1GFDA

Solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
b'GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Solution structure and ligand-binding site of the carboxy-terminal SH3 domain of GRB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Adaptor protein containing sh2 and sh3
total genus 9
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gfdA00
2DL3A 1T0HA 2CSQA 2D8HA 2AK5A 2JTEA 4CC2A 2KT1A 2LJ3A 1AZGB 2CT4A 4AG1C 2BTTA 1WI7A 1K1ZA 3THKA 3VS1A 3EG2A 1AWJA 2EPDA 4D8KA 1NYFA 2DL4A 1GRIA 3A98A 2DBMA 4J9FA 4J9DA 4IIMA 2GNCA 1YWOA 2VVKA 5IXBA 2LZ6B 1WIEA 1UJYA 1LCKA 1PNJA 2GGRA 4LNPA 4CC4B 2J7IA 1FMKA 4OMNA 4RTTA 1UFFA 1K76A 4JJBA 4HXJA 2O88A 1OEBA 2B86A 2ENMA 4HVUA 1E6GA 2A08A 1QWFA 2CH4A 2ESWA 2X3XD 2KROA 3NMZC 2HDAA 1VYUA 4K11A 2KXDA 3SHWA 2EYWA 4LUEA 1E6HA 2KR3A 1W1FA 2LMJA 2DX1A 2MCNA 2E5KA 5FW9A 5HCKA 1UDLA 1ZX6A 1AOJA 2PNIA 4DEXA 2LJ0A 2FRYA 3RNJA 4OMLA 2KGTA 2LP5A 2FRWA 2EGAA 5I11A 2YDLA 1A0NB 2L2PA 1ZUKA 2CDTA 1ZBJA 2FO0A 4OMPA 1X69A 1SHGA 1VA7A 2LX7A 2DNUA 1BK2A 1RI9A 3R6NA 2DE0X 1K0SA 2RN8A 4AFQC 1YNZA 1VYVA 2AZSA 1X43A 2KT8A 2KRNA 2RQWA 1MV0B 2M51A 2D8JA 1PKSA 3U23A 1W6XA 1PKTA 1Z9ZA 2YT6A 3UA7A 3NGPA 2K3BA 2D0NA 3TSWA 1I0CA 3SEMA 3O5ZA 2O31A 3VS7A 2DLPA 1RLPC 3GBQA 1SRMA 4QT7A 1U5SA 1H8KA 4RUGA 1NYGA 1X27A 4RTYA 5IHKA 1M3AA 4GBQA 1UJ0A 2EVRA 4AG2C 1ARKA 1H92A 2ROTA 1OPLA 1PRLC 1GBRA 4LUDA 1I07A 4RTZA 3ULRB 2F2VA 2FPEA 1U06A 2L3PA 3IQLA 2KBTA 2K2MA 5ECAA 2EGEA 2CT3A 2CUDA 1J3TA 1JXMA 2W0ZA 1HSQA 4OMOA 1QLYA 2DYBA 1ABOA 3ZL7C 4RTUA 2P4RA 1K9AA 1K4US 1H3HA 1XOVA 2RMOA 2XMFA 5IHNA 2YUNA 2DL5A 1T0JA 4Y92A 2C0IA 4D8DA 1X6GA 2KYMA 2QDLA 2KEAA 5FWCA 3EGUA 3C0CA 1E7OA 2JM9A 1TUCA 1KSWA 1OV3A 1M8MA 2J06A 4GLMA 2DL8A 1JEGA 1YCSB 1WLPB 1UHFA 2DM1A 1M30A 4R0KA 3VS5A 1ABQA 1X2KA 2GBQA 4EIKA 3VRZA 5GJVB 2DVJA 3CQTA 1M27C 1EFNA 2FG0A 3M0UA 1UG1A 1WFWA 3PVLA 1KJWA 2KE9A 1TG0A 2DMOA 4Z89A 2PTKA 3H0IA 2YUPA 1MV3A 1GCQC 3VS2A 1TUDA 1X6BA 1AEYA 1YP5A 3VS0A 2DL7A 4LN2A 2JMCA 1B07A 1QKXA 2EYXA 2X3WD 2L3QA 2SEMA 1QWEA 1N5ZA 2JS0A 4HCKA 1SPKA 2MOXA 2RQRA 1WXTA 2H8HA 4AFUC 1QKWA 2DA9A 1QCFA 1PRMC 1BU1A 1GFDA 1S1NA 3H0FA 4J9IA 2GTOA 3H0HA 3EHRA 1ZSGA 2A36A 1KIKA 1SHFA 2AZVA 4KRTA 2J6OA 3REBB 2LQNA 2BZ8A 3M0SA 2J05A 4HVWA 4F14A 2DILA 1UE9A 1I1JA 2JMAA 2IIMA 1JU5C 2L3SA 1Z9QA 1WDXA 2LNHB 2W10A 3I9QA 1T3LA 2ED1A 4RTWA 3JV3A 2RQTA 2LQWA 4DEYA 2YUQA 2KYBA 2V1QA 1ZUUA 2ROLA 4J9BA 4CC3A 1SEMA 1BB9A 1ZUYA 1X2QA 1V1CA 2DJQA 2RNAA 2JM8A 1Y0MA 4M4ZA 1VYTA 5GJWB 1AD5A 1RLQC 2DBKA 3EG3A 4J9EA 3QWXX 4J9HA 2GQIA 4ESRA 2K7AA 5L23A 2YSQA 2J6KA 2NUZA 1W70A 1WXUA 2ABLA 4Z88A 2O9SA 1HJDA 4RTXA 2LCSA 1AWXA 4AFZC 4AFSC 2ED0A 3M0TA 2A37A 2V1RA 3M0RA 1BBZA 1GCPA 1PWTA 1CKBA 1KFZA 1SSHA 3PE0A 1U3OA 1G2BA 2CSIA 2D1XA 3I5RA 3UF4A 2CREA 4E6RA 2FEIA 1CKAA 3PVQA 1M3BA 1UTIA 5EC7A 1NM7A 4JJDA 4IIOA 1AWWA 5IH2A 2KRSA 4ORZA 4A63B 4OMMA 2OJ2A 4X1VA 2JXBA 1OOTA 2CUBA 1WXBA 1AZEA 1M3CA 2A28A 1UECA 2I0NA 2BZYA 1T3SA 1JO8A 2FPFA 2M0YA 2MIOA 2EBPA 2KXCA 1NLOC 1IO6A 4ZNXA 2G6FX 1RUWA 2EYZA 2JS2A 1JQQA 5FWBA 1G83A 2EQIA 3RBBB 2HEQA 2DF6A 2F2XA 1UUEA 1NG2A 4CC7A 1GBQA 2EKHA 1PHTA 2O2OA 2YUOA 1MUZA 2JW4A 2C0OA 2CH4W 1ZLMA 2DRKA 2C0TA 2KRMA 2RF0A 1GL5A 1UGVA 2J6FA 2PZ1A 2F2WA 2LJ1A 3REAB 1YWPA 4OMQA 1OPKA 3LH5A 2RQVA 1WA7A 3VS4A 3NHNA 4J9GA 1NEGA 3VRYA 1FYNA 1HD3A 2O9VA 3EG0A 3NPFA 4JPBW 4FSSA 3KFVA 3VS6A 2K9GA 1GCQA 4LE9A 2NWMA 3UATA 1GFCA 3VS3A 3UA6A 1AWOA 2GTJA 2K6DA 1B3QA 2K79A 2RQUA 4JZ4A 2HBWA 4JJCA 3EG1A 2EYYA 2OAWA 1NEBA 2VKNA 2EW3A 3EHQA 3TVTA 3M0QA 1UHCA 4HVVA 1JXOA 1NLPC 3TSZA 2OI3A 3M0PA 2ECZA 5IHIA 2FPDA 2JT4A 2EGCA 2RPNA 2HCKA 3QWYA 1CSKA 1WYXA 4J9CA 1WX6A 5IXFA 1K0XA 1YN8A 4F17A 3FJ5A 3I5SA 2HSPA 4JZ3A 2VWFA 1AVZC 4WCIA 2BZXA 2KNBB 2L0AA 4RTVA 2AKLA 1SRLA 2SRCA 2DRMA 4Z8AA 1Y57A 4F16A 2AKKA 3I35A 3H41A 5I22A
chains in the Genus database with same CATH superfamily
2DL3A 2D8HA 2AK5A 1BIBA 3A8GB 1RACB 5HY6A 4B9XA 2EQUA 1K9MR 5M9OA 1VQNQ 3WVDB 3M56A 3P8DA 2LDMA 5A2QE 3THKA 2EPDA 1Q82R 2Y90A 1QVPA 4IUQA 5FU6B 3OSSC 1KD1C 2NUTA 4J9FA 3NTIA 5GAN8 1K73R 3CCRQ 1YWOA 2LZ6B 2B8AA 4QVDA 3EFOB 3CCJA 4IUPA 4JDSA 4OMNA 4L59A 3CCUQ 4F7UE 4HXJA 4PLLA 1E6GA 2A08A 5D6WA 1VQLA 2E70A 2KROA 1WPYA 2KVQG 2WSCE 3NMZC 4M77G 3HL8A 1MMGA 3L1AA 1D1CA 3CXCP 2M16A 5GMKm 4MMLA 4WTOB 1E6HA 3SD4A 5HCKA 3EGDB 1Q7YC 1UDLA 3CC2Q 2PNIA 4DEXA 4M7DA 2LJ0A 5D7UA 2RD1A 5AYFA 4C0DB 5GAMg 5GAN2 3C12A 2YDLA 5GMKj 5LJ5d 2NLUA 1X69A 4HCBA 2PVDB 2LX7A 1OU8A 2DNUA 4NL2A 5GMKe 2HNIA 3PIPA 5FRMA 4KBMB 4BE2A 1GXIE 3JRZA 4KUDK 1K0SA 2RN8A 5CKHA 3C95A 5FU7C 5FU7B 1M5Q1 3L2VA 4M7AD 1MV0B 1YJ9A 3G4SQ 1W6XA 1Z9ZA 2YT6A 3M55A 3G1JA 5DLQE 2ZPGB 3SEMA 1ZBXA 1RLPC 3G6EQ 3JB9F 1NYGA 4M77C 4E7JA 4M77B 3EG9B 1UJ0A 2EVRA 4RCCA 2RO0A 1PRLC 1D0ZA 2MWPA 4LUDA 1LVKA 4NS5A 5GAOm 2L3PA 1KG1A 4XTWA 3M4YA 1WJRA 1P92A 5ECAA 4X9DA 2CUDA 1J3TA 2JUFA 2YHTA 2W0ZA 3CD6A 2DYBA 1ABOA 3CCEQ 3I55A 3CD6T 2E4HA 3HPWA 3OYKA 1N8RU 3DB3A 3JCMP 2A3LA 3MEUA 2RMOA 1Y7XA 3JCMd 2F5KA 4FIBA 2KMTA 3OQ5A 2PQWA 4D8DA 1X6GA 1MHNA 1RL2A 5FWCA 1RAEB 2DTIA 1TUCA 3J7AF 1M8MA 4GLMA 4PJLA 1JEGA 3BE3A 3V7CA 1M30A 1KHCA 3VS5A 1ABQA 3X25B 1MNDA 2E41A 3VRZA 3L2UA 3E1SA 3NFCA 3HP9A 4BI4A 1EFNA 3M4GA 3META 1BI3A 3FDRA 1VQ5T 3MKDA 1OQKA 4ZGEB 1RABB 3H6ZA 1RADB 4WF2A 3G71Q 1MV3A 2LQ8A 3SWNA 1AEYA 2DIQA 2XHCA 3VS0A 2SEMA 4M78A 3NTKA 1HYOA 1KQ1A 1SPKA 3A1PA 1D3BB 4LDWA 3E9GA 1YJWA 1OYXA 2XKOC 1QKWA 2DA9A 3CC4Q 1WNLA 1S1NA 3H0FA 4NOYA 4XU0A 1I5OB 2GTOA 2KAFA 2DFUA 4BDYA 3JCMQ 2E6ZA 2J6OA 2LQNA 2BZ8A 3M0SA 2J05A 4J83A 3VV0A 1QMCA 4M7AC 1JU5C 2L3SA 1WDXA 3EAEA 3JV3A 3FLGA 8ATCB 2ROLA 4J9BA 4CC3A 2QTVA 1IZ6A 1WJSA 5GAN5 5CKFA 2DD4A 2CZ1B 2HQXA 1Y0MA 3JCMW 1VYTA 1ZSZA 4KH0B 4J9EA 1VQ8Q 3QWXX 4J9HA 3OW2A 4J8OA 4FW2A 1TSFA 1WXUA 4E47A 2XDPA 2ABLA 3OY9A 2P4TA 1M1KU 1VQ6Q 3M0TA 3L42A 2LNVA 4J7IA 1BBZA 2MYSA 4QKUA 1Y71A 3PE0A 2RI3A 2HL5C 2CSIA 3A8HB 3MCAB 4E6RA 2FEIA 2QAZA 1CKAA 4EMKA 5GAOq 3CBMA 2JJ9A 5CAIA 3CMAQ 1M2VB 1I5LA 4M77E 3O8VA 4A63B 1OOTA 3BW1A 2CUBA 4DQ2A 1VQ4Q 2A28A 1UECA 2MIOA 3F70A 2HD0A 4ZNXA 2QA4Q 1JQQA 4PK4A 3OW2S 