1GL5A

Nmr structure of the sh3 domain from the tec protein tyrosine kinase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
b'GSEIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNNLDQYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE TEC
publication title The solution structure and intramolecular associations of the Tec kinase SRC homology 3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 11
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gl5A00
2A28A 1YWPA 1XOVA 1SSHA 2JS0A 2GTJA 2M0YA 2JT4A 2PNIA 2K3BA 1PRLC 2ROLA 1AEYA 2JMCA 2K7AA 3NHNA 4J9CA 1QWFA 2BZXA 3ZL7C 4HVUA 2CH4W 4RTWA 1I07A 1IO6A 1K76A 3CQTA 4LNPA 1U3OA 1WXBA 1WXTA 4J9EA 2KEAA 4Z8AA 2A36A 2RNAA 2EGAA 2KXCA 2EQIA 3VS7A 1K0SA 3M0UA 1K1ZA 2DVJA 2GTOA 2O31A 4IIOA 1EFNA 2C0OA 5GJWB 4F17A 3VS2A 2PZ1A 4HXJA 2LMJA 2J6KA 4X1VA 2LQWA 1B07A 1S1NA 1M27C 2LQNA 2H8HA 2AZVA 2NWMA 1G2BA 1WX6A 1PKTA 1UTIA 4AFZC 1NEBA 1GCQC 2F2VA 2KT8A 5IXFA 1AZEA 2CT3A 1BBZA 2RQWA 1T0HA 1GBRA 2OI3A 3REAB 4RTZA 2LX7A 2RN8A 2CREA 4EIKA 1ZUUA 5IHNA 4J9DA 1M3CA 1ABOA 2FG0A 1M8MA 1OEBA 1KIKA 3I35A 2L3PA 2DL3A 3NPFA 2J6OA 4J9HA 1OOTA 2LZ6B 4OMOA 1GFCA 1QKXA 4CC4B 1QCFA 3FJ5A 4ZNXA 2KYBA 1QLYA 4Z89A 1X69A 2HSPA 5I22A 4QT7A 1WDXA 4AG1C 2DRMA 1H3HA 2K6DA 4Y92A 2AZSA 3I5RA 1U06A 2DBKA 1PHTA 1VYVA 2PTKA 2AKKA 4WCIA 1YNZA 5IXBA 4JZ3A 4D8DA 3NGPA 4AFSC 2YUOA 2DA9A 1RLPC 2CSQA 1V1CA 2MIOA 2EYWA 3EG1A 4CC7A 1UECA 2AKLA 1ABQA 1QKWA 2JMAA 1B3QA 1UFFA 2XMFA 2EPDA 1Z9ZA 4J9IA 2CT4A 2DMOA 1JXOA 1H8KA 2FO0A 2KRMA 1G83A 2BZYA 3EHRA 1PKSA 1X27A 2LCSA 3KFVA 2JXBA 2GGRA 1FYNA 3SEMA 3EG3A 1M30A 1ZLMA 1NEGA 1NLOC 4DEYA 2YT6A 1K0XA 2CUDA 3NMZC 2SRCA 2L3SA 1N5ZA 2RF0A 1HD3A 3EG2A 4ORZA 4RTXA 4M4ZA 3VS1A 2DILA 4ESRA 2E5KA 2DL8A 1JXMA 4FSSA 2LNHB 1OV3A 1X2QA 1YN8A 1K9AA 2MOXA 4K11A 3M0RA 2DL4A 1KFZA 4LN2A 2W10A 1E7OA 1YCSB 4CC3A 2ENMA 1WLPB 3C0CA 1TUDA 2ESWA 1UE9A 2RQTA 2X3XD 3LH5A 2LJ3A 3RNJA 1AOJA 4OMMA 2I0NA 4GBQA 2KNBB 1NLPC 1GBQA 2KT1A 4JZ4A 2FRWA 1M3AA 1ZBJA 1M3BA 4RTYA 2CSIA 1VA7A 2GNCA 1AVZC 5EC7A 2X3WD 3VS5A 1AD5A 2KE9A 2KGTA 1T3SA 4OMNA 1BB9A 2J7IA 2ROTA 2DJQA 1T3LA 2D8HA 1AWJA 2RQVA 2VWFA 1KJWA 2EVRA 2F2XA 1UHCA 3EHQA 2FRYA 1YP5A 4DEXA 2JM9A 2KROA 2K2MA 1Y0MA 5ECAA 4D8KA 2RPNA 3M0TA 3REBB 1WI7A 1GRIA 3EGUA 2DX1A 4KRTA 2LJ0A 3A98A 2CDTA 2RQRA 2MCNA 1FMKA 2V1QA 2YUQA 2BZ8A 2KRNA 1MUZA 1UUEA 4JPBW 3UF4A 1CSKA 2DL5A 5FW9A 1AWOA 4LUDA 1ARKA 4OMLA 3GBQA 4IIMA 1X43A 1OPKA 2HBWA 4OMQA 2D1XA 2YSQA 2ED0A 3QWYA 3PVLA 1W70A 2D8JA 2EKHA 1KSWA 2DL7A 3IQLA 1W6XA 2G6FX 2J05A 1LCKA 1RI9A 4RTUA 1MV0B 1Z9QA 2D0NA 3VS4A 3I5SA 1UG1A 3R6NA 2W0ZA 4A63B 1X6BA 4R0KA 1WXUA 2P4RA 3TSWA 1SPKA 1J3TA 1GL5A 1UDLA 2K9GA 1GFDA 1PRMC 3O5ZA 4CC2A 4HVVA 4LUEA 1U5SA 3VS0A 1NYFA 1UGVA 1SHGA 2C0IA 2L2PA 5FWCA 2B86A 3VS6A 1ZUKA 2EYXA 3H41A 5HCKA 1BU1A 2DF6A 1ZSGA 3U23A 5I11A 2CH4A 4OMPA 2GBQA 3M0QA 1VYUA 2DRKA 2KXDA 1UJYA 2A08A 3QWXX 2KR3A 3M0PA 1SHFA 1NG2A 2J6FA 1WIEA 4LE9A 4J9BA 4JJDA 4RTVA 1GCQA 1MV3A 1W1FA 5GJVB 2EGCA 3H0FA 3RBBB 2KRSA 3EG0A 2J06A 2HCKA 2JW4A 1K4US 2YUPA 2YDLA 2IIMA 4JJBA 2DE0X 2VVKA 1I1JA 1HJDA 1TUCA 3ULRB 