1UWXA 1MVKA 2LHDA 4HKZE 2RMMA 2LHEA 3FILB 1EM7A 1K53A 4HJGE 1XCQL 2N9LA 1YNTE 1PGXA 1MHHE 1MPEA 2NMQA 4OZBA 2LUMA 2IGGA 4WH4A 2K0PA 1JMLA 1IBXB 2I2YA 3UI3A 2KWDA 1HZ6A 2LGIA 1XCTL 2ZW1A 2OEDA 5HI1A 1KH0A 1F2RC 1K52A 2ONQA 4KGRA 1FCCC 3MP9A 2QSDA 2PTLA 4GLSC 2IGHA 4D2KA 1K50A 2RPVA 1P7FA 4IOIE 3FILA 1GB4A 2QMTA 2I38A 2PW9A 1K51A 2JU6X 2ZW0A 1IGCA 1QKZA 5JXVA 1HZ5A 1HEZE 1MHXA 5BMIA 1MI0A 5BMGA 5HFYA 2KN4A 1F2RI 2JWUA 5BMHA 1FD6A 1IBXA 1D4BA 4KGTA 1FCLA 2JZPA 2KACA 2N7JA 2JXTA 2PLPA 1XF5L 4KGSA 4OZAA 2KDMA 2J52A 2N9KA 5HHDG 2EELA 2J53A 1C9FA 1YMHE 2IGDA 2KQ4X 3V3XA 1ZXHA 2ON8A 2GB1A 1Q10A 4OZCA 1GB1A 3GB1A 2GI9A 5HG2A 1P7EA 1PGAA 4IKGA 4MACA 1IGDA 1PGBA
chains in the Genus database with same CATH superfamily
4IWOA 2QC8A 2R2OA 1XLQA 3BK2A 3BVMA 4W9IA 4HKZE 3MC9A 1GPXA 3P42A 1XT9B 1YD8U 3PS6A 4AS1A 3V62A 2NVUI 2UYZB 1WGGA 1IBXB 3OWEB 5FR6A 1XQQA 2LVQA 2LI5A 3NS8A 2KFKA 2DAJA 1UGMA 2BQQA 4NAMA 1RM6C 3UF8A 3A33B 3AE5B 2MBEA 2W9NA 3O13A 2KT7A 2JY6A 2K1FA 2XNAC 1PFDA 4FJVB 2IGHA 3EFUA 3ETRA 3L13A 3QC8B 2O2VB 3AU4A 3DCGA 3RD2A 2YEPF 2XEWA 3AE9B 2BB6A 4MSMB 1MJDA 2K25A 2ZEQA 4DXFA 1I4PA 4ARCA 3R7QA 1ZPSA 4FA6A 1CZPA 3SFEB 1I4HA 5GXGB 1WXAA 2ZPNA 4N6EB 1E8XA 2M56B 1P3QU 2KACA 1ZOYB 2CU1A 2PLPA 4K7SA 2KMMA 4HVBA 3H1UA 3MJ5A 2N9KA 3IAM1 1WZ3A 1CJEA 1TY2A 3Q14C 1ENFA 5AEKB 2JVCA 4N59A 1ZW7A 2SEBD 3QX1A 3AEBB 3LXFA 2KTRB 4BBNF 3A1QB 2AWTA 4IKGA 3VFKA 3GZNB 2K9XA 3RNCC 3NZUA 4RGMA 4I6NB 1UWXA 1MVKA 3ZUNA 1MG8A 4ZYNA 5IOIA 2ZCBA 2JXXA 1KLUD 3H9DA 2CJNA 2I1KA 5DPTA 2WXKA 4FJZA 3TEZA 1MHHE 2NTTA 2AQ2B 1HZ6A 2KC2A 4LNKA 3RNAC 4KKIA 5G5GA 2M19A 4LDTB 1FRRA 2KVRA 2O6VA 2WU5B 2GBMA 4A8XC 3VH3B 1DGJA 3AE3B 3Q8BA 1JRUA 4JE3B 1QOGA 2KMAA 3AE8B 1UELA 2WS3B 4NPNA 1S3SG 2MBHA 3ZO5B 1N5WA 4AWJA 1K50A 5L95C 3ZLZA 4IOIE 2TSSA 4WJOA 2RPQA 2G1EA 1F0ZA 2KLCA 1QKZA 1XO3A 2WHIA 2DAFA 4KX6B 1F2RI 3SD5A 3TEYA 2QIEB 4K1RB 4CYEA 1FXAA 2INNE 3FC4A 1XF5L 3HRDD 5E6NA 2SAKA 2ZZPB 3NY5A 1KTKA 5DPSA 3RUIB 2DYOA 2GBRA 1TKYA 3TL5A 4WJPA 4NJCA 2KOXA 2G4SA 3HHMA 3GB1A 1R4MI 3PHWB 3FKYA 1EUVB 1P7EA 1PGAA 3QARA 5AZGA 4AOFA 2NBWB 3Q2AC 5LXIB 2JSVX 2KAJA 2HE7A 2MBOA 2KLGA 3QWZB 1ISNA 2Y5PA 1YN5A 3H6NA 1QOFA 1TS2A 1WXQA 3DBLB 2K0PA 2BS3B 2GOWA 2C7MB 4KVGB 4I6PA 3RFZB 2WXIA 2L00B 1F77A 1EWCA 1V5TA 1V81A 1H8CA 1C79A 2KHWB 3K9OB 1KJTA 5I4DA 3W1SC 3P1MA 3DWGC 2M4NA 3RZWC 2FUHB 1FCCC 1V1PB 1V80A 3IXSA 1LXDA 3TIXA 2K5PA 4LNNA 2INCC 3GE8C 5CHVC 2KK8A 2JF5A 1OTRB 4A90A 1HQRD 2PW9A 3M63B 4PT5A 1WJNA 4RF0A 3NVWA 1N60A 4TUUA 1FRDA 1V2YA 4NAWA 2BVCA 1GUAB 4HPMB 1HE8A 1OEYJ 2M17A 1CK1A 4GDLB 2YLMA 1TZOA 2KX0A 4WWNA 1WSPA 3B08A 2L1AA 4BKTA 3Q3NC 3PZDA 3AM9A 4OVUA 1STEA 4ZYSA 4HPLB 2RDGA 3IG3A 3GE3C 1TY0A 2EKEC 2G4DB 3PO0A 2KJHB 3AU5A 2V3NA 4G11A 2FIFA 2QILA 4WAFA 2NTSA 4YWGG 1JMLA 4MGZE 1N62A 2W55A 3I3TB 5AUIA 2OOBB 4HDOA 2WXJA 4OVZA 4GOCA 3EGRA 3KLSX 4AQ7A 3ZJVA 4JPSA 3ZTDA 1WXSA 3MFGA 1TBEA 4ITKA 2CKHB 1V86A 3KYCD 3QIJA 4CQNA 2L8JA 5JHBA 1XLOA 2N7EA 3L10B 2OHFA 3V05A 4W9FA 4KKJA 2PTLA 2IO1B 1DOXA 1XLNA 3A9KA 1B1ZA 4FBJB 1SE9A 2JU6X 1ZUD2 4WJNA 1TS4A 2INDC 1HTQA 1TTNA 1WF9A 4RFBA 2IO0B 1ZP0B 5EE3A 5IO9A 4H2AA 3IHPC 3ENEA 1SF0A 3HIZA 1MG4A 4BOZB 3ZNHB 3UIOB 1OQRA 2KDMA 3Q8FA 2EELA 2MH7A 2V3SA 5LLIA 3SU8X 3GS2A 1TS5A 4C80A 2V9HA 1I42A 3P4QB 1I35A 4OZCA 2D2QA 3NOBA 3ZKJC 1GG3A 3OG5A 1EU4A 2BYVE 1SEBD 2YVCA 4LDTD 3H7SA 4ZRJA 4WWPA 3ZNGC 1SE3A 4BKGA 1WR6E 3IT4B 4XWWA 3KH0A 1RRBA 4QAYA 4PYUA 3V6CB 2ZVOA 4G3XB 2LGXA 4B6WA 3AULA 2D10A 3DBHB 1FXTB 1OQQA 2GBJA 4WQOB 4OZBA 2AX5A 4YT0B 3EC8A 1QILA 4KZCA 1FEHA 3MJWA 3DDCB 5DPWA 1WXMA 4PK1A 1WIAA 1VZ8A 4GDKB 3PPAA 4Q2JA 3PSEB 3NVVA 1OQYA 1XCTL 1SXTA 1UBQA 2KQ7A 3RYTA 1V9JA 2QHOA 2MQJA 3WIMA 2LEKA 1J19A 1I7HA 3R2TA 2D11A 2KDIA 3OAWA 1KLVA 2MX2A 1WX9A 4XX5A 1BT0A 4JQWC 4K7WA 2K6QA 4MM3A 4D2KA 1I4QA 3QJZA 4MEMA 2C5LC 3JSVA 4AUQC 3ZGZA 1E6EB 1K51A 4HK2A 3I63C 2LZ6A 3IAS1 3TMPB 5EE1A 4DBGA 2OJRA 4IG7B 2KJRA 3VQIA 2IY0B 4KSLC 1LFDA 3AEEB 1D4BA 1E0ZA 4HCPB 4IM3A 4KGTA 4IUMB 1TZ1A 5JZEB 2KDFB 2FNJB 1I4GA 2KANA 3V60A 3VDZA 3ZQ4A 4E3CA 1DYQA 3L17A 1UF0A 5HHDG 3DHIC 3HVZA 4GIVA 3W1SA 3W5UB 2GBNA 1TKGA 2LXAA 1VD2A 1L6UA 2LUEA 1C4AA 3ALBA 4ZHPA 3PTFC 1WYGA 2DNFA 3MC8A 5G2NA 4HJGE 4XWTA 4EUTA 2XN9C 4KIKA 3ZXVA 1WRIA 3SDLC 4W9DA 4ZOHC 4IDIA 3DHHC 1FIQA 4DXAB 1K8RB 4UDUC 5D6JB 5E6JA 4M8NA 2V1YA 4WWOA 3U7ZA 2KXJA 5DPRA 1V5OA 2V3PA 3U7DA 3PHXB 3WANA 4ASWC 3N1YC 1FNWA 4US9A 3KVFB 4NZLB 3GP7A 4ARIA 1E5WA 4KGRA 4IC7B 2HJ8A 3RNEC 3T3OA 2IPKD 4KSKC 1C78A 4GLSC 2C9WB 5FKAC 1P9DU 3KUZA 3VR8B 3VUWA 1RAXA 1T0SC 4M02A 2JRIB 3FILA 4B0EA 2WWZA 1RFAA 3QAQA 4KDIC 5JXVA 1KRHA 1HZ5A 1R4NB 1G6JA 1FM0D 3VTWA 2M0AA 3L16A 2L52A 4R3DA 4YXDB 3SR6A 1J7CA 4N58A 2JZPA 4IM2A 3QA8A 4AJYB 1CQVA 4JX1C 3B1LX 2MHJA 1L4ZB 4TV3A 4E74A 4MJSB 3QCAA 3TEXA 1EF5A 3DQVA 2LVPA 5CHFA 2KQ4X 3WAMA 4EZLA 2BKFA 4TMAB 3IVFA 2BT6A 3ZJUA 2C60A 2CU3A 1Y56A 1SE4A 2DX5B 3N3KB 3R8BA 2L76A 2WXHA 4YTPB 1VDVA 1C76A 1IGDA 4GB9A 1WYWB 1UH6A 1T6BX 4DWFA 4IM0A 2WXGA 2GMIC 2RMMA 2PEAA 3DVNV 2FCNA 3PGEA 1D5MC 1TIFA 3A9JB 4P6VF 4W9JA 1TS3A 4P1CC 5D2MB 5TSSA 2CS4A 2LJIA 3PREA 4J3OD 3X23A 3V61A 1PGXA 1U4AA 3APDA 4WH4A 2NPTA 4F1SA 5D7GA 2I2YA 