3JCMh 1NBEB 2HEQA 4CC7A 2ZPEB 4PJOC 1ZLMA 2C0TA 1IB8A 2BIVA 3REAB 3HRUA 1OZ2A 1UGRB 1ZHIA 1NEGA 4PJMA 2X4WA 2F1LA 1HD3A 3CCSQ 4FSSA 1YI2T 3M57A 3ZEHA 2A0FB 3UWNA 3RUXA 5CKEA 1QVFP 4OGCA 1GCQA 3MJXA 4MZMA 1QVGS 3HFNA 5GAMd 2FVUA 2GTJA 2NUPA 2HBWA 4C8QA 1KC8C 3X28B 4PJOA 2DO3A 4FW1A 2VKNA 4DBRA 3TVTA 5J26A 3PIOA 1W2BP 1SF9A 2ZGWA 2ECZA 3MEAA 2X4YA 3HTRA 3JCMg 1WX6A 5IXFA 3CMET 4LDVA 3FJ5A 1K9MC 3KXTA 1VQPQ 3FIFA 4WCIA 2BZXA 2KNBB 2L0AA 5FROA 4RTVA 5LJ5j 4A4EA 3QKJA 3EGXB 3GIBA 5LJ5e 4JJNK 5I22A 4QQDA 3M54A 1SSFA 1EX4A 1K73C 5KYWA 1YJNQ 1VQOQ 2CT4A 4F7UA 3QYGB 1KD1U 4M75D 4E7HA 5GAN7 2NYSA 2CP6A 2JTFA 2LT1A 2MI6A 5A0LA 4M7AE 5FLXE 1NYFA 2DEQA 2DL4A 1GRIA 4OB1B 2DJZA 3A98A 1V29B 3OYCA 2VVKA 4FYXB 1LCKA 1PNJA 4CC4B 4BI8B 3SB2A 4C92F 1FMKA 1UFFA 1K76A 2G3RA 1Q86R 2B86A 4LXCA 3DLLA 4CI0C 1B34A 2CH4A 1Q95G 4FSXA 1N8RR 3CCMQ 2K2VA 1N6AA 1H3ZA 2HDAA 2I2LA 4HA8A 3PFSA 2K4YA 2EYWA 3QJ6A 1W1FA 2K3YA 4OMFB 2DX1A 3QYHB 2MCNA 5DLOA 3V8LA 1ZX6A 3M5AA 5D6XA 3TQ7P 3J81E 3JB9H 2RI5A 1JJ2P 2V8IA 4L6V5 1M2OA 1XNIA 1WZOA 1G3TA 1M90U 1NE8A 2COWA 4FU6A 1ZBJA 2FO0A 2DZCA 4ELZC 2RHZA 1VA7A 2GFAA 2CS7A 2O4XB 2YRVA 1TTHB 2QEXA 1VYVA 4N0AC 2AZSA 2M51A 5I2SA 4M75G 2D8JA 2QEXT 1PKSA 3U23A 1NJIU 1PKTA 3UA7A 3NGPA 2RB6A 4OB3B 4QQGA 2D0NA 2HBPA 3TSWA 3CCLA 4JRKA 2O31A 3C94A 4DBQA 3GBQA 3LWIA 4QT7A 1U5SA 2CZ7B 4C0GA 4QW2A 5LJ3e 4RUGA 3ZBDA 1IRXA 2EJGA 4M7DF 3CPWS 1YITQ 1ARKA 2ROTA 1OPLA 4OP0A 4A54A 5KE2A 1GBRA 3LWHA 3OYFA 3BFMA 3ULRB 4RG2A 4ANJA 2WACA 3CCVQ 1D0YA 4A4KA 4GY5A 3HSBA 2L5QA 2EGEA 4CRIA 5KYUA 2QTXA 3GOXA 2DEUA 2NUTB 5GAMh 1QLYA 3CCQA 2KI7A 3UPUA 4RTUA 5FU6C 1IGUA 1VQNA 3CCQT 1N9RA 4A4GA 3OYNA 1H3HA 1XOVA 4KUIA 1VQNT 2XMFA 1IREB 5GANd 3JB9D 3OYYA 4HKEA 2RJCA 2PVOB 2C0IA 1TUGB 2KYMA 1WQWA 2KEAA 4M75C 4M75B 4RKUE 3CCRA 3QIIA 1R0BG 3CCJT 2J06A 2H3JA 3S3MA 2M9UA 5LJ3f 2DL8A 3L2WA 1ACMB 2QQAA 2DM1A 1VQKQ 3CCUA 7AT1B 1UEBA 2GBQA 4EIKA 1VQLT 1OU9A 3CCUT 5GJVB 2QGGA 1Q81U 1M1KR 2DVJA 2O01E 3CQTA 2FG0A 3S3NA 2EJ9A 1MMAA 1QW1A 3OS1A 3CEYA 1ZQ1A 1YCYA 3EFOA 3V7RA 1X01A 1PM3A 2KE9A 2DMOA 2XU8A 4Z89A 2AT1B 3CC2A 2PTKA 4XTYA 4C0DC 3N5BB 2YUPA 2K5LA 3TU4K 3VS2A 1TUDA 5HKCA 1KK7A 1BI0A 5GAOn 5KYYA 1N5ZA 4HCKA 2RQRA 2RHXA 3QBYA 1SG5A 2EAYA 1RI0A 1QCFA 4A53A 2QI2A 3EGDA 1UGPB 1GFDA 1OULA 1YJ9T 1ZSGA 2D9TA 1KIKA 3CC7A 3G4SA 1K8AC 4KRTA 5CK9A 3JB9G 2K5IA 3CC7T 4F14A 5CKDA 2FZGB 1I1JA 3OSVA 3AHUA 3I9QA 2LNHB 2W10A 1N9SA 1RAHB 2LX9A 3G6EA 4B6MA 5CQXA 2LQWA 2QASA 3EH1A 2ZPIB 2JTMA 4FL6A 1F1BB 1X2QA 1YBYA 5C6SA 2HL3A 4C5HA 2RNAA 4J5YA 1R0CB 4KGVB 5GJWB 1RLQC 1X6OA 3EG3A 3Q1JA 4M78F 2K7AA 1LPLA 2J6KA 2M02A 4JLIA 3CXCA 4OB2B 4Z88A 2E12A 2O9SA 1HJDA 1AWXA 3I55T 3A8MB 2E3HA 3CCEA 2ED0A 4M77A 1D1BA 3CD6Q 3M0RA 1PCXA 5GAMj 1PWTA 1CKBA 1MMNA 1G5VA 1SSHA 4Q5WA 1G3WA 1U3OA 1G2BA 2D1XA 3UF4A 5CQYA 4KULA 4TVRA 1M3BA 2DERA 2DIGA 4Z02A 4JJDA 4LDUA 3OMGA 4IIOA 4II1A 5GAOr 1AWWA 5IH2A 4ORZA 3A5ZB 3S3OA 2DPPB 3CBPA 2OJ2A 1JRIA 2CYZB 3OYHA 2JXBA 4MDXA 1WXBA 1AZEA 1JO8A 2QXFA 2E10A 1IO6A 3I56A 2JS2A 4DOWA 1VQ5Q 3I56T 4QQ6A 2X4XA 3HKSA 3RBBB 2HKQB 2YXYA 4E7SA 2EQKA 5GANh 2F2XA 1NG2A 4N4IA 3G71A 3CXCS 4BE0A 3OMCA 2EKHA 2XK0A 2O2OA 3CPFA 4Y91A 4EMHA 1GL5A 2PZ1A 2X9HA 3HHTB 5AT1B 2R58A 4M75E 1YJWT 2ZPBB 1PC0A 2ZCFB 2QQBA 3VS4A 1YIJQ 3VRYA 3RKYA 2LC4A 2GQVA 2DETA 2XI9A 3CC4A 1FYNA 2O9VA 3NPFA 4BB7A 4BE1A 1KQSP 3UATA 1MNEA 2MMPA 2NWMA 3URGA 1KC8U 1FMWA 1S72A 2FHDA 1S72T 1ZSZB 1D3BA 2DAQA 2EYYA 1M90R 2OAWA 1NEBA 3LW5E 3OBWA 3FC3A 4HVVA 1JXOA 1NLPC 4XU1A 3VJPA 2RPNA 2HCKA 1CSKA 1WYXA 4J9CA 5GANg 1TU0B 4F17A 1BI2A 5FRNA 4F04B 1PSFA 1VQ8A 4M7AA 1SRLA 2SRCA 1NJIR 2DRMA 2L3RA 1VQ8T 2RHUA 3WVEB 4F16A 4C0ZA 4PFPA 1IHWA 1T0HA 3MP6A 2XDBA 2LJ3A 4EMKB 3LLRA 4ZN3A 2COYA 2QQRA 2ATCB 4AG1C 2BTTA 1WI7A 5J39A 2ZPHB 3VS1A 3A8OB 3INZA 4ZTJA 4D8KA 3OYMA 1PSEA 1Q86C 3L2RA 3E2UA 1QVGA 4C8QF 4PJOF 2QDYB 3QJYA 2KQWA 2OTJQ 4J9DA 4IIMA 2GNCA 5IXBA 1WIEA 3CMAA 4MZPA 4ATOA 4LNPA 4MDWA 2FZCB 2RK1A 4RTTA 1MGQA 2PUOB 2O88A 3EFSA 5KCOA 1VQ4A 3JCMc 2QYZA 2MK5A 1VQ4T 2HQEA 3S6WA 1AT1B 2EQMA 3ZFJA 2DVEA 2QA4A 3OB9A 4K11A 1U1SA 1VQMA 2KXDA 3SHWA 2Y4YA 1D0XA 2QA4T 3KBGA 2KR3A 1VQMT 1QP2A 2CP7A 3GLXA 1WJQA 2FB7A 4F7UF 5GANj 2FRYA 3NTHA 2KGTA 2LP5A 1YHQQ 1UGSB 1QCOA 5I11A 1A0NB 2X35A 1ZUKA 3X20B 4C92D 4OMPA 1Q81R 1B7TA 4BI3A 1SHGA 1OI1A 3R6NA 1RI9A 2NUPB 1AHJB 4C8QB 2DE0X 2HQHA 1IHVA 2KY9A 4D6WA 3CCSA 4E7LA 5IN1A 1X43A 2RQWA 1YI2Q 1BKBA 3FEOA 4PNOA 2K3BA 2D0QB 5HK3A 1EZZB 3R6OA 1WHJA 3VS7A 2DLPA 2CZ6B 2VGMA 3HRSA 2QG9B 2YRDA 3OS0A 5IAYA 3MEWA 2K5FA 5IHKA 4IKFA 1M3AA 3MPUB 4GBQA 5EG2A 4HCCA 4XK8E 5KYWB 4JRIA 1VQPA 5L8RE 3M58A 3CMEQ 1UGQB 1Q82C 2DK3A 2L89A 3VUBA 1U8RA 1BYMA 2F2VA 1U06A 4ZTFA 3G7ZA 2K2MA 1M4ZA 3MO8A 2CT3A 1JXMA 5A0DA 5KE3A 3DB4A 1HSQA 3VKIA 2P0KA 1WGSA 3FJPA 3TEEA 1YJNA 2OTLA 4HT9A 3ZL7C 3J80E 5I21A 1M9SA 2P0QA 2OTLT 1K9AA 1K4US 1M1GA 4QVZA 2DXBA 2YUNA 4Y92A 4C92G 1QP3A 2QDLA 4FT4A 4M7DD 4LDXA 1O75A 4OVAA 4JRPA 3C0CA 3EH2A 2YLBA 3X26B 1OV3A 5GAOp 2KDSA 1YCSB 2LCLA 3PMIA 1WLPB 5LJ3g 1UHFA 2F69A 3ME9A 3QDFA 2RHIA 4R0KA 3M9QA 3MEVA 1VQ9Q 4ZGJB 1X2KA 2RK2A 2R57A 1VQ7Q 3OYAA 5KYXB 2R5AA 4RG8A 3CPWA 1Q7YU 3A8LB 4R55A 3OYDA 3CCMA 1O9SA 5LJ5f 4ELYC 1M27C 4ZN1A 2V8JA 2VYTA 2JOYA 1WFWA 3QHSA 3PVLA 5HK0A 1W2BA 2XG8D 1V76A 1KJWA 1TG0A 2V8KA 4JS4A 1YFNA 4RMOA 3BDLA 1X6BA 3JCMe 3C4SA 2DL7A 3WXMB 4LN2A 2JMCA 1QKXA 2ZAEA 4X34A 5C0MA 5DM7R 2EYXA 1BCMA 1PD1A 2X3WD 2L3QA 1RAAB 5GMKh 4IUVA 2JS0A 2MOXA 5GAOl 1JBMA 4AFUC 2RJEA 4DOVA 4JS5A 1K8AU 4J9IA 4C92B 2A36A 1SHFA 2QEXQ 1Y96A 2L8DA 4AT1B 4DBFA 2KK4A 3CCLT 1ZA1B 3JB9I 4HVWA 3DLMA 2DILA 2IIMA 4M7DG 1QVFS 3E19A 1KQ2A 2HAXA 2ED1A 1WHMA 3HFOA 1SEMA 3PGGA 4N0AA 3GNFB 1YITA 2X51A 2AHJB 1LJOA 3QZ5B 3JCMf 1W2BS 3SDZA 2OAUA 2GQIA 3FB9A 4KT0E 3E9FA 5A0GA 3ER0A 4RTXA 4P5NA 2LCSA 1RAFB 3RIRA 2R5MA 3CCQQ 1JJ2A 3LYIA 1Y07A 1GCPA 1RAGB 1KFZA 3MHXA 4BACA 3CBOA 2VXEA 2CREA 3CCRT 2D6FA 3JCMJ 2BUDA 1UTIA 5EC7A 2DKGA 2CP5A 2E3IA 3PMTA 2MF2A 2LRQA 1OX8A 3CCJQ 3MP8A 4Y28E 2KRSA 1BI1A 4M78D 2CP2A 4R56A 1VQKA 4M7DC 2DTHA 1MMDA 4M7DB 3OYEA 3GF5A 4X1VA 4FM4B 1VQKT 2H3EB 2VB6A 