1CKAA 3UA7A 2DBMA 1HSQA 5IH2A 1X2KA 2FPDA 4Z88A 4HVWA 1VYTA 3THKA 1PNJA 2FPEA 4AFUC 1UJ0A 2DYBA 4J9FA 4HCKA 2M51A 1Y57A 2V1RA 2FEIA 1JO8A 1OPLA 2SEMA 1NM7A 2DNUA 1WFWA 1JEGA 1QWEA 1SRLA 2L0AA 2F2WA 2AK5A 2GQIA 2O9VA 2LP5A 4AFQC 1YWOA 2O88A 2HDAA 1GCPA 2BTTA 4AG2C 4GLMA 1UHFA 2ED1A 1BK2A 2L3QA 2OJ2A 4F14A 2A37A 2JTEA 1SEMA 1AWWA 1A0NB 3H0HA 1RLQC 3SHWA 3M0SA 4F16A 3UA6A 2HEQA 3UATA 1RUWA 2ABLA 1SRMA 1AWXA 2ECZA 4RUGA 2JS2A 2DLPA 1AZGB 1CKBA 2VKNA 3JV3A 1ZUYA 3VRYA 3I9QA 2EYYA 3PVQA 2OAWA 4RTTA 2EBPA 2EW3A 2K79A 1E6HA 5IHKA 1WA7A 2JM8A 1H92A 4E6RA 1JQQA 3TVTA 2KBTA 3VRZA 3VS3A 1X6GA 4JJCA 5L23A 1WYXA 2KYMA 2FPFA 2O2OA 2O9SA 2QDLA 1JU5C 1TG0A 5IHIA 2CUBA 5FWBA 1PWTA 1ZX6A 2EYZA 3PE0A 1I0CA 2EGEA 4J9GA 2YUNA 2LJ1A 2DM1A 2RQUA 2NUZA 1T0JA 2C0TA 2RMOA 3H0IA 3TSZA 1E6GA 1NYGA
chains in the Genus database with same CATH superfamily
3BY7A 1KD1U 2JS0A 1BI2A 4FIBA 2VYTA 3GNGA 2ROLA 3CBPA 3ZL7C 2CH4W 2P84A 1VQ9A 4BY6C 4FYVB 4M77A 1IO6A 1NPPA 1K76A 1EIFA 1WXBA 1VQMA 1RAGB 3QKJA 2A36A 2LDMA 4M7AA 1SKUB 3VYGA 3VS7A 3M0UA 1G3WA 3LWHA 1IHVA 1VQPT 4IURA 2C0OA 5DLOA 2RHXA 1D0ZA 4M78C 3PMTA 3MO8A 3EGDA 1K73C 2MAMA 2LQWA 1B34B 1B07A 1S1NA 1M27C 2H8HA 2AZVA 3OS5A 2AT1B 3CMAA 1YIJT 1NEBA 2H3JA 3QYGB 2KT8A 1KK7A 1AZEA 2YWWA 3CXCA 4IUTA 5GMKi 1PM3A 1ZBXA 5J39A 2QAZA 4OF1A 2K3XA 4C92D 3REAB 3QYHB 4M75B 5I2MA 1M1KR 3QO3A 1TTHB 2RN8A 2GCXA 3L1AA 4EIKA 4LD6A 3L2QA 3HRUA 2FG0A 2DIQA 1VUBA 3CCUT 2RA2A 3JB9H 4A54A 4CC4B 1C6VX 2QA4T 1YI2Q 2KYBA 4D6WA 1I5OB 3G6EA 4C92G 1WDXA 2HSEB 5GMKj 4AG1C 2DZCA 2DRMA 4Y92A 2RD1A 3I5RA 1U06A 1N8RU 3CD6A 2PTKA 4ELYC 4BI8B 5IXBA 2A3LA 2HKNA 1RLPC 1V1CA 2MIOA 3EG1A 1UECA 5FLXE 3I55A 1QKWA 3CC7Q 1KC8C 5FRNA 4C0DB 5AYFA 2EPDA 3LGFA 3JCMe 2RI5A 2RHUA 2JNGA 5GAMe 3UT1A 2V8JA 3OYKA 1YJ9A 2RH2A 2R58A 3X24B 3P8HA 2BZYA 1B34A 2LCSA 4WF2A 4M77E 3BW1A 4DEYA 4AT1B 4FW2A 4CRIA 2CZ7B 5CCAA 2E1HA 1D1AA 2R5AA 1N5ZA 4M7AE 2KMTA 5CAIA 4FSSA 1X2QA 1VQ4T 3CCLA 1ZA2B 4RCCA 1Q81C 4M75A 4N0AC 2OTJQ 4E7IA 1BIAA 2O4XB 3UDCA 4DQ2A 2VUBA 4F7UB 4CC3A 4F04B 4B9WA 2EQKA 3OYNA 3E9GA 2EYQA 2HQHA 1NJIC 4GBQA 1PSEA 5LJ3j 1ZBJA 1M3BA 4RTYA 2L5QA 4BDZA 1TSFA 2KSSA 1IGUA 2GNCA 2GFAA 2LX9A 3VS5A 3MEWA 4R55A 1Q7YU 1OQKA 2KGTA 3P8BB 1YJNA 1UGQB 1VIFA 2IG0A 2ROTA 2D8HA 1AWJA 4M7DC 2PUOB 3JCMb 1BCMA 3EHQA 1M90R 1IXDA 4A4FA 3KBGA 2JM9A 1RAHB 1I81A 3C12A 1XNIA 3BDLA 3MP8A 2FB7A 3REBB 1QP3A 1S72A 1GRIA 1NPRA 2DAQA 2VGNA 1QQJA 2X51A 2JOYA 4XTUA 4C92C 2BZ8A 1VQ6Q 2FHDA 5I21A 2E3IA 3JCMQ 1CSKA 2WSFE 4NS5A 4N4IA 3HFOA 5GAN3 3Q1JA 2YRCA 2M0OA 1K8AR 3OYCA 2ED0A 2CZ1B 5CR2A 1KD1R 2EKHA 1KSWA 3OBYA 2J05A 3CBOA 1RI9A 3OYDA 4ZN3A 1VQOT 2O4XA 3VS4A 3RKWA 3QJYA 2K3YA 4F7UA 3G71Q 3V7SA 1X6BA 1WXUA 2P4RA 3TSWA 1TUGB 3CC4Q 3RIRA 2HL5C 4BD3A 2RJCA 2P4TA 2AHJB 3VS0A 1NYFA 1UGVA 2C0IA 2L2PA 4L59A 4OB0B 3WVDB 3E2UA 1YHQA 1GXIE 4M75E 3CPFA 2PUKB 2GFUA 2COWA 4DBHA 3BFMA 1QCNA 3DKMA 3JB9I 4J9BA 3CCQT 1VQKQ 4RTVA 1MV3A 1W4SA 5GJVB 1N27A 3C4SA 1R77A 3VYHB 2F5KA 4M77D 1MMAA 4C8QB 3EG0A 4E7JA 2HBPA 1VQNA 2YUPA 3OB9A 4DOVA 2QTVA 4M7AD 4PJNA 1VQ5Q 1Y96B 2DBMA 1HSQA 4QVCA 1X2KA 2FPDA 2ATCB 3HFNA 