4GMVA 3DVGX 1L4DB 4WWMA 4LJOB 1YQ4B 1L5PA 4GN1A 1WR1A 2K39A 2OEDA 4DDGD 4PS7A 3ZDMC 2XK5B 2K22A 1RYJA 2MP2B 5H92C 5L83A 4RGOS 2FUG1 2PIAA 3T3NA 2M8SA 1WGKA 4EE2A 1C1YB 2N7DA 3N1XC 3K9PB 4HDQA 3KWLA 4HKQA 3WAOA 1SSNA 2NCNA 1JALA 3RMKC 3ZJTA 4GGQA 1PUTA 1IBXA 4OHJA 1VCBA 3AE2B 2BWES 1LO5D 1T5XD 4KV2A 4NQLB 4M00A 2LMCA 3L4PA 4LTUA 2D3BA 4JGHB 3R2IA 2VRRB 3ZW3A 4KDLB 2KJ6A 3BYYB 3VRBB 2ON8A 3OJ4B 1GB1A 1QOAA 1FFUA 5C2TB 3TJPA 5EDSA 2WQYB 3AI5A 4M01A 2O2VA 4FHKA 3U52E 4W9HA 1YOVB 3PLVA 1HA5A 2LVOA 4MH8A 2LHEA 3N9YC 1K53A 2N9LA 2J42A 2KX3A 4ZRKA 3TBLD 2KTFA 1Q1OA 2XBBC 1Z5SB 4B0MA 3B2GA 2LGIA 4LK0M 2LD9A 1J7BA 3A4RA 4W9LA 4GSWA 1QOBA 1P0RA 2IO3B 5CX3A 4A3PA 2Z59B 3AECB 1NI3A 1ROEA 2C7HA 3JW0X 1VJKA 2D3CA 4L1BA 2CR5A 4XZ4A 2KWUB 1NI2A 2KTRA 3A1QA 1VZ6A 3QHTA 1WZ0A 4EOYA 2D3AA 4ANWA 1VRAB 1WRDB 3VR9B 2IBIB 1E90A 1YJJA 1EF1A 4TQ1A 4JLCA 2MWSB 4CO7A 1HEZE 3EHVA 1J0GA 2KMCA 3RT3B 3ZIMA 2MJDA 1WMHB 3RNBC 2AYOB 5AUKA 2K6DB 1ET9A 4KGSA 1N61A 3RNGC 1QT9A 1BMLC 3H7PB 2L0FA 2J53A 2HJ1A 3AEDB 1GOZA 3V3XA 1ZXHA 2GB1A 2Q5WD 4DQOC 2AQ3B 3Q8CA 4NJ7A 2IJ0A 2B3AA 1KF6B 2JT4B 3AE4B 3APFA 4ZDVA 1F1HA 1JRPA 4DXGA 4HPPA 2LHDA 3T9LA 2QJLA 3BY4B 1FMAD 4TKNA 4MGKE 1WM3A 4RNAA 2L0TA 1JWAD 1SIJA 4DHZB 2LRWA 3W9CB 2JX5A 2WXFA 1LGRA 1MFWA 4W9EA 2FE8A 2HTME 3ABVB 3GZNI 5IKCM 3VXWA 4II3B 2LRUA 1DOIA 2W54A 2O6VD 4DK5A 3DBRB 3UGBB 2RD0A 1IUEA 1GC6A 4USAA 1V1OA 2AL3A 3AEGB 4EFOA 1E10A 4HJKA 2FAZA 5JH5C 1JW9D 1N5XA 3RULA 2LGYA 1H4RA 3B2FA 1SB3C 3O65B 4RCOA 2W82A 2LXCA 2QMTA 4A20A 3OJ3A 2K8BA 3ZYYX 3CIRB 5J2RA 2BPSA 2CHWA 3ZVVA 1DOYA 1D5ZC 1WX8A 1GJZA 4LCDE 1OFFA 4WURA 3N1ZC 5DCNA 4MT5A 3RCZA 1E7PB 2FCMA 2VH1A 2KDBA 2N4FA 2J0MA 1N6ZA 4WQMA 4BOSC 3A4SC 4C4VB 5JHAA 1V1PA 4NNJB 5J18A 3SFDB 1RWSA 4HCNB 2B76B 3VRAB 1KFYB 1L0YB 1E9MA 1QF6A 5D3DA 3BVZA 2BYFA 1LM8B 2M0XA 2VH2A 4KZ0A 5T8IA 3UINB 2WX0A 5BYSA 4M0WB 1VLBA 3AB5A 2INPE 3M95A 1D5XC 4G0NB 3BINA 2J4XA 3AMZA 4RH6A 3VHTC 2NBUA 1YNTE 4RM9A 2IGGA 1L0VB 4LNIA 3WCQA 3WALA 2BTEA 2KWCA 1L0XB 1GNUA 2DZIA 1VR9A 4F7ZA 4ANXA 1T0QC 2BB5A 2RDBC 1K52A 1SJED 1WX7A 3VUYA 3DBLI 2MSED 1ZDVA 2WXOA 3BYTB 4P7IA 2NBVB 3Q3JA 3HVDA 4O1NA 2Z8LA 3IFWB 3UIPB 1IGCA 3VVWB 3WA0A 1QQRA 2CHZA 4BKSD 2QDFA 1M4VA 2MBQA 3KQ4A 4ANUA 2WNMA 3AEAB 2N1VA 2LWPA 3AXCA 2KD0A 3RPFC 2KFKB 2EKIA 1ZXIA 2GBKA 2IGDA 1KM7A 1Y8RC 3BWUD 3W5VB 3B9JA 2JZ3B 4LNOA 3N20C 3PVLA 4MGIE 1L2NA 3MTNB 2GI9A 4YSXB 4L2YA 2KZRA 2N9XA 3VTVA 2L83A 4JL9A 1WGHA 3VUXA 2KFJA 4MACA 2G3QB 4XYCA 3BZDB 1XXGA 2BYTA 4PYZA 1E7UA 1WE6A 4HXDA 1YQBA 2DZMA 2BKRB 4WJQA 2ACZB 2LFIA 1MPEA 1YJ1A 1TKEA 4RMAA 3D32A 4AP4C 3ML9A 4A55A 2GLSA 3AE1B 4C56C 1JWBD 3PLUA 2JYEA 3DBRI 3WAPA 2D5GA 1RLFA 4C00A 2J7QB 2IDYA 4RGTA 2N9EB 2DZKA 2OJWA 3IT6B 2KVZA 4MDKE 3R7RA 1WE7A 4K3BA 2ZNVC 1ET6A 4BBNC 2JQRB 3C8YA 3MP9A 1PYWD 4AJWA 3KUCB 1Z2MA 2DYBA 3ZDTA 4YTNB 1GB4A 1YN3A 1E8WA 1IPGA 1TGZB 1V8CA 3BK1A 2BGFA 3IBEA 2FCSA 3S2AA 4HRSA 2VZKB 3HM3A 4IWQA 3DVGY 1R4MB 3NHEB 2JUOA 2AEHA 5C3JB 2WLBA 4GDKA 1J8CA 1SE2A 2PPHA 2N9PC 2K8CA 1C9FA 3NRZA 2O6VB 5GMVA 3HK0A 3ECIA 3Q69A 1WJUA 1C4PA 3TSSA 1JQ4A 4N9F4 1OGWA 4ZRQA 2HDEA 2BYEA 3PRZA 1J7AA 4ZRPA 2RSUA 4JWUC 1D3ZA 1PGBA 2K8HA 3C19A 4PS3A 4B95A 2WDRB 5G55A 3URYA 4BFRA 2H89B 3NJTA 1M94A 3U2SC 2WU2B 4GU2A 3NVZA 2KKCA 3NS1A 1JWMD 1SJHD 3KWVA 1UZXB 1SIFA 2DLBA 2NR2A 3T8MA 4A9AA 5MPOA 3W1YA 4WIPA 2WYQA 4EEWA 2IYDB 2LASA 4I6LB 3RNFC 1XLPA 2YEPB 5D94A 2AL6A 3E9SA 2H88B 4PS8A 3RZFA 3DBHI 2X38A 2IZVB 1NDDA 1ZGUB 4RF1A 1KLGD 3DOWA 3Q3MC 1WH3A 1R7SA 3EECA 3AEFB 1FPYA 2G9HD 2RPVA 4M8MA 5FR3A 4P1BC 2ZW0A 1L7YA 1N63A 2ZVNA 4X57B 2JRHA 3M62B 2BWFA 3APCA 5CHWA 4EZKA 2ZNVB 5IA7A 2KN5A 4TSSA 2BBCA 2L7RA 3ZRFA 1V6EA 2Z0DB 2RGFA 2DHZA 5D3IB 1P1AA 1I4XA 3LJ3A 3QQ8B 1UBIA 4LLGM 1WM2A 3ZXRA 2R2QA 3MHZA 3OLMD 4WAAA 1BUIC 3PZ8A 5HG2A 2WDTB 3P2BA 1A70A 3U4EG 3JYUA 3E56A 2DBYA 2I1JA 2BF8B 3ZRCA 4OVVA 3KUDB 2E6XA 4FLHA 4CHKA 1ACCA 4OW0A 2PVOD 1CMXB 5EE0A 3PZ7A 3PRPB 3ZTCA 3N30A 1WFYA 4MSQB 2NMQA 5KHOA 1BXTA 4ACFA 4W9CA 3L0WB 2DENB 2PJHA 4FN2A 2KWVB 1XD3B 2N0SB 4NAWB 3HUIA 4MJSA 4XGAB 1NBFC 5BYQA 5HI1A 4DHZE 2WDVB 5G5HA 2ONQA 5AZHA 2BS4B 1RFKA 3P4RB 4YTMB 2FCQA 2CHXA 1WI0A 2QSDA 1EO6A 1EWYC 3KYDD 4EZJA 3CWIA 2UWQA 3LYYA 2ZPYA 2JWZA 4ICUA 1P7FA 3R66C 3CSFA 3M3JA 5C1ZA 2I38A 3Q3FA 2E3TA 3A9JA 4XC2A 1ZKHA 3U30A 1JROA 5BMGA 2J0KA 3DHGC 3R3MA 1UNSA 2KN4A 1TYGB 4GXBA 2REXA 3V6EB 2DYMA 3W2DA 4B9KA 3EA6A 4NJ6A 4BVUC 5IP4D 1GAQB 4HWIB 2KC1A 2XK5A 3N32A 1VZ7A 3C0RB 3AN1A 1R4NI 1UGJA 2KQSA 2MP2A 3CMMB 3VAWA 5EE9A 4S0RA 1KOTA 2WXLA 3CF6E 4DHJD 4EKUA 2MJEA 4FULA 2N1WA 2JPHA 3VH4B 3J9CA 2LJ5A 2MA9B 5H8YE 2WXQA 3PT2B 3A9KB 4F8CB 2MEKA 1EM7A 2PE9A 1YX5B 2FIDA 1WGDA 4RM8A 1V49A 2ASQA 2WGSA 2C7NB 3UI3A 1V97A 1OEYA 2ZJDA 1HTOA 1YIWA 3I9V1 1ESFA 1SBBB 1FNVA 1TJEA 2D07B 2KNBA 4MELA 1C3TA 2D3GA 3SEBA 4YSYB 3U8ZA 2VZKD 4XDDA 4W9KA 5E6PA 5CTRC 3P4PB 4BKSA 4ZHOA 3ONSA 2J0JA 5J17A 1F52A 1JCKB 1D6EC 2A5UA 1WGRA 4TQ0A 2RR9A 1YQ3B 4C7YA 2R61A 1LQBA 2QCZA 5TR5A 5BYRA 1FO4A 1UD7A 2WDQB 4MGYE 5LNK1 1FD6A 3RN9C 2W3RA 1WJ6A 2DWQA 3UQAA 4DDID 2WXPA 3LB8C 3ZNID 1B9RA 4HEA1 4LNFA 1NVID 2WP9B 1AARA 1S1QB 3NUHB 3NVYA 3L08A 4REZA 3QK0A 1FXIA 2MCNB 