1VQLQ 2VGNA 2BE9B 1M3CA 1G8XA 1UB4A 2I0NA 2FPFA 2YRCA 1IXDA 1FXXA 4E7IA 2VV5A 3H9NA 1NLOC 3EFRA 4M75A 2G6FX 2EYZA 2V26A 5KYYB 1R77A 3CC2T 2EQIA 2K3XA 3L2QA 2DF6A 4IURA 4M77F 4AMCA 1PHTA 1MUZA 2C0OA 2DRKA 1SKUB 2VC8A 3LX7A 2KRMA 1UGVA 2J6FA 4E2FB 2LJ1A 1YWPA 9ATCB 3V8KA 3AT1B 2JNGA 1JJ2S 3JSCA 6AT1B 3KUFA 1BIAA 4J9GA 4RCBA 3TREA 1XTDA 1M90C 3EG0A 4JPBW 1I81A 3VS6A 1TXQA 3G4ST 3RKWA 2HKNA 1YJ9Q 3JCMX 1HK9A 2A7YA 5CKBA 3PT9A 1FX7A 1GFCA 3VS3A 4DBHA 1D1AA 3CC7Q 4QVCA 1AWOA 3OS5A 2BKDN 4JZ4A 3G6ET 3JCMV 5CIUA 4JJCA 5KH6A 3GNGA 2PUKB 1G3SA 2EW3A 1NJIC 3EHQA 4BUGA 1UHCA 4M78G 5IHIA 2CKKA 2FPDA 2EGCA 3QPHA 4PFZA 4J6YA 5KYNA 2EYQA 1D09B 2PU9B 2CZ0B 1VIFA 4ME7A 4JZ3A 2RHYA 2VWFA 5LL6S 4PJNA 1NPPA 2MAMA 2AKLA 3ASKA 2IG0A 4Z8AA 1N27A 2AKKA 3I35A 3H41A 3EG9A 2CSQA 3L2ZA 4KH1B 4C5IA 3CCET 2JTEA 2FL7A 4CC2A 2KT1A 4C92E 5I2MA 4IUUA 1DJ7B 3I55Q 1AZGB 1Q86U 4YTLA 2RH2A 5GAMe 3M53A 1K1ZA 2PVGB 1AWJA 3EG2A 2LQKA 4FYVB 2DBMA 5CR2A 5CVIA 3OBYA 1C0MA 1XQHA 2HMAA 1UJYA 1X75C 2GGRA 2J7IA 3OYLA 3OA6A 1WHKA 3JAME 4JJBA 3SWNC 2QQSA 1KD1R 1OEBA 2ENMA 3SWNB 4HVUA 4M7AG 1QWFA 2BE7D 4A4HA 2ESWA 2X3XD 1NPRA 4M78C 3OW2P 4M78B 4M7AF 3SFMA 2M1HA 3M59A 1VYUA 3QZ9B 4LUEA 1VQ5A 1Q81C 2LMJA 4BDZA 2E5KA 5FW9A 5LJ3d 3I56Q 3G71T 1AOJA 3QUIA 3UT1A 4C5EA 4C8QD 5J3BA 1QCNA 3H8ZA 4LD6A 4PJOD 4OF1A 4E7KA 4A4FA 2IVWA 5GAMf 1NZ9A 4FYYB 3RNJA 4OMLA 2EWNA 3QSUA 2FRWA 2EGAA 2L2PA 2RI2A 4JUVA 2EJFA 2CDTA 3RR6A 1PD0A 1YJWQ 2E5QA 1BK2A 1TH7A 2OX7A 3CC4T 1Q7YR 1YIJA 1QVGP 4V2SA 4O5VA 2LT4A 2IPOB 3D7SB 1YIJT 4AFQC 1YNZA 4M7DE 2KT8A 2KRNA 2X4JA 1U1TA 2VXFA 1KHIA 1ZA2B 1ZSZC 3RMQA 3TCJA 2JVVA 4KGXB 1I0CA 3O5ZA 4XAXB 1S72Q 4BD3A 4NL3A 1VOMA 1SRMA 1K9MU 3QO3A 4HT8A 1H8KA 4FYWB 4VUBA 4M7AB 3UDCA 1X27A 4RTYA 1Q82U 2LVMA 1FWZA 4AG2C 3VYHB 1C1AA 1H92A 1K8AR 2XDDA 5IT9E 2VASA 1K73U 1I07A 5GAN4 4RTZA 5LJ5h 2FPEA 2RA2A 3IQLA 4BY6C 2KBTA 4EMKC 4BY6B 1VQ6A 3VYGA 1G3YA 4J6XA 1EIFA 1VQ6T 2P0PA 4OMOA 3BDUA 4O6JA 2ZZDA 4C8QG 4PLIA 4PJOG 2P4RA 1HXDA 4E7ZA 5IHNA 2EIFA 2DL5A 2GFUA 4JRQA 1T0JA 1N8RC 1WHHA 4PJJA 3V8JA 3X24B 4C5GA 1XJWB 2OTJA 2EFIA 3EGUA 1E7OA 2JM9A 3CMAT 1VIEA 1KSWA 2OTJT 2QQ9A 3OYJA 2WSFE 4PL6A 1KQSA 4DA4A 2WSEE 4KGZB 3GPLA 3LGFA 2DZ9A 1WHGA 5GAN6 2HSEB 1FMVA 4EMGA 4GLKA 3HRTA 2F5TX 3M0UA 5LJ5g 1UG1A 1M2VA 4F7UG 3RMSA 3QDRB 1BCOA 1VQMQ 3H0IA 1GCQC 1YP5A 1C6VX 2MWOA 3VU3C 5GANe 1B07A 4PKCC 1YHQA 1QWEA 4C8QC 2DD5A 2JN0A 1YHQT 4PJOB 2E6NA 1WXTA 2H8HA 4B9WA 3P8HA 3V7SA 1TOVA 3CCST 1PRMC 2E1HA 1BU1A 2QGFB 1I4K1 3H0HA 3EHRA 4EPCA 2KSSA 1YI2A 2DTOA 2AZVA 4FCYA 3REBB 4M78E 4C0FA 3MP1A 1UE9A 1KQSS 2JMAA 4J6WA 1OX9A 1R8OB 5LJ3h 1LOJA 1Z9QA 4N4HA 1W4SA 3CPWP 1T3LA 2E64A 4RTWA 4OGEA 2RQTA 2XIDA 5GMKi 4DEYA 2YUQA 2KYBA 2V1QA 1ZUUA 3FRNA 1BB9A 4UC4A 1ZUYA 3LGLA 1V1CA 2Y4XA 2DJQA 3JCMb 2JM8A 1VQPT 1PG5B 4F7UB 4M4ZA 1AD5A 4PFOA 5GANf 3CMEA 1TS9A 2DBKA 4ESRA 4XTVA 2CP3A 1WQ7A 2XICA 5KCHA 5L23A 5GMKl 2P84A 2YSQA 2FYKA 2NUZA 1W70A 4JLGA 5CO7A 2DYIA 1VQOA 3QXEB 2CGHA 1YJNT 1VQOT 3PTAA 2HZYA 4AFZC 4J7FA 4AFSC 2VUBA 5GAN3 4LD9K 2A37A 4LDYA 2V1RA 2E65A 2OTLQ 1M1KC 3EGXA 4XU3A 2DXCA 1B34B 4ZGDB 2DXUA 3PNWC 3I5RA 3PVQA 3QG1A 1NM7A 3OYGA 1QVFA 2RM4A 2MPXC 4OMMA 1I8FA 1VQ9A 1OZ3A 1VQ7A 3OS2A 4N4GA 3RKXA 1VQ9T 1VQ7T 2RJFA 3CCMT 2BZYA 1T3SA 2M0YA 2YWWA 2RJDA 2EBPA 2EKOA 4X9CA 2KXCA 3OYIA 2QK0A 1RUWA 4XQ3A 5FWBA 3LH0A 3RDVA 1G83A 2JZ2A 2COZA 2DXTA 1LNXA 1UUEA 1RAIB 1QQJA 4OB0B 1GBQA 4EDUA 2LTOA 4MZTA 5CCAA 5KYXA 2YUOA 2JW4A 2CH4W 1H641 3RESA 2RF0A 2F2WA 1Y96B 4OMQA 1JB0E 1OPKA 3LH5A 3BY7A 2RQVA 1WA7A 4HCZA 4C92C 3NHNA 4IUTA 3VUZA 2AIRB 2GF7A 5D6YA 5DY9A 2GCXA 3KFVA 1TWBA 2K9GA 3RERA 4LE9A 2EQJA 2C06A 4MMKA 1M8VA 1WHLA 2LCCA 3P8BB 3OYBA 3UA6A 1IGQA 3CCLQ 2K6DA 1B3QA 2K79A 2RQUA 3DKMA 1VUBA 4M77D 8AT1B 2O4XA 3EG1A 4M75F 3M0QA 5KYUB 2XD0A 3TSZA 5LJ3j 2Z0WA 2OI3A 3M0PA 4C92A 2JT4A 1YITT 3QWYA 2M0OA 1K0XA 1YN8A 4XTUA 3I5SA 4FT2A 2HSPA 3CCVA 3GP8A 3JB9J 1KC8R 2FZKB 1AVZC 2YLCA 3CCVT 4C8QE 4PJOE 4XU2A 1M1FA 1Y57A 2CP0A 2ZPFB 4L5GA 2K57A 4XTXA 4XTZA 3T9NA
chains in the Genus database with same CATH topology
2DL3A 1T0HA 2CSQA 2D8HA 2AK5A 2JTEA 4CC2A 2KT1A 2LJ3A 1AZGB 2CT4A 4AG1C 2BTTA 1WI7A 1K1ZA 3THKA 3VS1A 3EG2A 1AWJA 2EPDA 4D8KA 1NYFA 2DL4A 1GRIA 3A98A 2DBMA 4J9FA 4J9DA 4IIMA 2GNCA 1YWOA 2VVKA 5IXBA 2LZ6B 1WIEA 1UJYA 1LCKA 1PNJA 2GGRA 4LNPA 4CC4B 2J7IA 1FMKA 4OMNA 4RTTA 1UFFA 1K76A 4JJBA 4HXJA 2O88A 1OEBA 2B86A 2ENMA 4HVUA 1E6GA 2A08A 1QWFA 2CH4A 2ESWA 2X3XD 2KROA 3NMZC 2HDAA 1VYUA 4K11A 2KXDA 3SHWA 2EYWA 4LUEA 1E6HA 2KR3A 1W1FA 2LMJA 2DX1A 2MCNA 2E5KA 5FW9A 5HCKA 1UDLA 1ZX6A 1AOJA 2PNIA 4DEXA 2LJ0A 2FRYA 3RNJA 4OMLA 2KGTA 2LP5A 2FRWA 2EGAA 5I11A 2YDLA 1A0NB 2L2PA 1ZUKA 2CDTA 1ZBJA 2FO0A 4OMPA 1X69A 1SHGA 1VA7A 2LX7A 2DNUA 1BK2A 1RI9A 3R6NA 2DE0X 1K0SA 2RN8A 4AFQC 1YNZA 1VYVA 2AZSA 1X43A 2KT8A 2KRNA 2RQWA 1MV0B 2M51A 2D8JA 1PKSA 3U23A 1W6XA 1PKTA 1Z9ZA 2YT6A 3UA7A 3NGPA 2K3BA 2D0NA 3TSWA 1I0CA 3SEMA 3O5ZA 2O31A 3VS7A 2DLPA 1RLPC 3GBQA 1SRMA 4QT7A 1U5SA 1H8KA 4RUGA 1NYGA 1X27A 4RTYA 5IHKA 1M3AA 4GBQA 1UJ0A 2EVRA 4AG2C 1ARKA 1H92A 2ROTA 1OPLA 1PRLC 1GBRA 4LUDA 1I07A 4RTZA 3ULRB 2F2VA 2FPEA 1U06A 2L3PA 3IQLA 2KBTA 2K2MA 5ECAA 2EGEA 2CT3A 2CUDA 1J3TA 1JXMA 2W0ZA 1HSQA 4OMOA 1QLYA 2DYBA 1ABOA 3ZL7C 4RTUA 2P4RA 1K9AA 1K4US 1H3HA 1XOVA 2RMOA 2XMFA 5IHNA 2YUNA 2DL5A 1T0JA 4Y92A 2C0IA 4D8DA 1X6GA 2KYMA 2QDLA 2KEAA 5FWCA 3EGUA 3C0CA 1E7OA 2JM9A 1TUCA 1KSWA 1OV3A 1M8MA 2J06A 4GLMA 2DL8A 1JEGA 1YCSB 1WLPB 1UHFA 2DM1A 1M30A 4R0KA 3VS5A 1ABQA 1X2KA 2GBQA 4EIKA 3VRZA 5GJVB 2DVJA 3CQTA 1M27C 1EFNA 2FG0A 3M0UA 1UG1A 1WFWA 3PVLA 1KJWA 2KE9A 1TG0A 2DMOA 4Z89A 2PTKA 3H0IA 2YUPA 1MV3A 1GCQC 3VS2A 1TUDA 1X6BA 1AEYA 1YP5A 3VS0A 2DL7A 4LN2A 2JMCA 1B07A 1QKXA 2EYXA 2X3WD 2L3QA 2SEMA 1QWEA 1N5ZA 2JS0A 4HCKA 1SPKA 2MOXA 2RQRA 1WXTA 2H8HA 4AFUC 1QKWA 2DA9A 1QCFA 1PRMC 1BU1A 1GFDA 1S1NA 3H0FA 4J9IA 2GTOA 3H0HA 3EHRA 1ZSGA 2A36A 1KIKA 1SHFA 2AZVA 4KRTA 2J6OA 3REBB 2LQNA 2BZ8A 3M0SA 2J05A 4HVWA 4F14A 2DILA 1UE9A 1I1JA 2JMAA 2IIMA 1JU5C 2L3SA 1Z9QA 1WDXA 2LNHB 2W10A 3I9QA 1T3LA 2ED1A 4RTWA 3JV3A 2RQTA 2LQWA 4DEYA 2YUQA 