1GGRB

Complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
b'MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PTS SYSTEM, GLUCOSE-SPECIFIC IIA COMPONENT
publication title Solution structure of the phosphoryl transfer complex between the signal transducing proteins HPr and IIA(glucose) of the Escherichia coli phosphoenolpyruvate:sugar phosphotransferase system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2000-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00381 PTS-HPr PTS HPr component phosphorylation site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1340.10 Alpha Beta 2-Layer Sandwich Histidine-containing Protein; Chain: A; HPr-like 1ggrB00
2JELP 1MO1B 2FEPS 2OENL 3LFGA 1ZVVJ 1CM3A 3CCDA 5T17A 1KA5A 1PFHA 1VRCC 2AK7A 2RLZA 4XWJB 3LE3A 1MU4A 2HIDA 5T1NA 1Y50A 3OQMD 1FU0A 2XDFC 1KKLH 1SPHA 1PTFA 1QR5A 3LNWA 3EZEB 1K1CA 1RZRL 2LRKD 1GGRB 3IHSA 3OQOD 3EZAB 1HDNA 1CM2A 3LE5A 1Y4YA 1QFRA 5T1OA 1OPDA 1KKMH 3LE1A 1POHA 3EZBB 1MO1A 2HPRA 3OQND 1JEMA 1Y51A 1PCHA 2NZVL 1TXEA 1J6TB 2NZUL 2LRLD
chains in the Genus database with same CATH superfamily
2JELP 1MO1B 2FEPS 2OENL 3LFGA 1ZVVJ 1CM3A 3CCDA 5T17A 1KA5A 1PFHA 1VRCC 2AK7A 2RLZA 4XWJB 3LE3A 1MU4A 2HIDA 5T1NA 1Y50A 3OQMD 1FU0A 2XDFC 1KKLH 1SPHA 1PTFA 1QR5A 3LNWA 3EZEB 1K1CA 1RZRL 2LRKD 1GGRB 3IHSA 3OQOD 3EZAB 1HDNA 1CM2A 3LE5A 1Y4YA 1QFRA 5T1OA 1OPDA 1KKMH 3LE1A 1POHA 3EZBB 1MO1A 2HPRA 3OQND 1JEMA 1Y51A 1PCHA 2NZVL 1TXEA 1J6TB 2NZUL 2LRLD 1J5YA
chains in the Genus database with same CATH topology
2JELP 1MO1B 2FEPS 2OENL 3LFGA 1ZVVJ 1CM3A 3CCDA 5T17A 1KA5A 1PFHA 1VRCC 2AK7A 2RLZA 4XWJB 3LE3A 1MU4A 2HIDA 5T1NA 1Y50A 3OQMD 1FU0A 2XDFC 1KKLH 1SPHA 1PTFA 1QR5A 3LNWA 3EZEB 1K1CA 1RZRL 2LRKD 1GGRB 3IHSA 3OQOD 3EZAB 1HDNA 1CM2A 3LE5A 1Y4YA 1QFRA 5T1OA 1OPDA 1KKMH 3LE1A 1POHA 3EZBB 1MO1A 2HPRA 3OQND 1JEMA 1Y51A 1PCHA 2NZVL 1TXEA 1J6TB 2NZUL 2LRLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEL P;  1MO1 B;  2FEP S;  2OEN L;  3LFG A;  1ZVV J;  1CM3 A;  3CCD A;  5T17 A;  1KA5 A;  1PFH A;  1VRC C;  2AK7 A;  2RLZ A;  4XWJ B;  3LE3 A;  1MU4 A;  2HID A;  5T1N A;  1Y50 A;  3OQM D;  1FU0 A;  2XDF C;  1KKL H;  1SPH A;  1PTF A;  1QR5 A;  3LNW A;  3EZE B;  1K1C A;  1RZR L;  2LRK D;  1GGR B;  3IHS A;  3OQO D;  3EZA B;  1HDN A;  1CM2 A;  3LE5 A;  1Y4Y A;  1QFR A;  5T1O A;  1OPD A;  1KKM H;  3LE1 A;  1POH A;  3EZB B;  1MO1 A;  2HPR A;  3OQN D;  1JEM A;  1Y51 A;  1PCH A;  2NZV L;  1TXE A;  1J6T B;  2NZU L;  2LRL D; 
#chains in the Genus database with same CATH topology
 2JEL P;  1MO1 B;  2FEP S;  2OEN L;  3LFG A;  1ZVV J;  1CM3 A;  3CCD A;  5T17 A;  1KA5 A;  1PFH A;  1VRC C;  2AK7 A;  2RLZ A;  4XWJ B;  3LE3 A;  1MU4 A;  2HID A;  5T1N A;  1Y50 A;  3OQM D;  1FU0 A;  2XDF C;  1KKL H;  1SPH A;  1PTF A;  1QR5 A;  3LNW A;  3EZE B;  1K1C A;  1RZR L;  2LRK D;  1GGR B;  3IHS A;  3OQO D;  3EZA B;  1HDN A;  1CM2 A;  3LE5 A;  1Y4Y A;  1QFR A;  5T1O A;  1OPD A;  1KKM H;  3LE1 A;  1POH A;  3EZB B;  1MO1 A;  2HPR A;  3OQN D;  1JEM A;  1Y51 A;  1PCH A;  2NZV L;  1TXE A;  1J6T B;  2NZU L;  2LRL D;  1J5Y A; 
#chains in the Genus database with same CATH homology
 2JEL P;  1MO1 B;  2FEP S;  2OEN L;  3LFG A;  1ZVV J;  1CM3 A;  3CCD A;  5T17 A;  1KA5 A;  1PFH A;  1VRC C;  2AK7 A;  2RLZ A;  4XWJ B;  3LE3 A;  1MU4 A;  2HID A;  5T1N A;  1Y50 A;  3OQM D;  1FU0 A;  2XDF C;  1KKL H;  1SPH A;  1PTF A;  1QR5 A;  3LNW A;  3EZE B;  1K1C A;  1RZR L;  2LRK D;  1GGR B;  3IHS A;  3OQO D;  3EZA B;  1HDN A;  1CM2 A;  3LE5 A;  1Y4Y A;  1QFR A;  5T1O A;  1OPD A;  1KKM H;  3LE1 A;  1POH A;  3EZB B;  1MO1 A;  2HPR A;  3OQN D;  1JEM A;  1Y51 A;  1PCH A;  2NZV L;  1TXE A;  1J6T B;  2NZU L;  2LRL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...