4IW0A 2DZJA 4ICVA 3Q6BA 4C7ZA 4G50A 3NZ3A 3Q3OC 3B0AA 1NENB 2KDEB 2JYTA 1FNUA 4A6QA 2MRPA 4ANVA 2V0GA 1PQSA 2EMSA 3PRMB 4K7UA 4ZRIA 4MM3B 3NG0A 4FXCA 2PVGC 1JWUD 3JSVB 4A3OA 3EUB2 2JZZA 1XCQL 2G45B 1UUPA 1ZE3D 4XDCA 1WMHA 2LUMA 1NEKB 2KWDA 1NYRA 3TEWA 1QZEA 3TCAA 3Q8AA 5FK9C 4BAXA 3H7PA 3AE6B 2LGDA 2L32A 3AE7B 3X0WA 3PV1A 3ML8A 4S17A 4K3CA 1F2RC 2V4LA 3DWMA 4JIOU 1T0YA 3DPDA 1C77A 3NZSA 2MLBA 4II2B 2Y5CA 2IO2B 1E7VA 1ZDXA 5BO4B 2LGSA 4IWPA 3MC0B 3AH7A 1E8ZA 3UQBA 4RGNA 2WX1A 1T3QA 5C23A 4GDLA 2A4ZA 2PKOA 1MHXA 5BMIA 2ZCCA 1WXVA 4NQKE 4NY0A 5LXHA 2JWUA 1FFVA 5BMHA 3P63A 4KIKB 1IYFA 3I5JC 3L54A 1C4CA 1X1MA 2BS2B 4P16A 3BVGA 2WXMA 1E8YA 2JXTA 3DBSA 5AZFA 4OZAA 1WJ4A 2J52A 5E6OA 2X8XX 1JWSD 2HTHA 2CJOA 2PMVA 1P98A 2RDHA 4W9GA 3AV8A 4URKA 2QEJC 2MJ3A 4FADA 3EFCA 2W3SA 3JVZX 2M1MA 4JWSC 3FAHA 3FILB 1YN4A 4J6IA 4BZAA 1L6VA 3Q8EA 2HD5B 4K81A 1AW7A 3CSTA 3ZNZB 4HLEA 3HM6X 2Y5BB 5KHQA 2L05A 1WGYA 3P4SB 2ZW1A 2KO3A 3BIID 1TT5B 2WXNA 1KH0A 4C4VA 1WY8A 5IN7A 5HKHA 2FBWB 2Y3AA 3LDZE 1IP9A 2AQ1B 1NYQA 2L3ZA 3GOEA 1SGHA 1UWMA 2K3UA 2GRIA 1Q5WB 4DHJB 1YX6B 3I57A 1Q0WB 1AWDA 4L23A 3RI7C 1XEEA 4M0WA 2NS5A 1GC7A 2MBBB 2Z0EB 4FJYA 1A5RA 1PDXA 1MI0A 5HFYA 4E71A 4FHJA 1YJIA 2ICIA 1FCLA 3KW5B 1T0RC 3DVNU 3TUOA 2N7JA 2NPTB 2MW5A 2KYWA 4US8A 4HROA 1QLBB 4YSZB 2IY1B 2UU7A 1YMHE 1HXYD 4LJPB 2BW2A 1I4RA 2EMTA 2PE6B 1AYFA 1Q10A 4MH0E 1AN8A 3SHQA 3MHSD 4XE0A 1F9JA 3VTUA 2V4IB 2WXRA 4YL8A 5IAAC 1EU3A 3H8HA 1WWTA
chains in the Genus database with same CATH topology
3IT4B 1JRPA 2E6XA 4DXGA 4XWWA 2LHDA 1XLQA 3BK2A 3BVMA 4HKZE 2QJLA 1FMAD 1ACCA 4OW0A 2PVOD 5EE0A 1GPXA 4RNAA 3P42A 1JWAD 1SIJA 3PZ7A 3W9CB 4AS1A 1OQQA 2JX5A 2WXFA 2NMQA 4OZBA 2FE8A 1BXTA 2HTME 2AX5A 3ABVB 4YT0B 1IBXB 1QILA 1FEHA 3OWEB 2N0SB 4NAWB 3HUIA 1VZ8A 4GDKB 1DOIA 2W54A 4Q2JA 3NVVA 4NAMA 1XCTL 1RM6C 1SXTA 5BYQA 5HI1A 1IUEA 3AE5B 4USAA 2WDVB 1V1OA 3O13A 3AEGB 5G5HA 1E10A 2LEKA 2ONQA 2XNAC 1I7HA 2BS4B 3R2TA 1RFKA 3P4RB 4YTMB 1PFDA 1JW9D 1N5XA 2QSDA 1EWYC 3CWIA 3B2FA 2IGHA 1SB3C 3LYYA 1I4QA 4D2KA 3ETRA 1P7FA 4RCOA 2W82A 2YEPF 3AE9B 3ZGZA 2QMTA 1E6EB 2I38A 2E3TA 2BB6A 1K51A 3ZYYX 3CIRB 4DXFA 1JROA 3IAS1 5BMGA 1DOYA 1I4PA 5EE1A 2KN4A 1D5ZC 1UNSA 1ZPSA 4ARCA 1TYGB 3VQIA 1CZPA 1OFFA 4WURA 3SFEB 3AEEB 4MT5A 1D4BA 1I4HA 1E0ZA 2DYMA 5GXGB 1E7PB 4KGTA 3W2DA 4N6EB 3EA6A 2M56B 2KACA 1ZOYB 2PLPA 1I4GA 2KMMA 3ZQ4A 3MJ5A 1GAQB 1DYQA 2N9KA 3IAM1 5HHDG 1CJEA 1VZ7A 1TY2A 3AN1A 3HVZA 4WQMA 1UGJA 1ENFA 4N59A 3W1SA 5EE9A 3W5UB 1TKGA 2WXLA 1V1PA 2SEBD 3SFDB 1RWSA 1L6UA 2B76B 3AEBB 2MJEA 3LXFA 3VRAB 1KFYB 1L0YB 1E9MA 1QF6A 4IKGA 5D3DA 1C4AA 3BVZA 3J9CA 2K9XA 4RGMA 5H8YE 1UWXA 2WXQA 1MVKA 5T8IA 4ZHPA 1WYGA 5BYSA 2MEKA 1EM7A 1VLBA 3AB5A 2INPE 4HJGE 1KLUD 4XWTA 2CJNA 1D5XC 2WXKA 2XN9C 1WRIA 2J4XA 3AMZA 4RH6A 1YNTE 3TEZA 1MHHE 4ZOHC 2IGGA 4IDIA 1L0VB 2NTTA 2AQ2B 3UI3A 1HZ6A 1V97A 1FIQA 3WCQA 4KKIA 5G5GA 2M19A 2BTEA 1FRRA 1L0XB 3I9V1 1ESFA 1SBBB 1FNVA 1TJEA 4UDUC 5E6JA 2WU5B 1VR9A 4A8XC 3U7ZA 1DGJA 3AE3B 3SEBA 2BB5A 2V3PA 4YSYB 2VZKD 3Q8BA 1K52A 1SJED 4XDDA 4JE3B 1QOGA 1FNWA 4US9A 4NZLB 3GP7A 3P4PB 3AE8B 4ARIA 4KGRA 4ZHOA 1ZDVA 2WXOA 2WS3B 1JCKB 1D6EC 3T3OA 2IPKD 3BYTB 1C78A 4GLSC 1N5WA 5FKAC 4TQ0A 3VR8B 1K50A 3HVDA 1YQ3B 4O1NA 4IOIE 2TSSA 2Z8LA 3FILA 4C7YA 2G1EA 2R61A 1F0ZA 4B0EA 1IGCA 1QKZA 5JXVA 1KRHA 1XO3A 1HZ5A 5BYRA 1FO4A 1FM0D 2WDQB 4KX6B 2M0AA 2L52A 1QQRA 4R3DA 4YXDB 1F2RI 3TEYA 3SR6A 5LNK1 1FD6A 2QIEB 1J7CA 1M4VA 1FXAA 2INNE 2W3RA 2JZPA 4N58A 3KQ4A 2WNMA 2DWQA 3FC4A 1XF5L 1CQVA 3AEAB 3HRDD 2SAKA 2WXPA 4JX1C 3LB8C 1L4ZB 1B9RA 3RPFC 4HEA1 2EKIA 1ZXIA 3TEXA 1NVID 2IGDA 2WP9B 3BWUD 1KTKA 3NUHB 3W5VB 3NVYA 2KQ4X 3B9JA 2DYOA 4REZA 4TMAB 1TKYA 1FXIA 4NJCA 2BT6A 3GB1A 3ZJUA 2CU3A 2GI9A 1Y56A 4C7ZA 4L2YA 4YSXB 3NZ3A 1SE4A 1P7EA 1PGAA 1NENB 3R8BA 2JYTA 2WXHA 4YTPB 2L83A 1FNUA 4MACA 4A6QA 2V0GA 1VDVA 1C76A 1IGDA 3BZDB 2JSVX 2KAJA 1T6BX 4MM3B 1XXGA 2BYTA 2WXGA 4FXCA 2PVGC 1JWUD 2RMMA 1D5MC 2Y5PA 1YN5A 3EUB2 4P6VF 1TS3A 1XCQL 1UUPA 2ACZB 1ZE3D 2LFIA 2LJIA 4J3OD 5TSSA 4XDCA 1PGXA 1QOFA 1MPEA 1TS2A 1WXQA 2LUMA 1TKEA 4WH4A 2K0PA 2BS3B 5D7GA 1NEKB 2I2YA 2KWDA 1NYRA 3RFZB 3TEWA 2WXIA 1L4DB 4WWMA 4A55A 1F77A 3AE1B 4C56C 1JWBD 3Q8AA 1EWCA 2JYEA 1YQ4B 5FK9C 1L5PA 2D5GA 3AE6B 1C79A 2L32A 3AE7B 5I4DA 2IDYA 2OEDA 4RGTA 3IT6B 3P1MA 2K22A 1F2RC 3DWGC 1RYJA 5H92C 1ET6A 3DWMA 4RGOS 1C77A 1FCCC 1V1PB 2FUG1 2JQRB 3C8YA 3MP9A 1PYWD 2Y5CA 3IXSA 1ZDXA 2PIAA 2K5PA 3T3NA 3MC0B 1WGKA 3AH7A 4YTNB 4RGNA 1GB4A 4EE2A 1YN3A 4A90A 1HQRD 2PW9A 1T3QA 1V8CA 2PKOA 3KWLA 1MHXA 4HKQA 4PT5A 5BMIA 1SSNA 3BK1A 1JALA 4RF0A 3NVWA 1N60A 2JWUA 1FFVA 1FRDA 4HRSA 3ZJTA 5BMHA 2VZKB 3P63A 1PUTA 1IBXA 4OHJA 3AE2B 1C4CA 2BS2B 1LO5D 5C3JB 2WLBA 1T5XD 3BVGA 4P16A 2WXMA 2JXTA 1SE2A 4OZAA 2LMCA 3L4PA 4LTUA 2J52A 3R2IA 1C9FA 1CK1A 3NRZA 3BYYB 3VRBB 1JWSD 3Q69A 4GDLB 2CJOA 1TZOA 2ON8A 2PMVA 1WSPA 1GB1A 1C4PA 3TSSA 1JQ4A 1QOAA 1FFUA 2RDHA 5C2TB 2L1AA 3AV8A 2WQYB 4ZRQA 2HDEA 1J7AA 4ZRPA 3AM9A 4ZYSA 1STEA 2QEJC 4JWUC 1PGBA 3U52E 2RDGA 2MJ3A 2W3SA 1TY0A 1HA5A 4JWSC 4MH8A 3FAHA 2LHEA 3FILB 1YN4A 3N9YC 1K53A 3PO0A 2WDRB 3URYA 2H89B 3U2SC 1L6VA 2N9LA 2V3NA 2WU2B 3NVZA 2J42A 2QILA 3NS1A 3Q8EA 