2KYBA 2V1QA 1ZUUA 2ROLA 4J9BA 4CC3A 1SEMA 1BB9A 1ZUYA 1X2QA 1V1CA 2DJQA 2RNAA 2JM8A 1Y0MA 4M4ZA 1VYTA 5GJWB 1AD5A 1RLQC 2DBKA 3EG3A 4J9EA 3QWXX 4J9HA 2GQIA 4ESRA 2K7AA 5L23A 2YSQA 2J6KA 2NUZA 1W70A 1WXUA 2ABLA 4Z88A 2O9SA 1HJDA 4RTXA 2LCSA 1AWXA 4AFZC 4AFSC 2ED0A 3M0TA 2A37A 2V1RA 3M0RA 1BBZA 1GCPA 1PWTA 1CKBA 1KFZA 1SSHA 3PE0A 1U3OA 1G2BA 2CSIA 2D1XA 3I5RA 3UF4A 2CREA 4E6RA 2FEIA 1CKAA 3PVQA 1M3BA 1UTIA 5EC7A 1NM7A 4JJDA 4IIOA 1AWWA 5IH2A 2KRSA 4ORZA 4A63B 4OMMA 2OJ2A 4X1VA 2JXBA 1OOTA 2CUBA 1WXBA 1AZEA 1M3CA 2A28A 1UECA 2I0NA 2BZYA 1T3SA 1JO8A 2FPFA 2M0YA 2MIOA 2EBPA 2KXCA 1NLOC 1IO6A 4ZNXA 2G6FX 1RUWA 2EYZA 2JS2A 1JQQA 5FWBA 1G83A 2EQIA 3RBBB 2HEQA 2DF6A 2F2XA 1UUEA 1NG2A 4CC7A 1GBQA 2EKHA 1PHTA 2O2OA 2YUOA 1MUZA 2JW4A 2C0OA 2CH4W 1ZLMA 2DRKA 2C0TA 2KRMA 2RF0A 1GL5A 1UGVA 2J6FA 2PZ1A 2F2WA 2LJ1A 3REAB 1YWPA 4OMQA 1OPKA 3LH5A 2RQVA 1WA7A 3VS4A 3NHNA 4J9GA 1NEGA 3VRYA 1FYNA 1HD3A 2O9VA 3EG0A 3NPFA 4JPBW 4FSSA 3KFVA 3VS6A 2K9GA 1GCQA 4LE9A 2NWMA 3UATA 1GFCA 3VS3A 3UA6A 1AWOA 2GTJA 2K6DA 1B3QA 2K79A 2RQUA 4JZ4A 2HBWA 4JJCA 3EG1A 2EYYA 2OAWA 1NEBA 2VKNA 2EW3A 3EHQA 3TVTA 3M0QA 1UHCA 4HVVA 1JXOA 1NLPC 3TSZA 2OI3A 3M0PA 2ECZA 5IHIA 2FPDA 2JT4A 2EGCA 2RPNA 2HCKA 3QWYA 1CSKA 1WYXA 4J9CA 1WX6A 5IXFA 1K0XA 1YN8A 4F17A 3FJ5A 3I5SA 2HSPA 4JZ3A 2VWFA 1AVZC 4WCIA 2BZXA 2KNBB 2L0AA 4RTVA 2AKLA 1SRLA 2SRCA 2DRMA 4Z8AA 1Y57A 4F16A 2AKKA 3I35A 3H41A 5I22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL3 A;  1T0H A;  2CSQ A;  2D8H A;  2AK5 A;  2JTE A;  4CC2 A;  2KT1 A;  2LJ3 A;  1AZG B;  2CT4 A;  4AG1 C;  2BTT A;  1WI7 A;  1K1Z A;  3THK A;  3VS1 A;  3EG2 A;  1AWJ A;  2EPD A;  4D8K A;  1NYF A;  2DL4 A;  1GRI A;  3A98 A;  2DBM A;  4J9F A;  4J9D A;  4IIM A;  2GNC A;  1YWO A;  2VVK A;  5IXB A;  2LZ6 B;  1WIE A;  1UJY A;  1LCK A;  1PNJ A;  2GGR A;  4LNP A;  4CC4 B;  2J7I A;  1FMK A;  4OMN A;  4RTT A;  1UFF A;  1K76 A;  4JJB A;  4HXJ A;  2O88 A;  1OEB A;  2B86 A;  2ENM A;  4HVU A;  1E6G A;  2A08 A;  1QWF A;  2CH4 A;  2ESW A;  2X3X D;  2KRO A;  3NMZ C;  2HDA A;  1VYU A;  4K11 A;  2KXD A;  3SHW A;  2EYW A;  4LUE A;  1E6H A;  2KR3 A;  1W1F A;  2LMJ A;  2DX1 A;  2MCN A;  2E5K A;  5FW9 A;  5HCK A;  1UDL A;  1ZX6 A;  1AOJ A;  2PNI A;  4DEX A;  2LJ0 A;  2FRY A;  3RNJ A;  4OML A;  2KGT A;  2LP5 A;  2FRW A;  2EGA A;  5I11 A;  2YDL A;  1A0N B;  2L2P A;  1ZUK A;  2CDT A;  1ZBJ A;  2FO0 A;  4OMP A;  1X69 A;  1SHG A;  1VA7 A;  2LX7 A;  2DNU A;  1BK2 A;  1RI9 A;  3R6N A;  2DE0 X;  1K0S A;  2RN8 A;  4AFQ C;  1YNZ A;  1VYV A;  2AZS A;  1X43 A;  2KT8 A;  2KRN A;  2RQW A;  1MV0 B;  2M51 A;  2D8J A;  1PKS A;  3U23 A;  1W6X A;  1PKT A;  1Z9Z A;  2YT6 A;  3UA7 A;  3NGP A;  2K3B A;  2D0N A;  3TSW A;  1I0C A;  3SEM A;  3O5Z A;  2O31 A;  3VS7 A;  2DLP A;  1RLP C;  3GBQ A;  1SRM A;  4QT7 A;  1U5S A;  1H8K A;  4RUG A;  1NYG A;  1X27 A;  4RTY A;  5IHK A;  1M3A A;  4GBQ A;  1UJ0 A;  2EVR A;  4AG2 C;  1ARK A;  1H92 A;  2ROT A;  1OPL A;  1PRL C;  1GBR A;  4LUD A;  1I07 A;  4RTZ A;  3ULR B;  2F2V A;  2FPE A;  1U06 A;  2L3P A;  3IQL A;  2KBT A;  2K2M A;  5ECA A;  2EGE A;  2CT3 A;  2CUD A;  1J3T A;  1JXM A;  2W0Z A;  1HSQ A;  4OMO A;  1QLY A;  2DYB A;  1ABO A;  3ZL7 C;  4RTU A;  2P4R A;  1K9A A;  1K4U S;  1H3H A;  1XOV A;  2RMO A;  2XMF A;  5IHN A;  2YUN A;  2DL5 A;  1T0J A;  4Y92 A;  2C0I A;  4D8D A;  1X6G A;  2KYM A;  2QDL A;  2KEA A;  5FWC A;  3EGU A;  3C0C A;  1E7O A;  2JM9 A;  1TUC A;  1KSW A;  1OV3 A;  1M8M A;  2J06 A;  4GLM A;  2DL8 A;  1JEG A;  1YCS B;  1WLP B;  1UHF A;  2DM1 A;  1M30 A;  4R0K A;  3VS5 A;  1ABQ A;  1X2K A;  2GBQ A;  4EIK A;  3VRZ A;  5GJV B;  2DVJ A;  3CQT A;  1M27 C;  1EFN A;  2FG0 A;  3M0U A;  1UG1 A;  1WFW A;  3PVL A;  1KJW A;  2KE9 A;  1TG0 A;  2DMO A;  4Z89 A;  2PTK A;  3H0I A;  2YUP A;  1MV3 A;  1GCQ C;  3VS2 A;  1TUD A;  1X6B A;  1AEY A;  1YP5 A;  3VS0 A;  2DL7 A;  4LN2 A;  2JMC A;  1B07 A;  1QKX A;  2EYX A;  2X3W D;  2L3Q A;  2SEM A;  1QWE A;  1N5Z A;  2JS0 A;  4HCK A;  1SPK A;  2MOX A;  2RQR A;  1WXT A;  2H8H A;  4AFU C;  1QKW A;  2DA9 A;  1QCF A;  1PRM C;  1BU1 A;  1GFD A;  1S1N A;  3H0F A;  4J9I A;  2GTO A;  3H0H A;  3EHR A;  1ZSG A;  2A36 A;  1KIK A;  1SHF A;  2AZV A;  4KRT A;  2J6O A;  3REB B;  2LQN A;  2BZ8 A;  3M0S A;  2J05 A;  4HVW A;  4F14 A;  2DIL A;  1UE9 A;  1I1J A;  2JMA A;  2IIM A;  1JU5 C;  2L3S A;  1Z9Q A;  1WDX A;  2LNH B;  2W10 A;  3I9Q A;  1T3L A;  2ED1 A;  4RTW A;  3JV3 A;  2RQT A;  2LQW A;  4DEY A;  2YUQ A;  2KYB A;  2V1Q A;  1ZUU A;  2ROL A;  4J9B A;  4CC3 A;  1SEM A;  1BB9 A;  1ZUY A;  1X2Q A;  1V1C A;  2DJQ A;  2RNA A;  2JM8 A;  1Y0M A;  4M4Z A;  1VYT A;  5GJW B;  1AD5 A;  1RLQ C;  2DBK A;  3EG3 A;  4J9E A;  3QWX X;  4J9H A;  2GQI A;  4ESR A;  2K7A A;  5L23 A;  2YSQ A;  2J6K A;  2NUZ A;  1W70 A;  1WXU A;  2ABL A;  4Z88 A;  2O9S A;  1HJD A;  4RTX A;  2LCS A;  1AWX A;  4AFZ C;  4AFS C;  2ED0 A;  3M0T A;  2A37 A;  2V1R A;  3M0R A;  1BBZ A;  1GCP A;  1PWT A;  1CKB A;  1KFZ A;  1SSH A;  3PE0 A;  1U3O A;  1G2B A;  2CSI A;  2D1X A;  3I5R A;  3UF4 A;  2CRE A;  4E6R A;  2FEI A;  1CKA A;  3PVQ A;  1M3B A;  1UTI A;  5EC7 A;  1NM7 A;  4JJD A;  4IIO A;  1AWW A;  5IH2 A;  2KRS A;  4ORZ A;  4A63 B;  4OMM A;  2OJ2 A;  4X1V A;  2JXB A;  1OOT A;  2CUB A;  1WXB A;  1AZE A;  1M3C A;  2A28 A;  1UEC A;  2I0N A;  2BZY A;  1T3S A;  1JO8 A;  2FPF A;  2M0Y A;  2MIO A;  2EBP A;  2KXC A;  1NLO C;  1IO6 A;  4ZNX A;  2G6F X;  1RUW A;  2EYZ A;  2JS2 A;  1JQQ A;  5FWB A;  1G83 A;  2EQI A;  3RBB B;  2HEQ A;  2DF6 A;  2F2X A;  1UUE A;  1NG2 A;  4CC7 A;  1GBQ A;  2EKH A;  1PHT A;  2O2O A;  2YUO A;  1MUZ A;  2JW4 A;  2C0O A;  2CH4 W;  1ZLM A;  2DRK A;  2C0T A;  2KRM A;  2RF0 A;  1GL5 A;  1UGV A;  2J6F A;  2PZ1 A;  2F2W A;  2LJ1 A;  3REA B;  1YWP A;  4OMQ A;  1OPK A;  3LH5 A;  2RQV A;  1WA7 A;  3VS4 A;  3NHN A;  4J9G A;  1NEG A;  3VRY A;  1FYN A;  1HD3 A;  2O9V A;  3EG0 A;  3NPF A;  4JPB W;  4FSS A;  3KFV A;  3VS6 A;  2K9G A;  1GCQ A;  4LE9 A;  2NWM A;  3UAT A;  1GFC A;  3VS3 A;  3UA6 A;  1AWO A;  2GTJ A;  2K6D A;  1B3Q A;  2K79 A;  2RQU A;  4JZ4 A;  2HBW A;  4JJC A;  3EG1 A;  2EYY A;  2OAW A;  1NEB A;  2VKN A;  2EW3 A;  3EHQ A;  3TVT A;  3M0Q A;  1UHC A;  4HVV A;  1JXO A;  1NLP C;  3TSZ A;  2OI3 A;  3M0P A;  2ECZ A;  5IHI A;  2FPD A;  2JT4 A;  2EGC A;  2RPN A;  2HCK A;  3QWY A;  1CSK A;  1WYX A;  4J9C A;  1WX6 A;  5IXF A;  1K0X A;  1YN8 A;  4F17 A;  3FJ5 A;  3I5S A;  2HSP A;  4JZ3 A;  2VWF A;  1AVZ C;  4WCI A;  2BZX A;  2KNB B;  2L0A A;  4RTV A;  2AKL A;  1SRL A;  2SRC A;  2DRM A;  4Z8A A;  1Y57 A;  4F16 A;  2AKK A;  3I35 A;  3H41 A;  5I22 A; 