2CZ6B 1VYTA 2H3EB 3THKA 1Q95G 1UJ0A 4C5EA 3S6WA 1JO8A 4JLIA 2KQWA 3EH1A 2SEMA 4BDYA 4JRIA 4M77G 4E7KA 1QVFA 2EKOA 4LXCA 1QWEA 5J26A 1K9MC 2AK5A 2KVQG 2CKKA 2O9VA 4A4EA 2LP5A 3CCET 3E1SA 4M7AG 4J7FA 4GLMA 3OSVA 4QQ6A 2D9TA 2L3QA 2A37A 1BI3A 1X75C 1B7TA 2COZA 3V7CA 3DLLA 1WJRA 5FRMA 5DLQE 4N4HA 1VQ8T 4RUGA 2JS2A 3FDRA 2DVEA 1MNDA 2DD4A 5LJ3g 3PMIA 3AHUA 1VQ9Q 3SWNB 4XTYA 1ZUYA 1TH7A 2EYYA 3D7SB 2EBPA 2EW3A 4BI4A 2X4JA 1VQMQ 4F7UE 5GANf 3PTAA 4LDUA 2KBTA 3VRZA 3RKYA 3M59A 5A0DA 3VS3A 5FU7C 5L23A 4E2FB 2BE7D 4KGZB 4LDWA 4C8QA 5IHIA 4JDSA 4C0ZA 2CUBA 5FWBA 1PWTA 3JRZA 3PGGA 3CBMA 2EGEA 2YUNA 1ZSZC 2DM1A 1G5VA 2NUZA 2C0TA 4PJOC 2RMOA 4KH1B 3EG9B 1Y96A 3H0IA 3E9FA 3CMAQ 1E6GA 3ZEHA 3HKSA 1IHWA 1YWPA 1XOVA 2E41A 3JCMd 1SF9A 2DKGA 2M0YA 2JT4A 5GAMd 2LRQA 2PNIA 2JMCA 1QWFA 2BZXA 1QVFP 3JCMW 4HVUA 1PD1A 1H3ZA 4RTWA 3EGXB 1ZA1B 1Q7YR 1XTDA 4J9EA 2CS7A 9ATCB 3PNWC 1M2OA 2E10A 3DB4A 1K0SA 5GMKm 2DVJA 2GTOA 2LCLA 4JS5A 3CCUA 5KCHA 2DTOA 4LDVA 4M75D 3G6EQ 2K5LA 3O8VA 1D0YA 3URGA 2DZ9A 2LMJA 2J6KA 2MF2A 4FYWB 5KCOA 2LQNA 3SWNA 4Z02A 1QVFS 1WX6A 5LJ5j 4AFZC 1GCQC 4DBQA 5IXFA 4IUQA 2RI2A 5CO7A 1YI2T 1LVKA 2D0QB 1BBZA 4M7AC 3JB9G 2ZGWA 4KGVB 2HKQB 1ZHIA 1QP2A 4PNOA 2X35A 4M75G 1QVGS 2QEXA 3CCJA 1RAFB 4RTZA 2QK0A 5GAOm 4J9DA 3OYEA 1YJ9Q 4ATOA 1KHCA 1OEBA 1KIKA 3I35A 3DLMA 3M4GA 3EG9A 2X4XA 2J6OA 3EGDB 4OMOA 1QKXA 4J83A 5KYYB 4L6V5 4HKEA 1XJWB 3TEEA 3CC7T 1QLYA 3LW5E 1X69A 4Z89A 1Q82C 1OYXA 5I22A 5CQXA 4LDYA 8ATCB 2AZSA 2M9UA 1OULA 5GMKe 3S3MA 3CCLQ 3A5ZB 3EGXA 5EG2A 4C8QE 1PHTA 4FW1A 2AKLA 3PIOA 4XU0A 1B3QA 2KK4A 5GAOn 1UFFA 3ER0A 1WHJA 2MWPA 3INZA 2K2VA 3JCMV 4J9IA 4BACA 1K8AU 3E19A 2KRMA 3EHRA 3ZBDA 4ANJA 3SEMA 2MK5A 1M30A 1ZLMA 1YJNQ 1NEGA 1NLOC 3CCVA 2L3SA 2QGFB 4ORZA 1M4ZA 3VS1A 2DILA 4MZPA 1AT1B 2P0KA 4EMKC 2MOXA 2XDDA 1S72Q 3OW2S 2NYSA 2NLUA 2MI6A 2DETA 4F7UG 1E7OA 2DIGA 4BB7A 4KGXB 4BY6B 5DY9A 2LT4A 5IN1A 5CKFA 2ESWA 1UE9A 2RQTA 3LH5A 2LJ3A 5CVIA 2BIVA 5KYYA 1HK9A 2WSEE 4PFOA 4C5HA 1EX4A 2KNBB 1GBQA 5GAMh 4HCCA 4RCBA 1OI1A 2CSIA 2DTIA 2JZ2A 4YTLA 1VQLT 1AVZC 5LJ3e 1TU0B 1Q86C 1UGPB 2X3WD 4FT4A 1WNLA 4M78B 1UHCA 4RG2A 1VQ7T 2FRYA 4OGEA 2L89A 4DEXA 3JB9F 4M78F 2ZPGB 3QDFA 1WQ7A 1WPYA 3KUFA 2QYZA 2RPNA 4M75F 4FL6A 3C95A 4PL6A 2QDYB 3A98A 2LJ0A 3CCMA 1V76A 1G3SA 2HNIA 4QKUA 1RAIB 1MMGA 3UF4A 4XTVA 3G71T 1YHQQ 2YRDA 5GANh 1HXDA 5FW9A 1ARKA 3CC4T 4IIMA 5CKEA 4OMQA 2D1XA 2YSQA 5LJ5g 3QWYA 2D8JA 1U1TA 2ZCFB 1W6XA 3MP6A 4C0DC 1K73U 1IB8A 4FM4B 2R5MA 1BI0A 2D0NA 3X26B 1UG1A 1VQNQ 3CPWA 4XTXA 3I56Q 2RM4A 2PU9B 2R57A 1GL5A 1UDLA 1N9RA 1VQKT 1U5SA 3HRSA 2V26A 5FWCA 2B86A 4C8QD 4VUBA 1ZSGA 2XICA 4MMLA 2ZPHB 3AT1B 2C06A 4OMPA 2GBQA 3M0QA 1VYUA 2E12A 2ZPEB 3VUZA 4M78A 4B9XA 3P8DA 1WHLA 1UJYA 2A08A 4QW2A 3QWXX 1VQ5T 2E5QA 1SHFA 2Y4YA 4ZGDB 3CCRT 4LE9A 5IAYA 1IZ6A 1W1FA 3RERA 4C8QG 4F7UF 4J8OA 2OTLT 2XI9A 3OYMA 1WZOA 2J06A 2HCKA 3LWIA 8AT1B 1K4US 4CI0C 3NFCA 2DE0X 1I1JA 1HJDA 1CKAA 5IH2A 4JRQA 2BKDN 4FCYA 4HVWA 2L3RA 1WHGA 1FMVA 2B8AA 1PNJA 3OYIA 2F69A 2EFIA 2DYBA 2M51A 4EPCA 3LX7A 4FYXB 2DNUA 4KUDK 1JEGA 1KQSA 1SRLA 2F2WA 3L2VA 2GQIA 1YITT 2MWOA 2CP7A 1YWOA 