4WAFA 2NTSA 1AW7A 1JWMD 4YWGG 1JMLA 4B0MA 1N62A 2W55A 1SJHD 3B2GA 3KWVA 2LGIA 4LK0M 2DLBA 1J7BA 5AUIA 2WXJA 4A9AA 4OVZA 5MPOA 1QOBA 3EGRA 3P4SB 4WIPA 3KLSX 2ZW1A 3AECB 4AQ7A 3ZJVA 1NI3A 1XLPA 1ROEA 2YEPB 3BIID 4JPSA 2WXNA 1KH0A 1VJKA 3E9SA 3MFGA 4L1BA 2H88B 4ITKA 2FBWB 2Y3AA 2X38A 2AQ1B 4RF1A 4CQNA 1NYQA 1KLGD 1VZ6A 1XLOA 3V05A 2OHFA 1UWMA 2K3UA 2GRIA 4KKJA 1R7SA 2PTLA 1DOXA 3I57A 1VRAB 1XLNA 3AEFB 3VR9B 2G9HD 2RPVA 1AWDA 4L23A 1XEEA 1YJJA 1B1ZA 4M0WA 5FR3A 4TQ1A 2JU6X 1ZUD2 2ZW0A 1TS4A 1HEZE 1N63A 1PDXA 1MI0A 5HFYA 4RFBA 2MJDA 1ZP0B 5EE3A 1YJIA 2ICIA 1FCLA 4H2AA 3TUOA 2N7JA 5AUKA 4TSSA 1SF0A 2BBCA 1ET9A 4KGSA 1N61A 4US8A 1OQRA 1QT9A 2KDMA 1BMLC 3Q8FA 4HROA 1QLBB 5D3IB 4YSZB 1I4XA 2EELA 2J53A 2MH7A 1YMHE 4LLGM 1HXYD 3GS2A 2BW2A 1TS5A 3AEDB 1GOZA 1I4RA 1ZXHA 3V3XA 2GB1A 3MHZA 4C80A 3P4QB 2Q5WD 1AYFA 1Q10A 4OZCA 1BUIC 2AQ3B 4DQOC 3Q8CA 1AN8A 3PZ8A 5HG2A 4XE0A 1EU4A 1A70A 2V4IB 1SEBD 2IJ0A 3U4EG 2WXRA 1KF6B 1SE3A 3E56A 1EU3A 2DBYA 3AE4B 3H8HA 1WWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSV X;  1UWX A;  1MVK A;  2LHD A;  4HKZ E;  2RMM A;  2LHE A;  3FIL B;  1EM7 A;  1K53 A;  4HJG E;  1XCQ L;  2N9L A;  1YNT E;  1PGX A;  1MHH E;  1MPE A;  2NMQ A;  4OZB A;  2LUM A;  2IGG A;  4WH4 A;  2K0P A;  1JML A;  1IBX B;  2I2Y A;  3UI3 A;  2KWD A;  1HZ6 A;  2LGI A;  1XCT L;  2ZW1 A;  2OED A;  5HI1 A;  1KH0 A;  1F2R C;  1K52 A;  2ONQ A;  4KGR A;  1FCC C;  3MP9 A;  2QSD A;  2PTL A;  4GLS C;  2IGH A;  4D2K A;  1K50 A;  2RPV A;  1P7F A;  4IOI E;  3FIL A;  1GB4 A;  2QMT A;  2I38 A;  2PW9 A;  1K51 A;  2JU6 X;  2ZW0 A;  1IGC A;  1QKZ A;  5JXV A;  1HZ5 A;  1HEZ E;  1MHX A;  5BMI A;  1MI0 A;  5BMG A;  5HFY A;  2KN4 A;  1F2R I;  2JWU A;  5BMH A;  1FD6 A;  1IBX A;  1D4B A;  4KGT A;  1FCL A;  2JZP A;  2KAC A;  2N7J A;  2JXT A;  2PLP A;  1XF5 L;  4KGS A;  4OZA A;  2KDM A;  2J52 A;  2N9K A;  5HHD G;  2EEL A;  2J53 A;  1C9F A;  1YMH E;  2IGD A;  2KQ4 X;  3V3X A;  1ZXH A;  2ON8 A;  2GB1 A;  1Q10 A;  4OZC A;  1GB1 A;  3GB1 A;  2GI9 A;  5HG2 A;  1P7E A;  1PGA A;  4IKG A;  4MAC A;  1IGD A;  1PGB A; 
#chains in the Genus database with same CATH topology
 4IWO A;  2QC8 A;  2R2O A;  1XLQ A;  3BK2 A;  3BVM A;  4W9I A;  4HKZ E;  3MC9 A;  1GPX A;  3P42 A;  1XT9 B;  1YD8 U;  3PS6 A;  4AS1 A;  3V62 A;  2NVU I;  2UYZ B;  1WGG A;  1IBX B;  3OWE B;  5FR6 A;  1XQQ A;  2LVQ A;  2LI5 A;  3NS8 A;  2KFK A;  2DAJ A;  1UGM A;  2BQQ A;  4NAM A;  1RM6 C;  3UF8 A;  3A33 B;  3AE5 B;  2MBE A;  2W9N A;  3O13 A;  2KT7 A;  2JY6 A;  2K1F A;  2XNA C;  1PFD A;  4FJV B;  2IGH A;  3EFU A;  3ETR A;  3L13 A;  3QC8 B;  2O2V B;  3AU4 A;  3DCG A;  3RD2 A;  2YEP F;  2XEW A;  3AE9 B;  2BB6 A;  4MSM B;  1MJD A;  2K25 A;  2ZEQ A;  4DXF A;  1I4P A;  4ARC A;  3R7Q A;  1ZPS A;  4FA6 A;  1CZP A;  3SFE B;  1I4H A;  5GXG B;  1WXA A;  2ZPN A;  4N6E B;  1E8X A;  2M56 B;  1P3Q U;  2KAC A;  1ZOY B;  2CU1 A;  2PLP A;  4K7S A;  2KMM A;  4HVB A;  3H1U A;  3MJ5 A;  2N9K A;  3IAM 1;  1WZ3 A;  1CJE A;  1TY2 A;  3Q14 C;  1ENF A;  5AEK B;  2JVC A;  4N59 A;  1ZW7 A;  2SEB D;  3QX1 A;  3AEB B;  3LXF A;  2KTR B;  4BBN F;  3A1Q B;  2AWT A;  4IKG A;  3VFK A;  3GZN B;  2K9X A;  3RNC C;  3NZU A;  4RGM A;  4I6N B;  1UWX A;  1MVK A;  3ZUN A;  1MG8 A;  4ZYN A;  5IOI A;  2ZCB A;  2JXX A;  1KLU D;  3H9D A;  2CJN A;  2I1K A;  5DPT A;  2WXK A;  4FJZ A;  3TEZ A;  1MHH E;  2NTT A;  2AQ2 B;  1HZ6 A;  2KC2 A;  4LNK A;  3RNA C;  4KKI A;  5G5G A;  2M19 A;  4LDT B;  1FRR A;  2KVR A;  2O6V A;  2WU5 B;  2GBM A;  4A8X C;  3VH3 B;  1DGJ A;  3AE3 B;  3Q8B A;  1JRU A;  4JE3 B;  1QOG A;  2KMA A;  3AE8 B;  1UEL A;  2WS3 B;  4NPN A;  1S3S G;  2MBH A;  3ZO5 B;  1N5W A;  4AWJ A;  1K50 A;  5L95 C;  3ZLZ A;  4IOI E;  2TSS A;  4WJO A;  2RPQ A;  2G1E A;  1F0Z A;  2KLC A;  1QKZ A;  1XO3 A;  2WHI A;  2DAF A;  4KX6 B;  1F2R I;  3SD5 A;  3TEY A;  2QIE B;  4K1R B;  4CYE A;  1FXA A;  2INN E;  3FC4 A;  1XF5 L;  3HRD D;  5E6N A;  2SAK A;  2ZZP B;  3NY5 A;  1KTK A;  5DPS A;  3RUI B;  2DYO A;  2GBR A;  1TKY A;  3TL5 A;  4WJP A;  4NJC A;  2KOX A;  2G4S A;  3HHM A;  3GB1 A;  1R4M I;  3PHW B;  3FKY A;  1EUV B;  1P7E A;  1PGA A;  3QAR A;  5AZG A;  4AOF A;  2NBW B;  3Q2A C;  5LXI B;  2JSV X;  2KAJ A;  2HE7 A;  2MBO A;  2KLG A;  3QWZ B;  1ISN A;  2Y5P A;  1YN5 A;  3H6N A;  1QOF A;  1TS2 A;  1WXQ A;  3DBL B;  2K0P A;  2BS3 B;  2GOW A;  2C7M B;  4KVG B;  4I6P A;  3RFZ B;  2WXI A;  2L00 B;  1F77 A;  1EWC A;  1V5T A;  1V81 A;  1H8C A;  1C79 A;  2KHW B;  3K9O B;  1KJT A;  5I4D A;  3W1S C;  3P1M A;  3DWG C;  2M4N A;  3RZW C;  2FUH B;  1FCC C;  1V1P B;  1V80 A;  3IXS A;  1LXD A;  3TIX A;  2K5P A;  4LNN A;  2INC C;  3GE8 C;  5CHV C;  2KK8 A;  2JF5 A;  1OTR B;  4A90 A;  1HQR D;  2PW9 A;  3M63 B;  4PT5 A;  1WJN A;  4RF0 A;  3NVW A;  1N60 A;  4TUU A;  1FRD A;  1V2Y A;  4NAW A;  2BVC A;  1GUA B;  4HPM B;  1HE8 A;  1OEY J;  2M17 A;  1CK1 A;  4GDL B;  2YLM A;  1TZO A;  2KX0 A;  4WWN A;  1WSP A;  3B08 A;  2L1A A;  4BKT A;  3Q3N C;  3PZD A;  3AM9 A;  4OVU A;  1STE A;  4ZYS A;  4HPL B;  2RDG A;  3IG3 A;  3GE3 C;  1TY0 A;  2EKE C;  2G4D B;  3PO0 A;  2KJH B;  3AU5 A;  2V3N A;  