#chains in the Genus database with same CATH topology
 2DL3 A;  2D8H A;  2AK5 A;  1BIB A;  3A8G B;  1RAC B;  5HY6 A;  4B9X A;  2EQU A;  1K9M R;  5M9O A;  1VQN Q;  3WVD B;  3M56 A;  3P8D A;  2LDM A;  5A2Q E;  3THK A;  2EPD A;  1Q82 R;  2Y90 A;  1QVP A;  4IUQ A;  5FU6 B;  3OSS C;  1KD1 C;  2NUT A;  4J9F A;  3NTI A;  5GAN 8;  1K73 R;  3CCR Q;  1YWO A;  2LZ6 B;  2B8A A;  4QVD A;  3EFO B;  3CCJ A;  4IUP A;  4JDS A;  4OMN A;  4L59 A;  3CCU Q;  4F7U E;  4HXJ A;  4PLL A;  1E6G A;  2A08 A;  5D6W A;  1VQL A;  2E70 A;  2KRO A;  1WPY A;  2KVQ G;  2WSC E;  3NMZ C;  4M77 G;  3HL8 A;  1MMG A;  3L1A A;  1D1C A;  3CXC P;  2M16 A;  5GMK m;  4MML A;  4WTO B;  1E6H A;  3SD4 A;  5HCK A;  3EGD B;  1Q7Y C;  1UDL A;  3CC2 Q;  2PNI A;  4DEX A;  4M7D A;  2LJ0 A;  5D7U A;  2RD1 A;  5AYF A;  4C0D B;  5GAM g;  5GAN 2;  3C12 A;  2YDL A;  5GMK j;  5LJ5 d;  2NLU A;  1X69 A;  4HCB A;  2PVD B;  2LX7 A;  1OU8 A;  2DNU A;  4NL2 A;  5GMK e;  2HNI A;  3PIP A;  5FRM A;  4KBM B;  4BE2 A;  1GXI E;  3JRZ A;  4KUD K;  1K0S A;  2RN8 A;  5CKH A;  3C95 A;  5FU7 C;  5FU7 B;  1M5Q 1;  3L2V A;  4M7A D;  1MV0 B;  1YJ9 A;  3G4S Q;  1W6X A;  1Z9Z A;  2YT6 A;  3M55 A;  3G1J A;  5DLQ E;  2ZPG B;  3SEM A;  1ZBX A;  1RLP C;  3G6E Q;  3JB9 F;  1NYG A;  4M77 C;  4E7J A;  4M77 B;  3EG9 B;  1UJ0 A;  2EVR A;  4RCC A;  2RO0 A;  1PRL C;  1D0Z A;  2MWP A;  4LUD A;  1LVK A;  4NS5 A;  5GAO m;  2L3P A;  1KG1 A;  4XTW A;  3M4Y A;  1WJR A;  1P92 A;  5ECA A;  4X9D A;  2CUD A;  1J3T A;  2JUF A;  2YHT A;  2W0Z A;  3CD6 A;  2DYB A;  1ABO A;  3CCE Q;  3I55 A;  3CD6 T;  2E4H A;  3HPW A;  3OYK A;  1N8R U;  3DB3 A;  3JCM P;  2A3L A;  3MEU A;  2RMO A;  1Y7X A;  3JCM d;  2F5K A;  4FIB A;  2KMT A;  3OQ5 A;  2PQW A;  4D8D A;  1X6G A;  1MHN A;  1RL2 A;  5FWC A;  1RAE B;  2DTI A;  1TUC A;  3J7A F;  1M8M A;  4GLM A;  4PJL A;  1JEG A;  3BE3 A;  3V7C A;  1M30 A;  1KHC A;  3VS5 A;  1ABQ A;  3X25 B;  1MND A;  2E41 A;  3VRZ A;  3L2U A;  3E1S A;  3NFC A;  3HP9 A;  4BI4 A;  1EFN A;  3M4G A;  3MET A;  1BI3 A;  3FDR A;  1VQ5 T;  3MKD A;  1OQK A;  4ZGE B;  1RAB B;  3H6Z A;  1RAD B;  4WF2 A;  3G71 Q;  1MV3 A;  2LQ8 A;  3SWN A;  1AEY A;  2DIQ A;  2XHC A;  3VS0 A;  2SEM A;  4M78 A;  3NTK A;  1HYO A;  1KQ1 A;  1SPK A;  3A1P A;  1D3B B;  4LDW A;  3E9G A;  1YJW A;  1OYX A;  2XKO C;  1QKW A;  2DA9 A;  3CC4 Q;  1WNL A;  1S1N A;  3H0F A;  4NOY A;  4XU0 A;  1I5O B;  2GTO A;  2KAF A;  2DFU A;  4BDY A;  3JCM Q;  2E6Z A;  2J6O A;  2LQN A;  2BZ8 A;  3M0S A;  2J05 A;  4J83 A;  3VV0 A;  1QMC A;  4M7A C;  1JU5 C;  2L3S A;  1WDX A;  3EAE A;  3JV3 A;  3FLG A;  8ATC B;  2ROL A;  4J9B A;  4CC3 A;  2QTV A;  1IZ6 A;  1WJS A;  5GAN 5;  5CKF A;  2DD4 A;  2CZ1 B;  2HQX A;  1Y0M A;  3JCM W;  1VYT A;  1ZSZ A;  4KH0 B;  4J9E A;  1VQ8 Q;  3QWX X;  4J9H A;  3OW2 A;  4J8O A;  4FW2 A;  1TSF A;  1WXU A;  4E47 A;  2XDP A;  2ABL A;  3OY9 A;  2P4T A;  1M1K U;  1VQ6 Q;  3M0T A;  3L42 A;  2LNV A;  4J7I A;  1BBZ A;  2MYS A;  4QKU A;  1Y71 A;  3PE0 A;  2RI3 A;  2HL5 C;  2CSI A;  3A8H B;  3MCA B;  4E6R A;  2FEI A;  2QAZ A;  1CKA A;  4EMK A;  5GAO q;  3CBM A;  2JJ9 A;  5CAI A;  3CMA Q;  1M2V B;  1I5L A;  4M77 E;  3O8V A;  4A63 B;  1OOT A;  3BW1 A;  2CUB A;  4DQ2 A;  1VQ4 Q;  2A28 A;  1UEC A;  2MIO A;  3F70 A;  2HD0 A;  4ZNX A;  2QA4 Q;  1JQQ A;  4PK4 A;  3OW2 S;  3JCM h;  1NBE B;  2HEQ A;  4CC7 A;  2ZPE B;  4PJO C;  1ZLM A;  2C0T A;  1IB8 A;  2BIV A;  3REA B;  3HRU A;  1OZ2 A;  1UGR B;  1ZHI A;  1NEG A;  4PJM A;  2X4W A;  2F1L A;  1HD3 A;  3CCS Q;  4FSS A;  1YI2 T;  3M57 A;  3ZEH A;  2A0F B;  3UWN A;  3RUX A;  5CKE A;  1QVF P;  4OGC A;  1GCQ A;  3MJX A;  4MZM A;  1QVG S;  3HFN A;  5GAM d;  2FVU A;  2GTJ A;  2NUP A;  2HBW A;  4C8Q A;  1KC8 C;  3X28 B;  4PJO A;  2DO3 A;  4FW1 A;  2VKN A;  4DBR A;  3TVT A;  5J26 A;  3PIO A;  1W2B P;  1SF9 A;  2ZGW A;  2ECZ A;  3MEA A;  2X4Y A;  3HTR A;  3JCM g;  1WX6 A;  5IXF A;  3CME T;  4LDV A;  3FJ5 A;  1K9M C;  3KXT A;  1VQP Q;  3FIF A;  4WCI A;  2BZX A;  2KNB B;  2L0A A;  5FRO A;  4RTV A;  5LJ5 j;  4A4E A;  3QKJ A;  3EGX B;  3GIB A;  5LJ5 e;  4JJN K;  5I22 A;  4QQD A;  3M54 A;  1SSF A;  1EX4 A;  1K73 C;  5KYW A;  1YJN Q;  1VQO Q;  2CT4 A;  4F7U A;  3QYG B;  1KD1 U;  4M75 D;  4E7H A;  5GAN 7;  2NYS A;  2CP6 A;  2JTF A;  2LT1 A;  2MI6 A;  5A0L A;  4M7A E;  5FLX E;  1NYF A;  2DEQ A;  2DL4 A;  1GRI A;  4OB1 B;  2DJZ A;  3A98 A;  1V29 B;  3OYC A;  2VVK A;  4FYX B;  1LCK A;  1PNJ A;  4CC4 B;  4BI8 B;  3SB2 A;  4C92 F;  1FMK A;  1UFF A;  1K76 A;  2G3R A;  1Q86 R;  2B86 A;  4LXC A;  3DLL A;  4CI0 C;  1B34 A;  2CH4 A;  1Q95 G;  4FSX A;  1N8R R;  3CCM Q;  2K2V A;  1N6A A;  1H3Z A;  2HDA A;  2I2L A;  4HA8 A;  3PFS A;  2K4Y A;  2EYW A;  3QJ6 A;  1W1F A;  2K3Y A;  4OMF B;  2DX1 A;  3QYH B;  2MCN A;  5DLO A;  3V8L A;  1ZX6 A;  3M5A A;  5D6X A;  3TQ7 P;  3J81 E;  3JB9 H;  2RI5 A;  1JJ2 P;  2V8I A;  4L6V 5;  1M2O A;  1XNI A;  1WZO A;  1G3T A;  1M90 U;  1NE8 A;  2COW A;  4FU6 A;  1ZBJ A;  2FO0 A;  2DZC A;  4ELZ C;  2RHZ A;  1VA7 A;  2GFA A;  2CS7 A;  2O4X B;  2YRV A;  1TTH B;  2QEX A;  1VYV A;  4N0A C;  2AZS A;  2M51 A;  5I2S A;  4M75 G;  2D8J A;  2QEX T;  1PKS A;  3U23 A;  1NJI U;  1PKT A;  3UA7 A;  3NGP A;  2RB6 A;  4OB3 B;  4QQG A;  2D0N A;  2HBP A;  3TSW A;  3CCL A;  4JRK A;  2O31 A;  3C94 A;  4DBQ A;  3GBQ A;  3LWI A;  4QT7 A;  1U5S A;  2CZ7 B;  4C0G A;  4QW2 A;  5LJ3 e;  4RUG A;  3ZBD A;  1IRX A;  2EJG A;  4M7D F;  3CPW S;  1YIT Q;  1ARK A;  2ROT A;  1OPL A;  4OP0 A;  4A54 