3CPWP 1X6OA 4KBMB 5AT1B 2K5IA 5GAN8 4OP0A 2RO0A 1VQMT 4P5NA 4M7DB 4F14A 3JSCA 1M1FA 3G4SA 3OMCA 1AWWA 1WHMA 1RLQC 4M7DF 2WSCE 3UA6A 2HEQA 1Q81U 1SRMA 3CMET 3CCST 1AHJB 2DLPA 3META 5GAN5 2QXFA 1AZGB 3HL8A 5D6YA 4C5IA 2XKOC 3OYYA 4JLGA 2EJ9A 2VGMA 3PVQA 3V8LA 3CC2Q 2DD5A 4OVAA 2K79A 5IHKA 1WA7A 2IVWA 1NJIU 4E6RA 5KYWB 3L2RA 1R0CB 3CMAT 3TVTA 1PC0A 3CPWS 4JJCA 4UC4A 1WYXA 3MEAA 2XDBA 2HQEA 4DA4A 5GAOq 2ZAEA 3CCUQ 2P0QA 1OX9A 2HZYA 3CEYA 3V8JA 4PFPA 4XQ3A 5IT9E 4N0AA 3EFOA 1RACB 4M78E 4OMFB 1UEBA 2PVDB 1NYGA 4Q5WA 3QHSA 1SSHA 5HK3A 3M58A 2K3BA 2QTXA 2VASA 3OBWA 2K7AA 3NHNA 3G6ET 1KQSP 1BYMA 1TXQA 2WACA 1I07A 2MPXC 2QEXQ 3CCJQ 4LNPA 3DB3A 2DYIA 3HTRA 5FU6B 3M4YA 1IREB 1M5Q1 2JN0A 2KY9A 2EQIA 2QGGA 4M7DA 1WGSA 4TVRA 4C8QF 2O31A 4IIOA 1EFNA 3A1PA 5GANj 3VS2A 2G3RA 2DEUA 4HT9A 1M1KC 2MMPA 1YJWA 3JCMf 2QQAA 5GAMf 4XTZA 1PKTA 1KQSS 2ZPBB 2EQJA 2F2VA 4C92A 1O9SA 3S3NA 5KYWA 5LJ5e 2CT3A 4PLLA 2RQWA 4IUPA 1UGRB 1T0HA 1QW1A 2CZ0B 1D3BB 5HK0A 5LJ3d 1QVGA 1G3TA 2LX7A 3RMQA 3MHXA 1M3CA 1K73R 1ABOA 2DXBA 3VJPA 1M8MA 1MMNA 2EJGA 2DL3A 3JCMJ 5D7UA 5FROA 2BUDA 1OOTA 1GFCA 3GP8A 2I2LA 1QCFA 3CCVQ 1WJQA 5A0GA 1V29B 4IUVA 4DOWA 4QT7A 2LCCA 4KT0E 2VXEA 1HYOA 2DERA 2QI2A 3KXTA 1H3HA 2K6DA 3RESA 3OS2A 3MEVA 1C0MA 1VYVA 2AKKA 4WCIA 1YJNT 1LJOA 4MZTA 4JZ3A 4D8DA 4AFSC 3PFSA 2YUOA 2DA9A 2ZZDA 1RAEB 2L8DA 4CC7A 2E4HA 1VQPA 4J7IA 2GQVA 3LH0A 2CP6A 2XMFA 4E7LA 1G3YA 2DMOA 1H8KA 2CP5A 3VKIA 3JCMc 5FU7B 5DM7R 1K9MU 1ACMB 1QVPA 3BE3A 1PKSA 1X27A 2FZKB 1YIJA 2JXBA 2GGRA 1VQLA 1H641 3MJXA 2E70A 2CUDA 2RJEA 1UGSB 1HD3A 1ZSZB 4JS4A 3EG2A 4PJOB 3UWNA 1VQ7A 2DL8A 1KC8R 4M7DE 2LNHB 1D3BA 1OV3A 4N4GA 4PJOF 1YN8A 1K9AA 2YRVA 3GLXA 4K11A 1QVGP 1PSFA 2DL4A 4RG8A 3OYBA 1KFZA 1IGQA 2YLCA 3OW2A 3CCMQ 3JB9D 4LN2A 4M78D 4HA8A 1N9SA 1YCSB 1M90C 4R56A 4GY5A 1OZ3A 4FT2A 2QA4A 3C0CA 4ZGEB 4LDXA 1TUDA 1P92A 3RNJA 1AOJA 5M9OA 2I0NA 3VU3C 4A4GA 2RHYA 5I2SA 4M77C 1M3AA 3CD6Q 2CGHA 3G1JA 1D1CA 3M55A 1NBEB 3L2WA 2E6ZA 2CYZB 2RK1A 4AMCA 1Q81R 4OMNA 3QZ5B 4M78G 2RJDA 2D6FA 4OB3B 3I55Q 2RQVA 1T3LA 5CKDA 2VWFA 5KH6A 1KJWA 1JJ2P 1JB0E 2EVRA 2DJZA 2F2XA 1YHQT 3X20B 4JJNK 4BE1A 2K2MA 1NJIR 5ECAA 4D8KA 2JTFA 3V7RA 2QG9B 1KD1C 4E7HA 2X4YA 5HKCA 2DX1A 4KRTA 1MGQA 2CDTA 2RQRA 2MCNA 5D6WA 1FMKA 3OS1A 3QPHA 2HQXA 2KRNA 1MUZA 2X4WA 1UUEA 3S3OA 1OU9A 1Y7XA 5GANg 3QUIA 3GF5A 1VQNT 2XK0A 3I56T 1AWOA 2JUFA 3NTIA 1UB4A 4OMLA 3GBQA 4A53A 3PT9A 3J81E 2NUTB 1ZSZA 3RDVA 1JJ2S 1X43A 3JCMP 4PJOA 1VQ4A 2M16A 5LJ3h 1YBYA 3PVLA 1W70A 5KYNA 4MDXA 3CCRA 3IQLA 2GF7A 3VUBA 3TQ7P 4ZTFA 1MV0B 1PG5B 3OW2P 1Z9QA 1O75A 3I5SA 2DEQA 3H6ZA 3R6NA 2OTLA 4A63B 1KQ2A 4R0KA 2VV5A 4II1A 2NUPA 3PIPA 2OTJT 1SPKA 3OA6A 3OYLA 1J3TA 2K9GA 1GFDA 1PRMC 3GNFB 4CC2A 4LUEA 3HRTA 4DBFA 5HCKA 2DF6A 3U23A 3FC3A 5GAOr 3QDRB 2CH4A 4QVDA 3M56A 4C0GA 3OYGA 2MYSA 3M9QA 2RK2A 2E64A 1BIBA 4FSXA 1R8OB 4BE2A 2KR3A 3FRNA 4ZTJA 2LNVA 1NG2A 2J6FA 1YITA 3M54A 3OS0A 3RMSA 1Q82U 3QBYA 1GCQA 2X9HA 3SB2A 3G4SQ 2EGCA 3RR6A 2FZCB 2KRSA 1BI1A 3NTKA 3JCMh 4ELZC 3M5AA 4EMKB 2JW4A 1OZ2A 1N8RC 2YDLA 1RL2A 2E65A 2Z0WA 3CMEA 3CCSA 4M7DD 3A8HB 5GMKl 4AFUC 2QQSA 1VQ6T 