4G11 A;  2FIF A;  2QIL A;  4WAF A;  2NTS A;  4YWG G;  1JML A;  4MGZ E;  1N62 A;  2W55 A;  3I3T B;  5AUI A;  2OOB B;  4HDO A;  2WXJ A;  4OVZ A;  4GOC A;  3EGR A;  3KLS X;  4AQ7 A;  3ZJV A;  4JPS A;  3ZTD A;  1WXS A;  3MFG A;  1TBE A;  4ITK A;  2CKH B;  1V86 A;  3KYC D;  3QIJ A;  4CQN A;  2L8J A;  5JHB A;  1XLO A;  2N7E A;  3L10 B;  2OHF A;  3V05 A;  4W9F A;  4KKJ A;  2PTL A;  2IO1 B;  1DOX A;  1XLN A;  3A9K A;  1B1Z A;  4FBJ B;  1SE9 A;  2JU6 X;  1ZUD 2;  4WJN A;  1TS4 A;  2IND C;  1HTQ A;  1TTN A;  1WF9 A;  4RFB A;  2IO0 B;  1ZP0 B;  5EE3 A;  5IO9 A;  4H2A A;  3IHP C;  3ENE A;  1SF0 A;  3HIZ A;  1MG4 A;  4BOZ B;  3ZNH B;  3UIO B;  1OQR A;  2KDM A;  3Q8F A;  2EEL A;  2MH7 A;  2V3S A;  5LLI A;  3SU8 X;  3GS2 A;  1TS5 A;  4C80 A;  2V9H A;  1I42 A;  3P4Q B;  1I35 A;  4OZC A;  2D2Q A;  3NOB A;  3ZKJ C;  1GG3 A;  3OG5 A;  1EU4 A;  2BYV E;  1SEB D;  2YVC A;  4LDT D;  3H7S A;  4ZRJ A;  4WWP A;  3ZNG C;  1SE3 A;  4BKG A;  1WR6 E;  3IT4 B;  4XWW A;  3KH0 A;  1RRB A;  4QAY A;  4PYU A;  3V6C B;  2ZVO A;  4G3X B;  2LGX A;  4B6W A;  3AUL A;  2D10 A;  3DBH B;  1FXT B;  1OQQ A;  2GBJ A;  4WQO B;  4OZB A;  2AX5 A;  4YT0 B;  3EC8 A;  1QIL A;  4KZC A;  1FEH A;  3MJW A;  3DDC B;  5DPW A;  1WXM A;  4PK1 A;  1WIA A;  1VZ8 A;  4GDK B;  3PPA A;  4Q2J A;  3PSE B;  3NVV A;  1OQY A;  1XCT L;  1SXT A;  1UBQ A;  2KQ7 A;  3RYT A;  1V9J A;  2QHO A;  2MQJ A;  3WIM A;  2LEK A;  1J19 A;  1I7H A;  3R2T A;  2D11 A;  2KDI A;  3OAW A;  1KLV A;  2MX2 A;  1WX9 A;  4XX5 A;  1BT0 A;  4JQW C;  4K7W A;  2K6Q A;  4MM3 A;  4D2K A;  1I4Q A;  3QJZ A;  4MEM A;  2C5L C;  3JSV A;  4AUQ C;  3ZGZ A;  1E6E B;  1K51 A;  4HK2 A;  3I63 C;  2LZ6 A;  3IAS 1;  3TMP B;  5EE1 A;  4DBG A;  2OJR A;  4IG7 B;  2KJR A;  3VQI A;  2IY0 B;  4KSL C;  1LFD A;  3AEE B;  1D4B A;  1E0Z A;  4HCP B;  4IM3 A;  4KGT A;  4IUM B;  1TZ1 A;  5JZE B;  2KDF B;  2FNJ B;  1I4G A;  2KAN A;  3V60 A;  3VDZ A;  3ZQ4 A;  4E3C A;  1DYQ A;  3L17 A;  1UF0 A;  5HHD G;  3DHI C;  3HVZ A;  4GIV A;  3W1S A;  3W5U B;  2GBN A;  1TKG A;  2LXA A;  1VD2 A;  1L6U A;  2LUE A;  1C4A A;  3ALB A;  4ZHP A;  3PTF C;  1WYG A;  2DNF A;  3MC8 A;  5G2N A;  4HJG E;  4XWT A;  4EUT A;  2XN9 C;  4KIK A;  3ZXV A;  1WRI A;  3SDL C;  4W9D A;  4ZOH C;  4IDI A;  3DHH C;  1FIQ A;  4DXA B;  1K8R B;  4UDU C;  5D6J B;  5E6J A;  4M8N A;  2V1Y A;  4WWO A;  3U7Z A;  2KXJ A;  5DPR A;  1V5O A;  2V3P A;  3U7D A;  3PHX B;  3WAN A;  4ASW C;  3N1Y C;  1FNW A;  4US9 A;  3KVF B;  4NZL B;  3GP7 A;  4ARI A;  1E5W A;  4KGR A;  4IC7 B;  2HJ8 A;  3RNE C;  3T3O A;  2IPK D;  4KSK C;  1C78 A;  4GLS C;  2C9W B;  5FKA C;  1P9D U;  3KUZ A;  3VR8 B;  3VUW A;  1RAX A;  1T0S C;  4M02 A;  2JRI B;  3FIL A;  4B0E A;  2WWZ A;  1RFA A;  3QAQ A;  4KDI C;  5JXV A;  1KRH A;  1HZ5 A;  1R4N B;  1G6J A;  1FM0 D;  3VTW A;  2M0A A;  3L16 A;  2L52 A;  4R3D A;  4YXD B;  3SR6 A;  1J7C A;  4N58 A;  2JZP A;  4IM2 A;  3QA8 A;  4AJY B;  1CQV A;  4JX1 C;  3B1L X;  2MHJ A;  1L4Z B;  4TV3 A;  4E74 A;  4MJS B;  3QCA A;  3TEX A;  1EF5 A;  3DQV A;  2LVP A;  5CHF A;  2KQ4 X;  3WAM A;  4EZL A;  2BKF A;  4TMA B;  3IVF A;  2BT6 A;  3ZJU A;  2C60 A;  2CU3 A;  1Y56 A;  1SE4 A;  2DX5 B;  3N3K B;  3R8B A;  2L76 A;  2WXH A;  4YTP B;  1VDV A;  1C76 A;  1IGD A;  4GB9 A;  1WYW B;  1UH6 A;  1T6B X;  4DWF A;  4IM0 A;  2WXG A;  2GMI C;  2RMM A;  2PEA A;  3DVN V;  2FCN A;  3PGE A;  1D5M C;  1TIF A;  3A9J B;  4P6V F;  4W9J A;  1TS3 A;  4P1C C;  5D2M B;  5TSS A;  2CS4 A;  2LJI A;  3PRE A;  4J3O D;  3X23 A;  3V61 A;  1PGX A;  1U4A A;  3APD A;  4WH4 A;  2NPT A;  4F1S A;  5D7G A;  2I2Y A;  4GMV A;  3DVG X;  1L4D B;  4WWM A;  4LJO B;  1YQ4 B;  1L5P A;  4GN1 A;  1WR1 A;  2K39 A;  2OED A;  4DDG D;  4PS7 A;  3ZDM C;  2XK5 B;  2K22 A;  1RYJ A;  2MP2 B;  5H92 C;  5L83 A;  4RGO S;  2FUG 1;  2PIA A;  3T3N A;  2M8S A;  1WGK A;  4EE2 A;  1C1Y B;  2N7D A;  3N1X C;  3K9P B;  4HDQ A;  3KWL A;  4HKQ A;  3WAO A;  1SSN A;  2NCN A;  1JAL A;  3RMK C;  3ZJT A;  4GGQ A;  1PUT A;  1IBX A;  4OHJ A;  1VCB A;  3AE2 B;  2BWE S;  1LO5 D;  1T5X D;  4KV2 A;  4NQL B;  4M00 A;  2LMC A;  3L4P A;  4LTU A;  2D3B A;  4JGH B;  3R2I A;  2VRR B;  3ZW3 A;  4KDL B;  2KJ6 A;  3BYY B;  3VRB B;  2ON8 A;  3OJ4 B;  1GB1 A;  1QOA A;  1FFU A;  5C2T B;  3TJP A;  5EDS A;  2WQY B;  3AI5 A;  4M01 A;  2O2V A;  4FHK A;  3U52 E;  4W9H A;  1YOV B;  3PLV A;  1HA5 A;  2LVO A;  4MH8 A;  2LHE A;  3N9Y C;  1K53 A;  2N9L A;  2J42 A;  2KX3 A;  4ZRK A;  3TBL D;  2KTF A;  1Q1O A;  2XBB C;  1Z5S B;  4B0M A;  3B2G A;  2LGI A;  4LK0 M;  2LD9 A;  1J7B A;  3A4R A;  4W9L A;  4GSW A;  1QOB A;  1P0R A;  2IO3 B;  5CX3 A;  4A3P A;  2Z59 B;  3AEC B;  1NI3 A;  1ROE A;  2C7H A;  3JW0 X;  1VJK A;  2D3C A;  4L1B A;  2CR5 A;  4XZ4 A;  2KWU B;  1NI2 A;  2KTR A;  3A1Q A;  1VZ6 A;  3QHT A;  1WZ0 A;  4EOY A;  2D3A A;  4ANW A;  1VRA B;  1WRD B;  3VR9 B;  2IBI B;  1E90 A;  1YJJ A;  1EF1 A;  4TQ1 A;  4JLC A;  2MWS B;  4CO7 A;  1HEZ E;  3EHV A;  1J0G A;  2KMC A;  3RT3 B;  3ZIM A;  2MJD A;  1WMH B;  3RNB C;  2AYO B;  5AUK A;  2K6D B;  1ET9 A;  4KGS A;  1N61 A;  3RNG C;  1QT9 A;  1BML C;  3H7P B;  2L0F A;  2J53 A;  