A;  5KE2 A;  1GBR A;  3LWH A;  3OYF A;  3BFM A;  3ULR B;  4RG2 A;  4ANJ A;  2WAC A;  3CCV Q;  1D0Y A;  4A4K A;  4GY5 A;  3HSB A;  2L5Q A;  2EGE A;  4CRI A;  5KYU A;  2QTX A;  3GOX A;  2DEU A;  2NUT B;  5GAM h;  1QLY A;  3CCQ A;  2KI7 A;  3UPU A;  4RTU A;  5FU6 C;  1IGU A;  1VQN A;  3CCQ T;  1N9R A;  4A4G A;  3OYN A;  1H3H A;  1XOV A;  4KUI A;  1VQN T;  2XMF A;  1IRE B;  5GAN d;  3JB9 D;  3OYY A;  4HKE A;  2RJC A;  2PVO B;  2C0I A;  1TUG B;  2KYM A;  1WQW A;  2KEA A;  4M75 C;  4M75 B;  4RKU E;  3CCR A;  3QII A;  1R0B G;  3CCJ T;  2J06 A;  2H3J A;  3S3M A;  2M9U A;  5LJ3 f;  2DL8 A;  3L2W A;  1ACM B;  2QQA A;  2DM1 A;  1VQK Q;  3CCU A;  7AT1 B;  1UEB A;  2GBQ A;  4EIK A;  1VQL T;  1OU9 A;  3CCU T;  5GJV B;  2QGG A;  1Q81 U;  1M1K R;  2DVJ A;  2O01 E;  3CQT A;  2FG0 A;  3S3N A;  2EJ9 A;  1MMA A;  1QW1 A;  3OS1 A;  3CEY A;  1ZQ1 A;  1YCY A;  3EFO A;  3V7R A;  1X01 A;  1PM3 A;  2KE9 A;  2DMO A;  2XU8 A;  4Z89 A;  2AT1 B;  3CC2 A;  2PTK A;  4XTY A;  4C0D C;  3N5B B;  2YUP A;  2K5L A;  3TU4 K;  3VS2 A;  1TUD A;  5HKC A;  1KK7 A;  1BI0 A;  5GAO n;  5KYY A;  1N5Z A;  4HCK A;  2RQR A;  2RHX A;  3QBY A;  1SG5 A;  2EAY A;  1RI0 A;  1QCF A;  4A53 A;  2QI2 A;  3EGD A;  1UGP B;  1GFD A;  1OUL A;  1YJ9 T;  1ZSG A;  2D9T A;  1KIK A;  3CC7 A;  3G4S A;  1K8A C;  4KRT A;  5CK9 A;  3JB9 G;  2K5I A;  3CC7 T;  4F14 A;  5CKD A;  2FZG B;  1I1J A;  3OSV A;  3AHU A;  3I9Q A;  2LNH B;  2W10 A;  1N9S A;  1RAH B;  2LX9 A;  3G6E A;  4B6M A;  5CQX A;  2LQW A;  2QAS A;  3EH1 A;  2ZPI B;  2JTM A;  4FL6 A;  1F1B B;  1X2Q A;  1YBY A;  5C6S A;  2HL3 A;  4C5H A;  2RNA A;  4J5Y A;  1R0C B;  4KGV B;  5GJW B;  1RLQ C;  1X6O A;  3EG3 A;  3Q1J A;  4M78 F;  2K7A A;  1LPL A;  2J6K A;  2M02 A;  4JLI A;  3CXC A;  4OB2 B;  4Z88 A;  2E12 A;  2O9S A;  1HJD A;  1AWX A;  3I55 T;  3A8M B;  2E3H A;  3CCE A;  2ED0 A;  4M77 A;  1D1B A;  3CD6 Q;  3M0R A;  1PCX A;  5GAM j;  1PWT A;  1CKB A;  1MMN A;  1G5V A;  1SSH A;  4Q5W A;  1G3W A;  1U3O A;  1G2B A;  2D1X A;  3UF4 A;  5CQY A;  4KUL A;  4TVR A;  1M3B A;  2DER A;  2DIG A;  4Z02 A;  4JJD A;  4LDU A;  3OMG A;  4IIO A;  4II1 A;  5GAO r;  1AWW A;  5IH2 A;  4ORZ A;  3A5Z B;  3S3O A;  2DPP B;  3CBP A;  2OJ2 A;  1JRI A;  2CYZ B;  3OYH A;  2JXB A;  4MDX A;  1WXB A;  1AZE A;  1JO8 A;  2QXF A;  2E10 A;  1IO6 A;  3I56 A;  2JS2 A;  4DOW A;  1VQ5 Q;  3I56 T;  4QQ6 A;  2X4X A;  3HKS A;  3RBB B;  2HKQ B;  2YXY A;  4E7S A;  2EQK A;  5GAN h;  2F2X A;  1NG2 A;  4N4I A;  3G71 A;  3CXC S;  4BE0 A;  3OMC A;  2EKH A;  2XK0 A;  2O2O A;  3CPF A;  4Y91 A;  4EMH A;  1GL5 A;  2PZ1 A;  2X9H A;  3HHT B;  5AT1 B;  2R58 A;  4M75 E;  1YJW T;  2ZPB B;  1PC0 A;  2ZCF B;  2QQB A;  3VS4 A;  1YIJ Q;  3VRY A;  3RKY A;  2LC4 A;  2GQV A;  2DET A;  2XI9 A;  3CC4 A;  1FYN A;  2O9V A;  3NPF A;  4BB7 A;  4BE1 A;  1KQS P;  3UAT A;  1MNE A;  2MMP A;  2NWM A;  3URG A;  1KC8 U;  1FMW A;  1S72 A;  2FHD A;  1S72 T;  1ZSZ B;  1D3B A;  2DAQ A;  2EYY A;  1M90 R;  2OAW A;  1NEB A;  3LW5 E;  3OBW A;  3FC3 A;  4HVV A;  1JXO A;  1NLP C;  4XU1 A;  3VJP A;  2RPN A;  2HCK A;  1CSK A;  1WYX A;  4J9C A;  5GAN g;  1TU0 B;  4F17 A;  1BI2 A;  5FRN A;  4F04 B;  1PSF A;  1VQ8 A;  4M7A A;  1SRL A;  2SRC A;  1NJI R;  2DRM A;  2L3R A;  1VQ8 T;  2RHU A;  3WVE B;  4F16 A;  4C0Z A;  4PFP A;  1IHW A;  1T0H A;  3MP6 A;  2XDB A;  2LJ3 A;  4EMK B;  3LLR A;  4ZN3 A;  2COY A;  2QQR A;  2ATC B;  4AG1 C;  2BTT A;  1WI7 A;  5J39 A;  2ZPH B;  3VS1 A;  3A8O B;  3INZ A;  4ZTJ A;  4D8K A;  3OYM A;  1PSE A;  1Q86 C;  3L2R A;  3E2U A;  1QVG A;  4C8Q F;  4PJO F;  2QDY B;  3QJY A;  2KQW A;  2OTJ Q;  4J9D A;  4IIM A;  2GNC A;  5IXB A;  1WIE A;  3CMA A;  4MZP A;  4ATO A;  4LNP A;  4MDW A;  2FZC B;  2RK1 A;  4RTT A;  1MGQ A;  2PUO B;  2O88 A;  3EFS A;  5KCO A;  1VQ4 A;  3JCM c;  2QYZ A;  2MK5 A;  1VQ4 T;  2HQE A;  3S6W A;  1AT1 B;  2EQM A;  3ZFJ A;  2DVE A;  2QA4 A;  3OB9 A;  4K11 A;  1U1S A;  1VQM A;  2KXD A;  3SHW A;  2Y4Y A;  1D0X A;  2QA4 T;  3KBG A;  2KR3 A;  1VQM T;  1QP2 A;  2CP7 A;  3GLX A;  1WJQ A;  2FB7 A;  4F7U F;  5GAN j;  2FRY A;  3NTH A;  2KGT A;  2LP5 A;  1YHQ Q;  1UGS B;  1QCO A;  5I11 A;  1A0N B;  2X35 A;  1ZUK A;  3X20 B;  4C92 D;  4OMP A;  1Q81 R;  1B7T A;  4BI3 A;  1SHG A;  1OI1 A;  3R6N A;  1RI9 A;  2NUP B;  1AHJ B;  4C8Q B;  2DE0 X;  2HQH A;  1IHV A;  2KY9 A;  4D6W A;  3CCS A;  4E7L A;  5IN1 A;  1X43 A;  2RQW A;  1YI2 Q;  1BKB A;  3FEO A;  4PNO A;  2K3B A;  2D0Q B;  5HK3 A;  1EZZ B;  3R6O A;  1WHJ A;  3VS7 A;  2DLP A;  2CZ6 B;  2VGM A;  3HRS A;  2QG9 B;  2YRD A;  3OS0 A;  5IAY A;  3MEW A;  2K5F A;  5IHK A;  4IKF A;  1M3A A;  3MPU B;  4GBQ A;  5EG2 A;  4HCC A;  4XK8 E;  5KYW B;  4JRI A;  1VQP A;  5L8R E;  3M58 A;  3CME Q;  1UGQ B;  1Q82 C;  2DK3 A;  2L89 A;  3VUB A;  1U8R A;  1BYM A;  2F2V A;  1U06 A;  4ZTF A;  3G7Z A;  2K2M A;  1M4Z A;  3MO8 A;  2CT3 A;  1JXM A;  5A0D A;  5KE3 A;  3DB4 A;  1HSQ A;  3VKI A;  2P0K A;  1WGS A;  3FJP A;  3TEE A;  1YJN A;  2OTL A;  4HT9 A;  3ZL7 C;  3J80 E;  5I21 A;  1M9S A;  2P0Q A;  2OTL T;  1K9A A;  1K4U S;  1M1G A;  4QVZ A;  2DXB A;  2YUN A;  4Y92 A;  4C92 G;  1QP3 A;  2QDL A;  4FT4 A;  4M7D D;  4LDX A;  1O75 A;  4OVA A;  4JRP A;  3C0C A;  3EH2 A;  2YLB A;  3X26 B;  1OV3 A;  5GAO p;  2KDS A;  1YCS B;  2LCL A;  3PMI A;  1WLP B;  5LJ3 g;  1UHF A;  2F69 A;  3ME9 A;  3QDF A;  2RHI A;  4R0K A;  3M9Q A;  3MEV A;  1VQ9 Q;  4ZGJ B;  1X2K A;  2RK2 A;  2R57 A;  1VQ7 Q;  3OYA A;  5KYX B;  2R5A A;  4RG8 A;  3CPW A;  1Q7Y U;  3A8L B;  4R55 A;  3OYD A;  3CCM A;  1O9S A;  5LJ5 f;  4ELY C;  1M27 C;  4ZN1 A;  2V8J A;  2VYT A;  2JOY A;  1WFW A;  3QHS A;  3PVL A;  5HK0 A;  1W2B A;  2XG8 D;  1V76 A;  1KJW A;  1TG0 A;  2V8K A;  4JS4 A;  1YFN A;  4RMO A;  3BDL A;  1X6B A;  3JCM e;  3C4S A;  2DL7 A;  3WXM B;  4LN2 A;  2JMC A;  1QKX A;  2ZAE A;  4X34 A;  5C0M A;  5DM7 R;  2EYX A;  1BCM A;  1PD1 A;  2X3W D;  2L3Q A;  1RAA B;  5GMK h;  4IUV A;  2JS0 A;  2MOX A;  5GAO l;  1JBM A;  4AFU C;  2RJE A;  4DOV A;  4JS5 A;  1K8A U;  4J9I A;  4C92 B;  2A36 A;  1SHF