2NUTA 4J9FA 4M75C 1Y57A 2DXCA 3MCAB 3BDUA 3RKXA 1I8FA 1NM7A 1VQOA 3OYFA 4J5YA 3TCJA 2L0AA 3HHTB 3JAME 2O88A 2HDAA 2K4YA 3CC2T 2BTTA 4AG2C 4M7DG 3OMGA 2ED1A 5LJ5d 1BK2A 2JTEA 1SEMA 2VXFA 2E3HA 4PLIA 3H0HA 3SHWA 4F16A 1JBMA 4PJOE 1M8VA 3L42A 3V8KA 2HMAA 1AWXA 5GAOl 2F5TX 3JB9J 3A8GB 4X9DA 1K9MR 4JRKA 3JV3A 3I9QA 3OYHA 2OAWA 4RTTA 1WQWA 1E6HA 4ZN1A 2JM8A 3CCQA 1H92A 4XU3A 3MP1A 3GPLA 2DXTA 2AIRB 3RUXA 2KYMA 4C5GA 3SD4A 3X25B 2O2OA 4ME7A 1MMDA 2O9SA 4JUVA 1Q86U 2JJ9A 2Y90A 1TG0A 3QG1A 2DO3A 3EFRA 1ZX6A 1SG5A 1Q7YC 4EMKA 2EYZA 2QEXT 3PE0A 3CCJT 4J9GA 1U1SA 1YJWQ 1T0JA 3T9NA 2DXUA 3TSZA 2JTMA 1VIEA 3TU4K 2RB6A 2A28A 4KH0B 3FLGA 2GTJA 4E7SA 4J6XA 1AEYA 1PRLC 4GLKA 1X01A 4DBRA 3ME9A 4J9CA 1QMCA 5CQYA 1RADB 4ZGJB 3CCEA 2EAYA 2PVOB 2VB6A 3CQTA 3CXCP 1U3OA 1NE8A 1WXTA 2KEAA 4Z8AA 2RNAA 2EGAA 2K5FA 2KXCA 3A8LB 5GAN2 1K1ZA 3ASKA 5KYXB 3WXMB 1WHHA 3EFOB 5GJWB 5L8RE 4F17A 1VQ8A 2V8IA 4B6MA 3VV0A 2PZ1A 3GIBA 4HXJA 1KC8U 4X1VA 1PCXA 1TWBA 5GANe 4QQDA 2XDPA 5A2QE 2NWMA 2QQ9A 1YCYA 1G2BA 2KAFA 4Y28E 1UTIA 2QQBA 1W2BA 1RAAB 3CXCS 2A7YA 3TREA 3OY9A 2V8KA 1VQ9T 3CCVT 2KDSA 5KYUB 4XAXB 1VQPQ 4PJJA 1FX7A 5KE3A 3H8ZA 1GBRA 2OI3A 1BKBA 4EDUA 2RHZA 3ZFJA 3HP9A 3OYJA 3QJ6A 1BCOA 2CREA 1ZUUA 3H9NA 5IHNA 5GAN6 5GAN7 1ZQ1A 4LD9K 2RHIA 1YIJQ 2L3PA 4E47A 3NPFA 4EMHA 4J9HA 1VQLQ 2LZ6B 2F1LA 1KQ1A 4HT8A 1OU8A 3FJ5A 4ZNXA 3LGLA 1D0XA 4NL3A 1QCOA 4QQGA 2HSPA 1Y07A 4C92B 1VQ7Q 2LT1A 2DK3A 3F70A 5HY6A 4C92F 2XIDA 4NOYA 4JRPA 2DBKA 4OB1B 1PD0A 1YNZA 4PJLA 5LJ3f 3NGPA 5LJ5h 2ZPFB 2CSQA 2EYWA 2HAXA 5A0LA 1WJSA 4PJOD 2QA4Q 1ABQA 2JMAA 1I4K1 5GAMj 2EWNA 1G8XA 5KYXA 1Q82R 4FU6A 3J80E 2PQWA 1Z9ZA 4XK8E 2CT4A 1JXOA 2XG8D 4OB2B 2RI3A 2FO0A 1G83A 3CCMT 2PVGB 3KFVA 4V2SA 1FYNA 4FYYB 5C0MA 3EG3A 1K0XA 2YT6A 2EQUA 1YI2A 1W2BP 3NMZC 2SRCA 3L2ZA 3QZ9B 4PJOG 4X9CA 2FL7A 2RF0A 4RTXA 2LQKA 2P0PA 5FU6C 4M4ZA 4C8QC 5KYUA 4ESRA 2E5KA 1JXMA 3EAEA 3CD6T 1RI0A 1LOJA 3M0RA 4MDWA 2XU8A 3R6OA 2W10A 3I55T 2IPOB 3N5BB 3HPWA 2Y4XA 2ENMA 1WLPB 3OYAA 2LVMA 2X3XD 3CC7A 1LNXA 4NL2A 1YJ9T 4OMMA 3L2UA 1D09B 1NLPC 3M57A 4J6WA 2KT1A 4JZ4A 2FRWA 4Y91A 1W2BS 3I56A 2M02A 1VQ4Q 4XTWA 1VA7A 3C94A 5EC7A 3OQ5A 1JRIA 1AD5A 2KE9A 4QVZA 3CCRQ 1T3SA 1BB9A 2J7IA 2DJQA 3LYIA 2VC8A 6AT1B 3EH2A 1MHNA 1YP5A 2JVVA 2HD0A 4IUUA 2KROA 2OTLQ 3CCLT 1Y0MA 2OAUA 4C0FA 4WTOB 3MKDA 4KULA 3M0TA 3SDZA 4PK4A 1N8RR 1WI7A 3HSBA 2OTJA 3EGUA 3SWNC 4L5GA 1YFNA 1Q86R 2V1QA 2BE9B 1TOVA 2EJFA 2YUQA 4HCZA 2LQ8A 4JPBW 4E7ZA 2XHCA 4O5VA 2CP3A 2LTOA 2DL5A 2FYKA 2KI7A 4LUDA 2EQMA 3OSSC 3M53A 2FVUA 5GAOp 3NTHA 1EZZB 1KHIA 1M1GA 5CK9A 1F1BB 1OPKA 2HBWA 1JJ2A 3EFSA 3JCMX 1VOMA 1YITQ 1OX8A 5CIUA 4RMOA 1I5LA 4OGCA 1M1KU 1D1BA 2DL7A 2YXYA 4BI3A 2G6FX 1LCKA 3FIFA 4RTUA 7AT1B 2W0ZA 1M2VB 1S72T 1IRXA 3CMEQ 3CCSQ 4BE0A 3J7AF 3O5ZA 1NZ9A 4HVVA 3G4ST 1SHGA 3VS6A 1XQHA 1ZUKA 1LPLA 2EYXA 3H41A 1BU1A 4J6YA 1VQ6A 5I11A 2QASA 1VQOQ 2YLBA 2DRKA 1RABB 2KXDA 2M1HA 2FZGB 5D6XA 5GMKh 1FWZA 1N6AA 3FB9A 2OX7A 2QQRA 5CKBA 2YHTA 3M0PA 3A8MB 1WIEA 4JJDA 2A0FB 5GAN4 3QSUA 4A4HA 3CC2A 4XU1A 3LLRA 5C6SA 3H0FA 2NUPB 4MZMA 3GOXA 1KG1A 3FEOA 3RBBB 3JCMg 2COYA 1DJ7B 2LC4A 