2HJ1 A;  3AED B;  1GOZ A;  3V3X A;  1ZXH A;  2GB1 A;  2Q5W D;  4DQO C;  2AQ3 B;  3Q8C A;  4NJ7 A;  2IJ0 A;  2B3A A;  1KF6 B;  2JT4 B;  3AE4 B;  3APF A;  4ZDV A;  1F1H A;  1JRP A;  4DXG A;  4HPP A;  2LHD A;  3T9L A;  2QJL A;  3BY4 B;  1FMA D;  4TKN A;  4MGK E;  1WM3 A;  4RNA A;  2L0T A;  1JWA D;  1SIJ A;  4DHZ B;  2LRW A;  3W9C B;  2JX5 A;  2WXF A;  1LGR A;  1MFW A;  4W9E A;  2FE8 A;  2HTM E;  3ABV B;  3GZN I;  5IKC M;  3VXW A;  4II3 B;  2LRU A;  1DOI A;  2W54 A;  2O6V D;  4DK5 A;  3DBR B;  3UGB B;  2RD0 A;  1IUE A;  1GC6 A;  4USA A;  1V1O A;  2AL3 A;  3AEG B;  4EFO A;  1E10 A;  4HJK A;  2FAZ A;  5JH5 C;  1JW9 D;  1N5X A;  3RUL A;  2LGY A;  1H4R A;  3B2F A;  1SB3 C;  3O65 B;  4RCO A;  2W82 A;  2LXC A;  2QMT A;  4A20 A;  3OJ3 A;  2K8B A;  3ZYY X;  3CIR B;  5J2R A;  2BPS A;  2CHW A;  3ZVV A;  1DOY A;  1D5Z C;  1WX8 A;  1GJZ A;  4LCD E;  1OFF A;  4WUR A;  3N1Z C;  5DCN A;  4MT5 A;  3RCZ A;  1E7P B;  2FCM A;  2VH1 A;  2KDB A;  2N4F A;  2J0M A;  1N6Z A;  4WQM A;  4BOS C;  3A4S C;  4C4V B;  5JHA A;  1V1P A;  4NNJ B;  5J18 A;  3SFD B;  1RWS A;  4HCN B;  2B76 B;  3VRA B;  1KFY B;  1L0Y B;  1E9M A;  1QF6 A;  5D3D A;  3BVZ A;  2BYF A;  1LM8 B;  2M0X A;  2VH2 A;  4KZ0 A;  5T8I A;  3UIN B;  2WX0 A;  5BYS A;  4M0W B;  1VLB A;  3AB5 A;  2INP E;  3M95 A;  1D5X C;  4G0N B;  3BIN A;  2J4X A;  3AMZ A;  4RH6 A;  3VHT C;  2NBU A;  1YNT E;  4RM9 A;  2IGG A;  1L0V B;  4LNI A;  3WCQ A;  3WAL A;  2BTE A;  2KWC A;  1L0X B;  1GNU A;  2DZI A;  1VR9 A;  4F7Z A;  4ANX A;  1T0Q C;  2BB5 A;  2RDB C;  1K52 A;  1SJE D;  1WX7 A;  3VUY A;  3DBL I;  2MSE D;  1ZDV A;  2WXO A;  3BYT B;  4P7I A;  2NBV B;  3Q3J A;  3HVD A;  4O1N A;  2Z8L A;  3IFW B;  3UIP B;  1IGC A;  3VVW B;  3WA0 A;  1QQR A;  2CHZ A;  4BKS D;  2QDF A;  1M4V A;  2MBQ A;  3KQ4 A;  4ANU A;  2WNM A;  3AEA B;  2N1V A;  2LWP A;  3AXC A;  2KD0 A;  3RPF C;  2KFK B;  2EKI A;  1ZXI A;  2GBK A;  2IGD A;  1KM7 A;  1Y8R C;  3BWU D;  3W5V B;  3B9J A;  2JZ3 B;  4LNO A;  3N20 C;  3PVL A;  4MGI E;  1L2N A;  3MTN B;  2GI9 A;  4YSX B;  4L2Y A;  2KZR A;  2N9X A;  3VTV A;  2L83 A;  4JL9 A;  1WGH A;  3VUX A;  2KFJ A;  4MAC A;  2G3Q B;  4XYC A;  3BZD B;  1XXG A;  2BYT A;  4PYZ A;  1E7U A;  1WE6 A;  4HXD A;  1YQB A;  2DZM A;  2BKR B;  4WJQ A;  2ACZ B;  2LFI A;  1MPE A;  1YJ1 A;  1TKE A;  4RMA A;  3D32 A;  4AP4 C;  3ML9 A;  4A55 A;  2GLS A;  3AE1 B;  4C56 C;  1JWB D;  3PLU A;  2JYE A;  3DBR I;  3WAP A;  2D5G A;  1RLF A;  4C00 A;  2J7Q B;  2IDY A;  4RGT A;  2N9E B;  2DZK A;  2OJW A;  3IT6 B;  2KVZ A;  4MDK E;  3R7R A;  1WE7 A;  4K3B A;  2ZNV C;  1ET6 A;  4BBN C;  2JQR B;  3C8Y A;  3MP9 A;  1PYW D;  4AJW A;  3KUC B;  1Z2M A;  2DYB A;  3ZDT A;  4YTN B;  1GB4 A;  1YN3 A;  1E8W A;  1IPG A;  1TGZ B;  1V8C A;  3BK1 A;  2BGF A;  3IBE A;  2FCS A;  3S2A A;  4HRS A;  2VZK B;  3HM3 A;  4IWQ A;  3DVG Y;  1R4M B;  3NHE B;  2JUO A;  2AEH A;  5C3J B;  2WLB A;  4GDK A;  1J8C A;  1SE2 A;  2PPH A;  2N9P C;  2K8C A;  1C9F A;  3NRZ A;  2O6V B;  5GMV A;  3HK0 A;  3ECI A;  3Q69 A;  1WJU A;  1C4P A;  3TSS A;  1JQ4 A;  4N9F 4;  1OGW A;  4ZRQ A;  2HDE A;  2BYE A;  3PRZ A;  1J7A A;  4ZRP A;  2RSU A;  4JWU C;  1D3Z A;  1PGB A;  2K8H A;  3C19 A;  4PS3 A;  4B95 A;  2WDR B;  5G55 A;  3URY A;  4BFR A;  2H89 B;  3NJT A;  1M94 A;  3U2S C;  2WU2 B;  4GU2 A;  3NVZ A;  2KKC A;  3NS1 A;  1JWM D;  1SJH D;  3KWV A;  1UZX B;  1SIF A;  2DLB A;  2NR2 A;  3T8M A;  4A9A A;  5MPO A;  3W1Y A;  4WIP A;  2WYQ A;  4EEW A;  2IYD B;  2LAS A;  4I6L B;  3RNF C;  1XLP A;  2YEP B;  5D94 A;  2AL6 A;  3E9S A;  2H88 B;  4PS8 A;  3RZF A;  3DBH I;  2X38 A;  2IZV B;  1NDD A;  1ZGU B;  4RF1 A;  1KLG D;  3DOW A;  3Q3M C;  1WH3 A;  1R7S A;  3EEC A;  3AEF B;  1FPY A;  2G9H D;  2RPV A;  4M8M A;  5FR3 A;  4P1B C;  2ZW0 A;  1L7Y A;  1N63 A;  2ZVN A;  4X57 B;  2JRH A;  3M62 B;  2BWF A;  3APC A;  5CHW A;  4EZK A;  2ZNV B;  5IA7 A;  2KN5 A;  4TSS A;  2BBC A;  2L7R A;  3ZRF A;  1V6E A;  2Z0D B;  2RGF A;  2DHZ A;  5D3I B;  1P1A A;  1I4X A;  3LJ3 A;  3QQ8 B;  1UBI A;  4LLG M;  1WM2 A;  3ZXR A;  2R2Q A;  3MHZ A;  3OLM D;  4WAA A;  1BUI C;  3PZ8 A;  5HG2 A;  2WDT B;  3P2B A;  1A70 A;  3U4E G;  3JYU A;  3E56 A;  2DBY A;  2I1J A;  2BF8 B;  3ZRC A;  4OVV A;  3KUD B;  2E6X A;  4FLH A;  4CHK A;  1ACC A;  4OW0 A;  2PVO D;  1CMX B;  5EE0 A;  3PZ7 A;  3PRP B;  3ZTC A;  3N30 A;  1WFY A;  4MSQ B;  2NMQ A;  5KHO A;  1BXT A;  4ACF A;  4W9C A;  3L0W B;  2DEN B;  2PJH A;  4FN2 A;  2KWV B;  1XD3 B;  2N0S B;  4NAW B;  3HUI A;  4MJS A;  4XGA B;  1NBF C;  5BYQ A;  5HI1 A;  4DHZ E;  2WDV B;  5G5H A;  2ONQ A;  5AZH A;  2BS4 B;  1RFK A;  3P4R B;  4YTM B;  2FCQ A;  2CHX A;  1WI0 A;  2QSD A;  1EO6 A;  1EWY C;  3KYD D;  4EZJ A;  3CWI A;  2UWQ A;  3LYY A;  2ZPY A;  2JWZ A;  4ICU A;  1P7F A;  3R66 C;  3CSF A;  3M3J A;  5C1Z A;  2I38 A;  3Q3F A;  2E3T A;  3A9J A;  4XC2 A;  1ZKH A;  3U30 A;  1JRO A;  5BMG A;  2J0K A;  3DHG C;  3R3M A;  1UNS A;  2KN4 A;  1TYG B;  4GXB A;  2REX A;  3V6E B;  2DYM A;  3W2D A;  4B9K A;  3EA6 A;  4NJ6 A;  4BVU C;  5IP4 D;  1GAQ B;  4HWI B;  2KC1 A;  2XK5 A;  3N32 A;  1VZ7 A;  3C0R B;  3AN1 A;  1R4N