A;  2QEX Q;  1Y96 A;  2L8D A;  4AT1 B;  4DBF A;  2KK4 A;  3CCL T;  1ZA1 B;  3JB9 I;  4HVW A;  3DLM A;  2DIL A;  2IIM A;  4M7D G;  1QVF S;  3E19 A;  1KQ2 A;  2HAX A;  2ED1 A;  1WHM A;  3HFO A;  1SEM A;  3PGG A;  4N0A A;  3GNF B;  1YIT A;  2X51 A;  2AHJ B;  1LJO A;  3QZ5 B;  3JCM f;  1W2B S;  3SDZ A;  2OAU A;  2GQI A;  3FB9 A;  4KT0 E;  3E9F A;  5A0G A;  3ER0 A;  4RTX A;  4P5N A;  2LCS A;  1RAF B;  3RIR A;  2R5M A;  3CCQ Q;  1JJ2 A;  3LYI A;  1Y07 A;  1GCP A;  1RAG B;  1KFZ A;  3MHX A;  4BAC A;  3CBO A;  2VXE A;  2CRE A;  3CCR T;  2D6F A;  3JCM J;  2BUD A;  1UTI A;  5EC7 A;  2DKG A;  2CP5 A;  2E3I A;  3PMT A;  2MF2 A;  2LRQ A;  1OX8 A;  3CCJ Q;  3MP8 A;  4Y28 E;  2KRS A;  1BI1 A;  4M78 D;  2CP2 A;  4R56 A;  1VQK A;  4M7D C;  2DTH A;  1MMD A;  4M7D B;  3OYE A;  3GF5 A;  4X1V A;  4FM4 B;  1VQK T;  2H3E B;  2VB6 A;  1VQL Q;  2VGN A;  2BE9 B;  1M3C A;  1G8X A;  1UB4 A;  2I0N A;  2FPF A;  2YRC A;  1IXD A;  1FXX A;  4E7I A;  2VV5 A;  3H9N A;  1NLO C;  3EFR A;  4M75 A;  2G6F X;  2EYZ A;  2V26 A;  5KYY B;  1R77 A;  3CC2 T;  2EQI A;  2K3X A;  3L2Q A;  2DF6 A;  4IUR A;  4M77 F;  4AMC A;  1PHT A;  1MUZ A;  2C0O A;  2DRK A;  1SKU B;  2VC8 A;  3LX7 A;  2KRM A;  1UGV A;  2J6F A;  4E2F B;  2LJ1 A;  1YWP A;  9ATC B;  3V8K A;  3AT1 B;  2JNG A;  1JJ2 S;  3JSC A;  6AT1 B;  3KUF A;  1BIA A;  4J9G A;  4RCB A;  3TRE A;  1XTD A;  1M90 C;  3EG0 A;  4JPB W;  1I81 A;  3VS6 A;  1TXQ A;  3G4S T;  3RKW A;  2HKN A;  1YJ9 Q;  3JCM X;  1HK9 A;  2A7Y A;  5CKB A;  3PT9 A;  1FX7 A;  1GFC A;  3VS3 A;  4DBH A;  1D1A A;  3CC7 Q;  4QVC A;  1AWO A;  3OS5 A;  2BKD N;  4JZ4 A;  3G6E T;  3JCM V;  5CIU A;  4JJC A;  5KH6 A;  3GNG A;  2PUK B;  1G3S A;  2EW3 A;  1NJI C;  3EHQ A;  4BUG A;  1UHC A;  4M78 G;  5IHI A;  2CKK A;  2FPD A;  2EGC A;  3QPH A;  4PFZ A;  4J6Y A;  5KYN A;  2EYQ A;  1D09 B;  2PU9 B;  2CZ0 B;  1VIF A;  4ME7 A;  4JZ3 A;  2RHY A;  2VWF A;  5LL6 S;  4PJN A;  1NPP A;  2MAM A;  2AKL A;  3ASK A;  2IG0 A;  4Z8A A;  1N27 A;  2AKK A;  3I35 A;  3H41 A;  3EG9 A;  2CSQ A;  3L2Z A;  4KH1 B;  4C5I A;  3CCE T;  2JTE A;  2FL7 A;  4CC2 A;  2KT1 A;  4C92 E;  5I2M A;  4IUU A;  1DJ7 B;  3I55 Q;  1AZG B;  1Q86 U;  4YTL A;  2RH2 A;  5GAM e;  3M53 A;  1K1Z A;  2PVG B;  1AWJ A;  3EG2 A;  2LQK A;  4FYV B;  2DBM A;  5CR2 A;  5CVI A;  3OBY A;  1C0M A;  1XQH A;  2HMA A;  1UJY A;  1X75 C;  2GGR A;  2J7I A;  3OYL A;  3OA6 A;  1WHK A;  3JAM E;  4JJB A;  3SWN C;  2QQS A;  1KD1 R;  1OEB A;  2ENM A;  3SWN B;  4HVU A;  4M7A G;  1QWF A;  2BE7 D;  4A4H A;  2ESW A;  2X3X D;  1NPR A;  4M78 C;  3OW2 P;  4M78 B;  4M7A F;  3SFM A;  2M1H A;  3M59 A;  1VYU A;  3QZ9 B;  4LUE A;  1VQ5 A;  1Q81 C;  2LMJ A;  4BDZ A;  2E5K A;  5FW9 A;  5LJ3 d;  3I56 Q;  3G71 T;  1AOJ A;  3QUI A;  3UT1 A;  4C5E A;  4C8Q D;  5J3B A;  1QCN A;  3H8Z A;  4LD6 A;  4PJO D;  4OF1 A;  4E7K A;  4A4F A;  2IVW A;  5GAM f;  1NZ9 A;  4FYY B;  3RNJ A;  4OML A;  2EWN A;  3QSU A;  2FRW A;  2EGA A;  2L2P A;  2RI2 A;  4JUV A;  2EJF A;  2CDT A;  3RR6 A;  1PD0 A;  1YJW Q;  2E5Q A;  1BK2 A;  1TH7 A;  2OX7 A;  3CC4 T;  1Q7Y R;  1YIJ A;  1QVG P;  4V2S A;  4O5V A;  2LT4 A;  2IPO B;  3D7S B;  1YIJ T;  4AFQ C;  1YNZ A;  4M7D E;  2KT8 A;  2KRN A;  2X4J A;  1U1T A;  2VXF A;  1KHI A;  1ZA2 B;  1ZSZ C;  3RMQ A;  3TCJ A;  2JVV A;  4KGX B;  1I0C A;  3O5Z A;  4XAX B;  1S72 Q;  4BD3 A;  4NL3 A;  1VOM A;  1SRM A;  1K9M U;  3QO3 A;  4HT8 A;  1H8K A;  4FYW B;  4VUB A;  4M7A B;  3UDC A;  1X27 A;  4RTY A;  1Q82 U;  2LVM A;  1FWZ A;  4AG2 C;  3VYH B;  1C1A A;  1H92 A;  1K8A R;  2XDD A;  5IT9 E;  2VAS A;  1K73 U;  1I07 A;  5GAN 4;  4RTZ A;  5LJ5 h;  2FPE A;  2RA2 A;  3IQL A;  4BY6 C;  2KBT A;  4EMK C;  4BY6 B;  1VQ6 A;  3VYG A;  1G3Y A;  4J6X A;  1EIF A;  1VQ6 T;  2P0P A;  4OMO A;  3BDU A;  4O6J A;  2ZZD A;  4C8Q G;  4PLI A;  4PJO G;  2P4R A;  1HXD A;  4E7Z A;  5IHN A;  2EIF A;  2DL5 A;  2GFU A;  4JRQ A;  1T0J A;  1N8R C;  1WHH A;  4PJJ A;  3V8J A;  3X24 B;  4C5G A;  1XJW B;  2OTJ A;  2EFI A;  3EGU A;  1E7O A;  2JM9 A;  3CMA T;  1VIE A;  1KSW A;  2OTJ T;  2QQ9 A;  3OYJ A;  2WSF E;  4PL6 A;  1KQS A;  4DA4 A;  2WSE E;  4KGZ B;  3GPL A;  3LGF A;  2DZ9 A;  1WHG A;  5GAN 6;  2HSE B;  1FMV A;  4EMG A;  4GLK A;  3HRT A;  2F5T X;  3M0U A;  5LJ5 g;  1UG1 A;  1M2V A;  4F7U G;  3RMS A;  3QDR B;  1BCO A;  1VQM Q;  3H0I A;  1GCQ C;  1YP5 A;  1C6V X;  2MWO A;  3VU3 C;  5GAN e;  1B07 A;  4PKC C;  1YHQ A;  1QWE A;  4C8Q C;  2DD5 A;  2JN0 A;  1YHQ T;  4PJO B;  2E6N A;  1WXT A;  2H8H A;  4B9W A;  3P8H A;  3V7S A;  1TOV A;  3CCS T;  1PRM C;  2E1H A;  1BU1 A;  2QGF B;  1I4K 1;  3H0H A;  3EHR A;  4EPC A;  2KSS A;  1YI2 A;  2DTO A;  2AZV A;  4FCY A;  3REB B;  4M78 E;  4C0F A;  3MP1 A;  1UE9 A;  1KQS S;  2JMA A;  4J6W A;  1OX9 A;  1R8O B;  5LJ3 h;  1LOJ A;  1Z9Q A;  4N4H A;  1W4S A;  3CPW P;  1T3L A;  2E64 A;  4RTW A;  4OGE A;  2RQT A;  2XID A;  5GMK i;  4DEY A;  2YUQ A;  2KYB A;  2V1Q A;  1ZUU A;  3FRN A;  1BB9 A;  4UC4 A;  1ZUY A;  3LGL A;  1V1C A;  2Y4X A;  2DJQ A;  3JCM b;  2JM8 A;  1VQP T;  1PG5 B;  4F7U B;  4M4Z A;  1AD5 A;  4PFO A;  5GAN f;  3CME A;  1TS9 A;  2DBK A;  4ESR A;  4XTV A;  2CP3 A;  1WQ7 A;  2XIC A;  5KCH A;  5L23 A;  5GMK l;  2P84 A;  2YSQ A;  2FYK A;  2NUZ A;  1W70 A;  4JLG A;  5CO7 A;  2DYI A;  1VQO A;  3QXE B;  2CGH A;  1YJN T;  1VQO T;  3PTA A;  2HZY A;  4AFZ C;  4J7F A;  4AFS C;  2VUB A;  5GAN 3;  4LD9 K;  2A37 A;  4LDY A;  2V1R A;  2E65 A;  2OTL Q;  1M1K C;  3EGX A;  4XU3 A;  2DXC A;  1B34 B;  4ZGD B;  2DXU A;  3PNW C;  3I5R A;  3PVQ A;  3QG1 A;  1NM7 A;  3OYG A;  1QVF A;  2RM4 A;  2MPX C;  4OMM A;  1I8F A;  1VQ9 A;  1OZ3 A;  1VQ7 A;  3OS2 A;  4N4G A;  3RKX A;  1VQ9 T;  1VQ7 T;  2RJF A;  3CCM T;  2BZY A;  1T3S A;  2M0Y A;  2YWW A;  2RJD A;  2EBP A;  2EKO A;  4X9C A;  2KXC A;  3OYI A;  2QK0 A;  1RUW A;  4XQ3 A;  5FWB A;  3LH0 A;  3RDV A;  1G83 A;  2JZ2 A;  2COZ A;  2DXT A;  1LNX A;  1UUE A;  1RAI B;  1QQJ A;  4OB0 B;  1GBQ A;  4EDU A;  2LTO A;  4MZT A;  5CCA A;  5KYX A;  2YUO A;  2JW4 A;  2CH4 W;  1H64 1;  3RES A;  2RF0 A;  2F2W A;  1Y96 B;  4OMQ A;  1JB0 E;  1OPK A;  3LH5 A;  3BY7 A;  2RQV A;  1WA7 A;  4HCZ A;  4C92 C;  3NHN A;  4IUT A;  3VUZ A;  2AIR B;  2GF7 A;  5D6Y A;  5DY9 A;  2GCX A;  3KFV A;  1TWB A;  2K9G A;  3RER A;  4LE9 A;  2EQJ A;  2C06 A;  4MMK A;  1M8V A;  1WHL A;  2LCC A;  3P8B B;  3OYB A;  3UA6 A;  1IGQ A;  3CCL Q;  2K6D A;  1B3Q A;  2K79 A;  2RQU A;  3DKM A;  1VUB A;  4M77 D;  8AT1 B;  2O4X A;  3EG1 A;  4M75 F;  3M0Q A;  5KYU B;  2XD0 A;  3TSZ A;  5LJ3 j;  2Z0W A;  2OI3 A;  3M0P A;  4C92 A;  2JT4 A;  1YIT T;  3QWY A;  2M0O A;  1K0X A;  1YN8 A;  4XTU A;  3I5S A;  4FT2 A;  2HSP A;  3CCV A;  3GP8 A;  3JB9 J;  1KC8 R;  2FZK B;  1AVZ C;  2YLC A;  3CCV T;  4C8Q E;  4PJO E;  4XU2 A;  1M1F A;  1Y57 A;  2CP0 A;  2ZPF B;  4L5G A;  2K57 A;  4XTX A;  4XTZ A;  3T9N A; 