4BUGA 1FXXA 4C92E 5GAMg 3G71A 2IIMA 4JJBA 2VVKA 3CC4A 1TS9A 4PFZA 1TUCA 3ULRB 3UA7A 4Z88A 4MMKA 2FPEA 3QIIA 1U8RA 3CCQQ 4HCKA 4X34A 2HL3A 2V1RA 2EIFA 2RJFA 2FEIA 3A8OB 1OPLA 1WFWA 2CP2A 1K8AC 4M77B 5GANd 2K57A 3X28B 4PJMA 4AFQC 4M77F 5J3BA 4PKCC 1GCPA 4M7AB 1M2VA 1UHFA 1VQKA 2CP0A 2OJ2A 3FJPA 4M7AF 1WHKA 3UPUA 1A0NB 3M0SA 4IKFA 2DTHA 3UATA 1RUWA 2ABLA 2E6NA 2DFUA 2ECZA 4KUIA 1CKBA 2VKNA 1M90U 3CCEQ 1VQ5A 1FMWA 3SFMA 4EMGA 1SSFA 3VRYA 1YJWT 4HCBA 1M9SA 4RKUE 1MNEA 3MPUB 1JQQA 2DPPB 1X6GA 2ZPIB 2FPFA 2QDLA 1JU5C 5LJ5f 1R0BG 1VQ8Q 1C1AA 2O01E 4O6JA 2XD0A 3MEUA 1I0CA 2LJ1A 3QXEB 2RQUA 5CKHA 4XU2A 5LL6S 3WVEB 1Y71A 5KE2A 3G7ZA 4A4KA
chains in the Genus database with same CATH topology
2A28A 1YWPA 1XOVA 1SSHA 2JS0A 2GTJA 2M0YA 2JT4A 2PNIA 2K3BA 1PRLC 2ROLA 1AEYA 2JMCA 2K7AA 3NHNA 4J9CA 1QWFA 2BZXA 3ZL7C 4HVUA 2CH4W 4RTWA 1I07A 1IO6A 1K76A 3CQTA 4LNPA 1U3OA 1WXBA 1WXTA 4J9EA 2KEAA 4Z8AA 2A36A 2RNAA 2EGAA 2KXCA 2EQIA 3VS7A 1K0SA 3M0UA 1K1ZA 2DVJA 2GTOA 2O31A 4IIOA 1EFNA 2C0OA 5GJWB 4F17A 3VS2A 2PZ1A 4HXJA 2LMJA 2J6KA 4X1VA 2LQWA 1B07A 1S1NA 1M27C 2LQNA 2H8HA 2AZVA 2NWMA 1G2BA 1WX6A 1PKTA 1UTIA 4AFZC 1NEBA 1GCQC 2F2VA 2KT8A 5IXFA 1AZEA 2CT3A 1BBZA 2RQWA 1T0HA 1GBRA 2OI3A 3REAB 4RTZA 2LX7A 2RN8A 2CREA 4EIKA 1ZUUA 5IHNA 4J9DA 1M3CA 1ABOA 2FG0A 1M8MA 1OEBA 1KIKA 3I35A 2L3PA 2DL3A 3NPFA 2J6OA 4J9HA 1OOTA 2LZ6B 4OMOA 1GFCA 1QKXA 4CC4B 1QCFA 3FJ5A 4ZNXA 2KYBA 1QLYA 4Z89A 1X69A 2HSPA 5I22A 4QT7A 1WDXA 4AG1C 2DRMA 1H3HA 2K6DA 4Y92A 2AZSA 3I5RA 1U06A 2DBKA 1PHTA 1VYVA 2PTKA 2AKKA 4WCIA 1YNZA 5IXBA 4JZ3A 4D8DA 3NGPA 4AFSC 2YUOA 2DA9A 1RLPC 2CSQA 1V1CA 2MIOA 2EYWA 3EG1A 4CC7A 1UECA 2AKLA 1ABQA 1QKWA 2JMAA 1B3QA 1UFFA 2XMFA 2EPDA 1Z9ZA 4J9IA 2CT4A 2DMOA 1JXOA 1H8KA 2FO0A 2KRMA 1G83A 2BZYA 3EHRA 1PKSA 1X27A 2LCSA 3KFVA 2JXBA 2GGRA 1FYNA 3SEMA 3EG3A 1M30A 1ZLMA 1NEGA 1NLOC 4DEYA 2YT6A 1K0XA 2CUDA 3NMZC 2SRCA 2L3SA 1N5ZA 2RF0A 1HD3A 3EG2A 4ORZA 4RTXA 4M4ZA 3VS1A 2DILA 4ESRA 2E5KA 2DL8A 1JXMA 4FSSA 2LNHB 1OV3A 1X2QA 1YN8A 1K9AA 2MOXA 4K11A 3M0RA 2DL4A 1KFZA 4LN2A 2W10A 1E7OA 1YCSB 4CC3A 2ENMA 1WLPB 3C0CA 1TUDA 2ESWA 1UE9A 2RQTA 2X3XD 3LH5A 2LJ3A 3RNJA 1AOJA 4OMMA 2I0NA 4GBQA 2KNBB 1NLPC 1GBQA 2KT1A 4JZ4A 2FRWA 1M3AA 1ZBJA 1M3BA 4RTYA 2CSIA 1VA7A 2GNCA 1AVZC 5EC7A 2X3WD 3VS5A 1AD5A 2KE9A 2KGTA 1T3SA 4OMNA 1BB9A 2J7IA 2ROTA 2DJQA 1T3LA 2D8HA 1AWJA 2RQVA 2VWFA 1KJWA 2EVRA 2F2XA 1UHCA 3EHQA 2FRYA 1YP5A 4DEXA 2JM9A 2KROA 2K2MA 1Y0MA 5ECAA 4D8KA 2RPNA 3M0TA 3REBB 1WI7A 1GRIA 3EGUA 2DX1A 4KRTA 2LJ0A 3A98A 2CDTA 2RQRA 2MCNA 1FMKA 2V1QA 2YUQA 2BZ8A 2KRNA 1MUZA 1UUEA 4JPBW 3UF4A 1CSKA 2DL5A 5FW9A 1AWOA 4LUDA 1ARKA 4OMLA 3GBQA 4IIMA 1X43A 1OPKA 2HBWA 4OMQA 2D1XA 2YSQA 2ED0A 3QWYA 3PVLA 1W70A 2D8JA 2EKHA 1KSWA 2DL7A 3IQLA 1W6XA 2G6FX 2J05A 1LCKA 1RI9A 4RTUA 1MV0B 1Z9QA 2D0NA 3VS4A 3I5SA 1UG1A 3R6NA 2W0ZA 4A63B 1X6BA 4R0KA 1WXUA 2P4RA 3TSWA 1SPKA 1J3TA 1GL5A 1UDLA 2K9GA 1GFDA 1PRMC 3O5ZA 4CC2A 4HVVA 4LUEA 1U5SA 3VS0A 1NYFA 1UGVA 1SHGA 2C0IA 2L2PA 5FWCA 2B86A 3VS6A 1ZUKA 2EYXA 3H41A 5HCKA 1BU1A 2DF6A 1ZSGA 3U23A 5I11A 2CH4A 4OMPA 2GBQA 3M0QA 1VYUA 2DRKA 2KXDA 1UJYA 