I;  1UGJ A;  2KQS A;  2MP2 A;  3CMM B;  3VAW A;  5EE9 A;  4S0R A;  1KOT A;  2WXL A;  3CF6 E;  4DHJ D;  4EKU A;  2MJE A;  4FUL A;  2N1W A;  2JPH A;  3VH4 B;  3J9C A;  2LJ5 A;  2MA9 B;  5H8Y E;  2WXQ A;  3PT2 B;  3A9K B;  4F8C B;  2MEK A;  1EM7 A;  2PE9 A;  1YX5 B;  2FID A;  1WGD A;  4RM8 A;  1V49 A;  2ASQ A;  2WGS A;  2C7N B;  3UI3 A;  1V97 A;  1OEY A;  2ZJD A;  1HTO A;  1YIW A;  3I9V 1;  1ESF A;  1SBB B;  1FNV A;  1TJE A;  2D07 B;  2KNB A;  4MEL A;  1C3T A;  2D3G A;  3SEB A;  4YSY B;  3U8Z A;  2VZK D;  4XDD A;  4W9K A;  5E6P A;  5CTR C;  3P4P B;  4BKS A;  4ZHO A;  3ONS A;  2J0J A;  5J17 A;  1F52 A;  1JCK B;  1D6E C;  2A5U A;  1WGR A;  4TQ0 A;  2RR9 A;  1YQ3 B;  4C7Y A;  2R61 A;  1LQB A;  2QCZ A;  5TR5 A;  5BYR A;  1FO4 A;  1UD7 A;  2WDQ B;  4MGY E;  5LNK 1;  1FD6 A;  3RN9 C;  2W3R A;  1WJ6 A;  2DWQ A;  3UQA A;  4DDI D;  2WXP A;  3LB8 C;  3ZNI D;  1B9R A;  4HEA 1;  4LNF A;  1NVI D;  2WP9 B;  1AAR A;  1S1Q B;  3NUH B;  3NVY A;  3L08 A;  4REZ A;  3QK0 A;  1FXI A;  2MCN B;  4IW0 A;  2DZJ A;  4ICV A;  3Q6B A;  4C7Z A;  4G50 A;  3NZ3 A;  3Q3O C;  3B0A A;  1NEN B;  2KDE B;  2JYT A;  1FNU A;  4A6Q A;  2MRP A;  4ANV A;  2V0G A;  1PQS A;  2EMS A;  3PRM B;  4K7U A;  4ZRI A;  4MM3 B;  3NG0 A;  4FXC A;  2PVG C;  1JWU D;  3JSV B;  4A3O A;  3EUB 2;  2JZZ A;  1XCQ L;  2G45 B;  1UUP A;  1ZE3 D;  4XDC A;  1WMH A;  2LUM A;  1NEK B;  2KWD A;  1NYR A;  3TEW A;  1QZE A;  3TCA A;  3Q8A A;  5FK9 C;  4BAX A;  3H7P A;  3AE6 B;  2LGD A;  2L32 A;  3AE7 B;  3X0W A;  3PV1 A;  3ML8 A;  4S17 A;  4K3C A;  1F2R C;  2V4L A;  3DWM A;  4JIO U;  1T0Y A;  3DPD A;  1C77 A;  3NZS A;  2MLB A;  4II2 B;  2Y5C A;  2IO2 B;  1E7V A;  1ZDX A;  5BO4 B;  2LGS A;  4IWP A;  3MC0 B;  3AH7 A;  1E8Z A;  3UQB A;  4RGN A;  2WX1 A;  1T3Q A;  5C23 A;  4GDL A;  2A4Z A;  2PKO A;  1MHX A;  5BMI A;  2ZCC A;  1WXV A;  4NQK E;  4NY0 A;  5LXH A;  2JWU A;  1FFV A;  5BMH A;  3P63 A;  4KIK B;  1IYF A;  3I5J C;  3L54 A;  1C4C A;  1X1M A;  2BS2 B;  4P16 A;  3BVG A;  2WXM A;  1E8Y A;  2JXT A;  3DBS A;  5AZF A;  4OZA A;  1WJ4 A;  2J52 A;  5E6O A;  2X8X X;  1JWS D;  2HTH A;  2CJO A;  2PMV A;  1P98 A;  2RDH A;  4W9G A;  3AV8 A;  4URK A;  2QEJ C;  2MJ3 A;  4FAD A;  3EFC A;  2W3S A;  3JVZ X;  2M1M A;  4JWS C;  3FAH A;  3FIL B;  1YN4 A;  4J6I A;  4BZA A;  1L6V A;  3Q8E A;  2HD5 B;  4K81 A;  1AW7 A;  3CST A;  3ZNZ B;  4HLE A;  3HM6 X;  2Y5B B;  5KHQ A;  2L05 A;  1WGY A;  3P4S B;  2ZW1 A;  2KO3 A;  3BII D;  1TT5 B;  2WXN A;  1KH0 A;  4C4V A;  1WY8 A;  5IN7 A;  5HKH A;  2FBW B;  2Y3A A;  3LDZ E;  1IP9 A;  2AQ1 B;  1NYQ A;  2L3Z A;  3GOE A;  1SGH A;  1UWM A;  2K3U A;  2GRI A;  1Q5W B;  4DHJ B;  1YX6 B;  3I57 A;  1Q0W B;  1AWD A;  4L23 A;  3RI7 C;  1XEE A;  4M0W A;  2NS5 A;  1GC7 A;  2MBB B;  2Z0E B;  4FJY A;  1A5R A;  1PDX A;  1MI0 A;  5HFY A;  4E71 A;  4FHJ A;  1YJI A;  2ICI A;  1FCL A;  3KW5 B;  1T0R C;  3DVN U;  3TUO A;  2N7J A;  2NPT B;  2MW5 A;  2KYW A;  4US8 A;  4HRO A;  1QLB B;  4YSZ B;  2IY1 B;  2UU7 A;  1YMH E;  1HXY D;  4LJP B;  2BW2 A;  1I4R A;  2EMT A;  2PE6 B;  1AYF A;  1Q10 A;  4MH0 E;  1AN8 A;  3SHQ A;  3MHS D;  4XE0 A;  1F9J A;  3VTU A;  2V4I B;  2WXR A;  4YL8 A;  5IAA C;  1EU3 A;  3H8H A;  1WWT A; 
#chains in the Genus database with same CATH homology
 3IT4 B;  1JRP A;  2E6X A;  4DXG A;  4XWW A;  2LHD A;  1XLQ A;  3BK2 A;  3BVM A;  4HKZ E;  2QJL A;  1FMA D;  1ACC A;  4OW0 A;  2PVO D;  5EE0 A;  1GPX A;  4RNA A;  3P42 A;  1JWA D;  1SIJ A;  3PZ7 A;  3W9C B;  4AS1 A;  1OQQ A;  2JX5 A;  2WXF A;  2NMQ A;  4OZB A;  2FE8 A;  1BXT A;  2HTM E;  2AX5 A;  3ABV B;  4YT0 B;  1IBX B;  1QIL A;  1FEH A;  3OWE B;  2N0S B;  4NAW B;  3HUI A;  1VZ8 A;  4GDK B;  1DOI A;  2W54 A;  4Q2J A;  3NVV A;  4NAM A;  1XCT L;  1RM6 C;  1SXT A;  5BYQ A;  5HI1 A;  1IUE A;  3AE5 B;  4USA A;  2WDV B;  1V1O A;  3O13 A;  3AEG B;  5G5H A;  1E10 A;  2LEK A;  2ONQ A;  2XNA C;  1I7H A;  2BS4 B;  3R2T A;  1RFK A;  3P4R B;  4YTM B;  1PFD A;  1JW9 D;  1N5X A;  2QSD A;  1EWY C;  3CWI A;  3B2F A;  2IGH A;  1SB3 C;  3LYY A;  1I4Q A;  4D2K A;  3ETR A;  1P7F A;  4RCO A;  2W82 A;  2YEP F;  3AE9 B;  3ZGZ A;  2QMT A;  1E6E B;  2I38 A;  2E3T A;  2BB6 A;  1K51 A;  3ZYY X;  3CIR B;  4DXF A;  1JRO A;  3IAS 1;  5BMG A;  1DOY A;  1I4P A;  5EE1 A;  2KN4 A;  1D5Z C;  1UNS A;  1ZPS A;  4ARC A;  1TYG B;  3VQI A;  1CZP A;  1OFF A;  4WUR A;  3SFE B;  3AEE B;  4MT5 A;  1D4B A;  1I4H A;  1E0Z A;  2DYM A;  5GXG B;  1E7P B;  4KGT A;  3W2D A;  4N6E B;  3EA6 A;  2M56 B;  2KAC A;  1ZOY B;  2PLP A;  1I4G A;  2KMM A;  3ZQ4 A;  3MJ5 A;  1GAQ B;  1DYQ A;  2N9K A;  3IAM 1;  5HHD G;  1CJE A;  1VZ7 A;  1TY2 A;  3AN1 A;  3HVZ A;  4WQM A;  1UGJ A;  1ENF A;  4N59 A;  3W1S A;  5EE9 A;  3W5U B;  1TKG A;  2WXL A;  1V1P A;  2SEB D;  3SFD B;  1RWS A;  1L6U A;  2B76 B;  3AEB B;  2MJE A;  3LXF A;  3VRA B;  1KFY B;  1L0Y B;  1E9M A;  1QF6 A;  4IKG A;  5D3D A;  1C4A A;  3BVZ A;  3J9C A;  2K9X A;  4RGM A;  5H8Y E;  1UWX A;  2WXQ A;  1MVK A;  5T8I A;  4ZHP A;  1WYG A;  5BYS A;  2MEK A;  1EM7 A;  1VLB A;  3AB5 A;  2INP E;  4HJG E;  1KLU D;  4XWT A;  2CJN A;  1D5X C;  2WXK A;  2XN9 C;  