#chains in the Genus database with same CATH homology
 2DL3 A;  1T0H A;  2CSQ A;  2D8H A;  2AK5 A;  2JTE A;  4CC2 A;  2KT1 A;  2LJ3 A;  1AZG B;  2CT4 A;  4AG1 C;  2BTT A;  1WI7 A;  1K1Z A;  3THK A;  3VS1 A;  3EG2 A;  1AWJ A;  2EPD A;  4D8K A;  1NYF A;  2DL4 A;  1GRI A;  3A98 A;  2DBM A;  4J9F A;  4J9D A;  4IIM A;  2GNC A;  1YWO A;  2VVK A;  5IXB A;  2LZ6 B;  1WIE A;  1UJY A;  1LCK A;  1PNJ A;  2GGR A;  4LNP A;  4CC4 B;  2J7I A;  1FMK A;  4OMN A;  4RTT A;  1UFF A;  1K76 A;  4JJB A;  4HXJ A;  2O88 A;  1OEB A;  2B86 A;  2ENM A;  4HVU A;  1E6G A;  2A08 A;  1QWF A;  2CH4 A;  2ESW A;  2X3X D;  2KRO A;  3NMZ C;  2HDA A;  1VYU A;  4K11 A;  2KXD A;  3SHW A;  2EYW A;  4LUE A;  1E6H A;  2KR3 A;  1W1F A;  2LMJ A;  2DX1 A;  2MCN A;  2E5K A;  5FW9 A;  5HCK A;  1UDL A;  1ZX6 A;  1AOJ A;  2PNI A;  4DEX A;  2LJ0 A;  2FRY A;  3RNJ A;  4OML A;  2KGT A;  2LP5 A;  2FRW A;  2EGA A;  5I11 A;  2YDL A;  1A0N B;  2L2P A;  1ZUK A;  2CDT A;  1ZBJ A;  2FO0 A;  4OMP A;  1X69 A;  1SHG A;  1VA7 A;  2LX7 A;  2DNU A;  1BK2 A;  1RI9 A;  3R6N A;  2DE0 X;  1K0S A;  2RN8 A;  4AFQ C;  1YNZ A;  1VYV A;  2AZS A;  1X43 A;  2KT8 A;  2KRN A;  2RQW A;  1MV0 B;  2M51 A;  2D8J A;  1PKS A;  3U23 A;  1W6X A;  1PKT A;  1Z9Z A;  2YT6 A;  3UA7 A;  3NGP A;  2K3B A;  2D0N A;  3TSW A;  1I0C A;  3SEM A;  3O5Z A;  2O31 A;  3VS7 A;  2DLP A;  1RLP C;  3GBQ A;  1SRM A;  4QT7 A;  1U5S A;  1H8K A;  4RUG A;  1NYG A;  1X27 A;  4RTY A;  5IHK A;  1M3A A;  4GBQ A;  1UJ0 A;  2EVR A;  4AG2 C;  1ARK A;  1H92 A;  2ROT A;  1OPL A;  1PRL C;  1GBR A;  4LUD A;  1I07 A;  4RTZ A;  3ULR B;  2F2V A;  2FPE A;  1U06 A;  2L3P A;  3IQL A;  2KBT A;  2K2M A;  5ECA A;  2EGE A;  2CT3 A;  2CUD A;  1J3T A;  1JXM A;  2W0Z A;  1HSQ A;  4OMO A;  1QLY A;  2DYB A;  1ABO A;  3ZL7 C;  4RTU A;  2P4R A;  1K9A A;  1K4U S;  1H3H A;  1XOV A;  2RMO A;  2XMF A;  5IHN A;  2YUN A;  2DL5 A;  1T0J A;  4Y92 A;  2C0I A;  4D8D A;  1X6G A;  2KYM A;  2QDL A;  2KEA A;  5FWC A;  3EGU A;  3C0C A;  1E7O A;  2JM9 A;  1TUC A;  1KSW A;  1OV3 A;  1M8M A;  2J06 A;  4GLM A;  2DL8 A;  1JEG A;  1YCS B;  1WLP B;  1UHF A;  2DM1 A;  1M30 A;  4R0K A;  3VS5 A;  1ABQ A;  1X2K A;  2GBQ A;  4EIK A;  3VRZ A;  5GJV B;  2DVJ A;  3CQT A;  1M27 C;  1EFN A;  2FG0 A;  3M0U A;  1UG1 A;  1WFW A;  3PVL A;  1KJW A;  2KE9 A;  1TG0 A;  2DMO A;  4Z89 A;  2PTK A;  3H0I A;  2YUP A;  1MV3 A;  1GCQ C;  3VS2 A;  1TUD A;  1X6B A;  1AEY A;  1YP5 A;  3VS0 A;  2DL7 A;  4LN2 A;  2JMC A;  1B07 A;  1QKX A;  2EYX A;  2X3W D;  2L3Q A;  2SEM A;  1QWE A;  1N5Z A;  2JS0 A;  4HCK A;  1SPK A;  2MOX A;  2RQR A;  1WXT A;  2H8H A;  4AFU C;  1QKW A;  2DA9 A;  1QCF A;  1PRM C;  1BU1 A;  1GFD A;  1S1N A;  3H0F A;  4J9I A;  2GTO A;  3H0H A;  3EHR A;  1ZSG A;  2A36 A;  1KIK A;  1SHF A;  2AZV A;  4KRT A;  2J6O A;  3REB B;  2LQN A;  2BZ8 A;  3M0S A;  2J05 A;  4HVW A;  4F14 A;  2DIL A;  1UE9 A;  1I1J A;  2JMA A;  2IIM A;  1JU5 C;  2L3S A;  1Z9Q A;  1WDX A;  2LNH B;  2W10 A;  3I9Q A;  1T3L A;  2ED1 A;  4RTW A;  3JV3 A;  2RQT A;  2LQW A;  4DEY A;  2YUQ A;  2KYB A;  2V1Q A;  1ZUU A;  2ROL A;  4J9B A;  4CC3 A;  1SEM A;  1BB9 A;  1ZUY A;  1X2Q A;  1V1C A;  2DJQ A;  2RNA A;  2JM8 A;  1Y0M A;  4M4Z A;  1VYT A;  5GJW B;  1AD5 A;  1RLQ C;  2DBK A;  3EG3 A;  4J9E A;  3QWX X;  4J9H A;  2GQI A;  4ESR A;  2K7A A;  5L23 A;  2YSQ A;  2J6K A;  2NUZ A;  1W70 A;  1WXU A;  2ABL A;  4Z88 A;  2O9S A;  1HJD A;  4RTX A;  2LCS A;  1AWX A;  4AFZ C;  4AFS C;  2ED0 A;  3M0T A;  2A37 A;  2V1R A;  3M0R A;  1BBZ A;  1GCP A;  1PWT A;  1CKB A;  1KFZ A;  1SSH A;  3PE0 A;  1U3O A;  1G2B A;  2CSI A;  2D1X A;  3I5R A;  3UF4 A;  2CRE A;  4E6R A;  2FEI A;  1CKA A;  3PVQ A;  1M3B A;  1UTI A;  5EC7 A;  1NM7 A;  4JJD A;  4IIO A;  1AWW A;  5IH2 A;  2KRS A;  4ORZ A;  4A63 B;  4OMM A;  2OJ2 A;  4X1V A;  2JXB A;  1OOT A;  2CUB A;  1WXB A;  1AZE A;  1M3C A;  2A28 A;  1UEC A;  2I0N A;  2BZY A;  1T3S A;  1JO8 A;  2FPF A;  2M0Y A;  2MIO A;  2EBP A;  2KXC A;  1NLO C;  1IO6 A;  4ZNX A;  2G6F X;  1RUW A;  2EYZ A;  2JS2 A;  1JQQ A;  5FWB A;  1G83 A;  2EQI A;  3RBB B;  2HEQ A;  2DF6 A;  2F2X A;  1UUE A;  1NG2 A;  4CC7 A;  1GBQ A;  2EKH A;  1PHT A;  2O2O A;  2YUO A;  1MUZ A;  2JW4 A;  2C0O A;  2CH4 W;  1ZLM A;  2DRK A;  2C0T A;  2KRM A;  2RF0 A;  1GL5 A;  1UGV A;  2J6F A;  2PZ1 A;  2F2W A;  2LJ1 A;  3REA B;  1YWP A;  4OMQ A;  1OPK A;  3LH5 A;  2RQV A;  1WA7 A;  3VS4 A;  3NHN A;  4J9G A;  1NEG A;  3VRY A;  1FYN A;  1HD3 A;  2O9V A;  3EG0 A;  3NPF A;  4JPB W;  4FSS A;  3KFV A;  3VS6 A;  2K9G A;  1GCQ A;  4LE9 A;  2NWM A;  3UAT A;  1GFC A;  3VS3 A;  3UA6 A;  1AWO A;  2GTJ A;  2K6D A;  1B3Q A;  2K79 A;  2RQU A;  4JZ4 A;  2HBW A;  4JJC A;  3EG1 A;  2EYY A;  2OAW A;  1NEB A;  2VKN A;  2EW3 A;  3EHQ A;  3TVT A;  3M0Q A;  1UHC A;  4HVV A;  1JXO A;  1NLP C;  3TSZ A;  2OI3 A;  3M0P A;  2ECZ A;  5IHI A;  2FPD A;  2JT4 A;  2EGC A;  2RPN A;  2HCK A;  3QWY A;  1CSK A;  1WYX A;  4J9C A;  1WX6 A;  5IXF A;  1K0X A;  1YN8 A;  4F17 A;  3FJ5 A;  3I5S A;  2HSP A;  4JZ3 A;  2VWF A;  1AVZ C;  4WCI A;  2BZX A;  2KNB B;  2L0A A;  4RTV A;  2AKL A;  1SRL A;  2SRC A;  2DRM A;  4Z8A A;  1Y57 A;  4F16 A;  2AKK A;  3I35 A;  3H41 A;  5I22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...