2A08A 3QWXX 2KR3A 3M0PA 1SHFA 1NG2A 2J6FA 1WIEA 4LE9A 4J9BA 4JJDA 4RTVA 1GCQA 1MV3A 1W1FA 5GJVB 2EGCA 3H0FA 3RBBB 2KRSA 3EG0A 2J06A 2HCKA 2JW4A 1K4US 2YUPA 2YDLA 2IIMA 4JJBA 2DE0X 2VVKA 1I1JA 1HJDA 1TUCA 3ULRB 1CKAA 3UA7A 2DBMA 1HSQA 5IH2A 1X2KA 2FPDA 4Z88A 4HVWA 1VYTA 3THKA 1PNJA 2FPEA 4AFUC 1UJ0A 2DYBA 4J9FA 4HCKA 2M51A 1Y57A 2V1RA 2FEIA 1JO8A 1OPLA 2SEMA 1NM7A 2DNUA 1WFWA 1JEGA 1QWEA 1SRLA 2L0AA 2F2WA 2AK5A 2GQIA 2O9VA 2LP5A 4AFQC 1YWOA 2O88A 2HDAA 1GCPA 2BTTA 4AG2C 4GLMA 1UHFA 2ED1A 1BK2A 2L3QA 2OJ2A 4F14A 2A37A 2JTEA 1SEMA 1AWWA 1A0NB 3H0HA 1RLQC 3SHWA 3M0SA 4F16A 3UA6A 2HEQA 3UATA 1RUWA 2ABLA 1SRMA 1AWXA 2ECZA 4RUGA 2JS2A 2DLPA 1AZGB 1CKBA 2VKNA 3JV3A 1ZUYA 3VRYA 3I9QA 2EYYA 3PVQA 2OAWA 4RTTA 2EBPA 2EW3A 2K79A 1E6HA 5IHKA 1WA7A 2JM8A 1H92A 4E6RA 1JQQA 3TVTA 2KBTA 3VRZA 3VS3A 1X6GA 4JJCA 5L23A 1WYXA 2KYMA 2FPFA 2O2OA 2O9SA 2QDLA 1JU5C 1TG0A 5IHIA 2CUBA 5FWBA 1PWTA 1ZX6A 2EYZA 3PE0A 1I0CA 2EGEA 4J9GA 2YUNA 2LJ1A 2DM1A 2RQUA 2NUZA 1T0JA 2C0TA 2RMOA 3H0IA 3TSZA 1E6GA 1NYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A28 A;  1YWP A;  1XOV A;  1SSH A;  2JS0 A;  2GTJ A;  2M0Y A;  2JT4 A;  2PNI A;  2K3B A;  1PRL C;  2ROL A;  1AEY A;  2JMC A;  2K7A A;  3NHN A;  4J9C A;  1QWF A;  2BZX A;  3ZL7 C;  4HVU A;  2CH4 W;  4RTW A;  1I07 A;  1IO6 A;  1K76 A;  3CQT A;  4LNP A;  1U3O A;  1WXB A;  1WXT A;  4J9E A;  2KEA A;  4Z8A A;  2A36 A;  2RNA A;  2EGA A;  2KXC A;  2EQI A;  3VS7 A;  1K0S A;  3M0U A;  1K1Z A;  2DVJ A;  2GTO A;  2O31 A;  4IIO A;  1EFN A;  2C0O A;  5GJW B;  4F17 A;  3VS2 A;  2PZ1 A;  4HXJ A;  2LMJ A;  2J6K A;  4X1V A;  2LQW A;  1B07 A;  1S1N A;  1M27 C;  2LQN A;  2H8H A;  2AZV A;  2NWM A;  1G2B A;  1WX6 A;  1PKT A;  1UTI A;  4AFZ C;  1NEB A;  1GCQ C;  2F2V A;  2KT8 A;  5IXF A;  1AZE A;  2CT3 A;  1BBZ A;  2RQW A;  1T0H A;  1GBR A;  2OI3 A;  3REA B;  4RTZ A;  2LX7 A;  2RN8 A;  2CRE A;  4EIK A;  1ZUU A;  5IHN A;  4J9D A;  1M3C A;  1ABO A;  2FG0 A;  1M8M A;  1OEB A;  1KIK A;  3I35 A;  2L3P A;  2DL3 A;  3NPF A;  2J6O A;  4J9H A;  1OOT A;  2LZ6 B;  4OMO A;  1GFC A;  1QKX A;  4CC4 B;  1QCF A;  3FJ5 A;  4ZNX A;  2KYB A;  1QLY A;  4Z89 A;  1X69 A;  2HSP A;  5I22 A;  4QT7 A;  1WDX A;  4AG1 C;  2DRM A;  1H3H A;  2K6D A;  4Y92 A;  2AZS A;  3I5R A;  1U06 A;  2DBK A;  1PHT A;  1VYV A;  2PTK A;  2AKK A;  4WCI A;  1YNZ A;  5IXB A;  4JZ3 A;  4D8D A;  3NGP A;  4AFS C;  2YUO A;  2DA9 A;  1RLP C;  2CSQ A;  1V1C A;  2MIO A;  2EYW A;  3EG1 A;  4CC7 A;  1UEC A;  2AKL A;  1ABQ A;  1QKW A;  2JMA A;  1B3Q A;  1UFF A;  2XMF A;  2EPD A;  1Z9Z A;  4J9I A;  2CT4 A;  2DMO A;  1JXO A;  1H8K A;  2FO0 A;  2KRM A;  1G83 A;  2BZY A;  3EHR A;  1PKS A;  1X27 A;  2LCS A;  3KFV A;  2JXB A;  2GGR A;  1FYN A;  3SEM A;  3EG3 A;  1M30 A;  1ZLM A;  1NEG A;  1NLO C;  4DEY A;  2YT6 A;  1K0X A;  2CUD A;  3NMZ C;  2SRC A;  2L3S A;  1N5Z A;  2RF0 A;  1HD3 A;  3EG2 A;  4ORZ A;  4RTX A;  4M4Z A;  3VS1 A;  2DIL A;  4ESR A;  2E5K A;  2DL8 A;  1JXM A;  4FSS A;  2LNH B;  1OV3 A;  1X2Q A;  1YN8 A;  1K9A A;  2MOX A;  4K11 A;  3M0R A;  2DL4 A;  1KFZ A;  4LN2 A;  2W10 A;  1E7O