1WRI A;  2J4X A;  3AMZ A;  4RH6 A;  1YNT E;  3TEZ A;  1MHH E;  4ZOH C;  2IGG A;  4IDI A;  1L0V B;  2NTT A;  2AQ2 B;  3UI3 A;  1HZ6 A;  1V97 A;  1FIQ A;  3WCQ A;  4KKI A;  5G5G A;  2M19 A;  2BTE A;  1FRR A;  1L0X B;  3I9V 1;  1ESF A;  1SBB B;  1FNV A;  1TJE A;  4UDU C;  5E6J A;  2WU5 B;  1VR9 A;  4A8X C;  3U7Z A;  1DGJ A;  3AE3 B;  3SEB A;  2BB5 A;  2V3P A;  4YSY B;  2VZK D;  3Q8B A;  1K52 A;  1SJE D;  4XDD A;  4JE3 B;  1QOG A;  1FNW A;  4US9 A;  4NZL B;  3GP7 A;  3P4P B;  3AE8 B;  4ARI A;  4KGR A;  4ZHO A;  1ZDV A;  2WXO A;  2WS3 B;  1JCK B;  1D6E C;  3T3O A;  2IPK D;  3BYT B;  1C78 A;  4GLS C;  1N5W A;  5FKA C;  4TQ0 A;  3VR8 B;  1K50 A;  3HVD A;  1YQ3 B;  4O1N A;  4IOI E;  2TSS A;  2Z8L A;  3FIL A;  4C7Y A;  2G1E A;  2R61 A;  1F0Z A;  4B0E A;  1IGC A;  1QKZ A;  5JXV A;  1KRH A;  1XO3 A;  1HZ5 A;  5BYR A;  1FO4 A;  1FM0 D;  2WDQ B;  4KX6 B;  2M0A A;  2L52 A;  1QQR A;  4R3D A;  4YXD B;  1F2R I;  3TEY A;  3SR6 A;  5LNK 1;  1FD6 A;  2QIE B;  1J7C A;  1M4V A;  1FXA A;  2INN E;  2W3R A;  2JZP A;  4N58 A;  3KQ4 A;  2WNM A;  2DWQ A;  3FC4 A;  1XF5 L;  1CQV A;  3AEA B;  3HRD D;  2SAK A;  2WXP A;  4JX1 C;  3LB8 C;  1L4Z B;  1B9R A;  3RPF C;  4HEA 1;  2EKI A;  1ZXI A;  3TEX A;  1NVI D;  2IGD A;  2WP9 B;  3BWU D;  1KTK A;  3NUH B;  3W5V B;  3NVY A;  2KQ4 X;  3B9J A;  2DYO A;  4REZ A;  4TMA B;  1TKY A;  1FXI A;  4NJC A;  2BT6 A;  3GB1 A;  3ZJU A;  2CU3 A;  2GI9 A;  1Y56 A;  4C7Z A;  4L2Y A;  4YSX B;  3NZ3 A;  1SE4 A;  1P7E A;  1PGA A;  1NEN B;  3R8B A;  2JYT A;  2WXH A;  4YTP B;  2L83 A;  1FNU A;  4MAC A;  4A6Q A;  2V0G A;  1VDV A;  1C76 A;  1IGD A;  3BZD B;  2JSV X;  2KAJ A;  1T6B X;  4MM3 B;  1XXG A;  2BYT A;  2WXG A;  4FXC A;  2PVG C;  1JWU D;  2RMM A;  1D5M C;  2Y5P A;  1YN5 A;  3EUB 2;  4P6V F;  1TS3 A;  1XCQ L;  1UUP A;  2ACZ B;  1ZE3 D;  2LFI A;  2LJI A;  4J3O D;  5TSS A;  4XDC A;  1PGX A;  1QOF A;  1MPE A;  1TS2 A;  1WXQ A;  2LUM A;  1TKE A;  4WH4 A;  2K0P A;  2BS3 B;  5D7G A;  1NEK B;  2I2Y A;  2KWD A;  1NYR A;  3RFZ B;  3TEW A;  2WXI A;  1L4D B;  4WWM A;  4A55 A;  1F77 A;  3AE1 B;  4C56 C;  1JWB D;  3Q8A A;  1EWC A;  2JYE A;  1YQ4 B;  5FK9 C;  1L5P A;  2D5G A;  3AE6 B;  1C79 A;  2L32 A;  3AE7 B;  5I4D A;  2IDY A;  2OED A;  4RGT A;  3IT6 B;  3P1M A;  2K22 A;  1F2R C;  3DWG C;  1RYJ A;  5H92 C;  1ET6 A;  3DWM A;  4RGO S;  1C77 A;  1FCC C;  1V1P B;  2FUG 1;  2JQR B;  3C8Y A;  3MP9 A;  1PYW D;  2Y5C A;  3IXS A;  1ZDX A;  2PIA A;  2K5P A;  3T3N A;  3MC0 B;  1WGK A;  3AH7 A;  4YTN B;  4RGN A;  1GB4 A;  4EE2 A;  1YN3 A;  4A90 A;  1HQR D;  2PW9 A;  1T3Q A;  1V8C A;  2PKO A;  3KWL A;  1MHX A;  4HKQ A;  4PT5 A;  5BMI A;  1SSN A;  3BK1 A;  1JAL A;  4RF0 A;  3NVW A;  1N60 A;  2JWU A;  1FFV A;  1FRD A;  4HRS A;  3ZJT A;  5BMH A;  2VZK B;  3P63 A;  1PUT A;  1IBX A;  4OHJ A;  3AE2 B;  1C4C A;  2BS2 B;  1LO5 D;  5C3J B;  2WLB A;  1T5X D;  3BVG A;  4P16 A;  2WXM A;  2JXT A;  1SE2 A;  4OZA A;  2LMC A;  3L4P A;  4LTU A;  2J52 A;  3R2I A;  1C9F A;  1CK1 A;  3NRZ A;  3BYY B;  3VRB B;  1JWS D;  3Q69 A;  4GDL B;  2CJO A;  1TZO A;  2ON8 A;  2PMV A;  1WSP A;  1GB1 A;  1C4P A;  3TSS A;  1JQ4 A;  1QOA A;  1FFU A;  2RDH A;  5C2T B;  2L1A A;  3AV8 A;  2WQY B;  4ZRQ A;  2HDE A;  1J7A A;  4ZRP A;  3AM9 A;  4ZYS A;  1STE A;  2QEJ C;  4JWU C;  1PGB A;  3U52 E;  2RDG A;  2MJ3 A;  2W3S A;  1TY0 A;  1HA5 A;  4JWS C;  4MH8 A;  3FAH A;  2LHE A;  3FIL B;  1YN4 A;  3N9Y C;  1K53 A;  3PO0 A;  2WDR B;  3URY A;  2H89 B;  3U2S C;  1L6V A;  2N9L A;  2V3N A;  2WU2 B;  3NVZ A;  2J42 A;  2QIL A;  3NS1 A;  3Q8E A;  4WAF A;  2NTS A;  1AW7 A;  1JWM D;  4YWG G;  1JML A;  4B0M A;  1N62 A;  2W55 A;  1SJH D;  3B2G A;  3KWV A;  2LGI A;  4LK0 M;  2DLB A;  1J7B A;  5AUI A;  2WXJ A;  4A9A A;  4OVZ A;  5MPO A;  1QOB A;  3EGR A;  3P4S B;  4WIP A;  3KLS X;  2ZW1 A;  3AEC B;  4AQ7 A;  3ZJV A;  1NI3 A;  1XLP A;  1ROE A;  2YEP B;  3BII D;  4JPS A;  2WXN A;  1KH0 A;  1VJK A;  3E9S A;  3MFG A;  4L1B A;  2H88 B;  4ITK A;  2FBW B;  2Y3A A;  2X38 A;  2AQ1 B;  4RF1 A;  4CQN A;  1NYQ A;  1KLG D;  1VZ6 A;  1XLO A;  3V05 A;  2OHF A;  1UWM A;  2K3U A;  2GRI A;  4KKJ A;  1R7S A;  2PTL A;  1DOX A;  3I57 A;  1VRA B;  1XLN A;  3AEF B;  3VR9 B;  2G9H D;  2RPV A;  1AWD A;  4L23 A;  1XEE A;  1YJJ A;  1B1Z A;  4M0W A;  5FR3 A;  4TQ1 A;  2JU6 X;  1ZUD 2;  2ZW0 A;  1TS4 A;  1HEZ E;  1N63 A;  1PDX A;  1MI0 A;  5HFY A;  4RFB A;  2MJD A;  1ZP0 B;  5EE3 A;  1YJI A;  2ICI A;  1FCL A;  4H2A A;  3TUO A;  2N7J A;  5AUK A;  4TSS A;  1SF0 A;  2BBC A;  1ET9 A;  4KGS A;  1N61 A;  4US8 A;  1OQR A;  1QT9 A;  2KDM A;  1BML C;  3Q8F A;  4HRO A;  1QLB B;  5D3I B;  4YSZ B;  1I4X A;  2EEL A;  2J53 A;  2MH7 A;  1YMH E;  4LLG M;  1HXY D;  3GS2 A;  2BW2 A;  1TS5 A;  3AED B;  1GOZ A;  1I4R A;  1ZXH A;  3V3X A;  2GB1 A;  3MHZ A;  4C80 A;  3P4Q B;  2Q5W D;  1AYF A;  1Q10 A;  4OZC A;  1BUI C;  2AQ3 B;  4DQO C;  3Q8C A;  1AN8 A;  3PZ8 A;  5HG2 A;  4XE0 A;  1EU4 A;  1A70 A;  2V4I B;  1SEB D;  2IJ0 A;  3U4E G;  2WXR A;  1KF6 B;  1SE3 A;  3E56 A;  1EU3 A;  2DBY A;  3AE4 B;  3H8H A;  1WWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...