A;  1YCS B;  4CC3 A;  2ENM A;  1WLP B;  3C0C A;  1TUD A;  2ESW A;  1UE9 A;  2RQT A;  2X3X D;  3LH5 A;  2LJ3 A;  3RNJ A;  1AOJ A;  4OMM A;  2I0N A;  4GBQ A;  2KNB B;  1NLP C;  1GBQ A;  2KT1 A;  4JZ4 A;  2FRW A;  1M3A A;  1ZBJ A;  1M3B A;  4RTY A;  2CSI A;  1VA7 A;  2GNC A;  1AVZ C;  5EC7 A;  2X3W D;  3VS5 A;  1AD5 A;  2KE9 A;  2KGT A;  1T3S A;  4OMN A;  1BB9 A;  2J7I A;  2ROT A;  2DJQ A;  1T3L A;  2D8H A;  1AWJ A;  2RQV A;  2VWF A;  1KJW A;  2EVR A;  2F2X A;  1UHC A;  3EHQ A;  2FRY A;  1YP5 A;  4DEX A;  2JM9 A;  2KRO A;  2K2M A;  1Y0M A;  5ECA A;  4D8K A;  2RPN A;  3M0T A;  3REB B;  1WI7 A;  1GRI A;  3EGU A;  2DX1 A;  4KRT A;  2LJ0 A;  3A98 A;  2CDT A;  2RQR A;  2MCN A;  1FMK A;  2V1Q A;  2YUQ A;  2BZ8 A;  2KRN A;  1MUZ A;  1UUE A;  4JPB W;  3UF4 A;  1CSK A;  2DL5 A;  5FW9 A;  1AWO A;  4LUD A;  1ARK A;  4OML A;  3GBQ A;  4IIM A;  1X43 A;  1OPK A;  2HBW A;  4OMQ A;  2D1X A;  2YSQ A;  2ED0 A;  3QWY A;  3PVL A;  1W70 A;  2D8J A;  2EKH A;  1KSW A;  2DL7 A;  3IQL A;  1W6X A;  2G6F X;  2J05 A;  1LCK A;  1RI9 A;  4RTU A;  1MV0 B;  1Z9Q A;  2D0N A;  3VS4 A;  3I5S A;  1UG1 A;  3R6N A;  2W0Z A;  4A63 B;  1X6B A;  4R0K A;  1WXU A;  2P4R A;  3TSW A;  1SPK A;  1J3T A;  1GL5 A;  1UDL A;  2K9G A;  1GFD A;  1PRM C;  3O5Z A;  4CC2 A;  4HVV A;  4LUE A;  1U5S A;  3VS0 A;  1NYF A;  1UGV A;  1SHG A;  2C0I A;  2L2P A;  5FWC A;  2B86 A;  3VS6 A;  1ZUK A;  2EYX A;  3H41 A;  5HCK A;  1BU1 A;  2DF6 A;  1ZSG A;  3U23 A;  5I11 A;  2CH4 A;  4OMP A;  2GBQ A;  3M0Q A;  1VYU A;  2DRK A;  2KXD A;  1UJY A;  2A08 A;  3QWX X;  2KR3 A;  3M0P A;  1SHF A;  1NG2 A;  2J6F A;  1WIE A;  4LE9 A;  4J9B A;  4JJD A;  4RTV A;  1GCQ A;  1MV3 A;  1W1F A;  5GJV B;  2EGC A;  3H0F A;  3RBB B;  2KRS A;  3EG0 A;  2J06 A;  2HCK A;  2JW4 A;  1K4U S;  2YUP A;  2YDL A;  2IIM A;  4JJB A;  2DE0 X;  2VVK A;  1I1J A;  1HJD A;  1TUC A;  3ULR B;  1CKA A;  3UA7 A;  2DBM A;  1HSQ A;  5IH2 A;  1X2K A;  2FPD A;  4Z88 A;  4HVW A;  1VYT A;  3THK A;  1PNJ A;  2FPE A;  4AFU C;  1UJ0 A;  2DYB A;  4J9F A;  4HCK A;  2M51 A;  1Y57 A;  2V1R A;  2FEI A;  1JO8 A;  1OPL A;  2SEM A;  1NM7 A;  2DNU A;  1WFW A;  1JEG A;  1QWE A;  1SRL A;  2L0A A;  2F2W A;  2AK5 A;  2GQI A;  2O9V A;  2LP5 A;  4AFQ C;  1YWO A;  2O88 A;  2HDA A;  1GCP A;  2BTT A;  4AG2 C;  4GLM A;  1UHF A;  2ED1 A;  1BK2 A;  2L3Q A;  2OJ2 A;  4F14 A;  2A37 A;  2JTE A;  1SEM A;  1AWW A;  1A0N B;  3H0H A;  1RLQ C;  3SHW A;  3M0S A;  4F16 A;  3UA6 A;  2HEQ A;  3UAT A;  1RUW A;  2ABL A;  1SRM A;  1AWX A;  2ECZ A;  4RUG A;  2JS2 A;  2DLP A;  1AZG B;  1CKB A;  2VKN A;  3JV3 A;  1ZUY A;  3VRY A;  3I9Q A;  2EYY A;  3PVQ A;  2OAW A;  4RTT A;  2EBP A;  2EW3 A;  2K79 A;  1E6H A;  5IHK A;  1WA7 A;  2JM8 A;  1H92 A;  4E6R A;  1JQQ A;  3TVT A;  2KBT A;  3VRZ A;  3VS3 A;  1X6G A;  4JJC A;  5L23 A;  1WYX A;  2KYM A;  2FPF A;  2O2O A;  2O9S A;  2QDL A;  1JU5 C;  1TG0 A;  5IHI A;  2CUB A;  5FWB A;  1PWT A;  1ZX6 A;  2EYZ A;  3PE0 A;  1I0C A;  2EGE A;  4J9G A;  2YUN A;  2LJ1 A;  2DM1 A;  2RQU A;  2NUZ A;  1T0J A;  2C0T A;  2RMO A;  3H0I A;  3TSZ A;  1E6G A;  1NYG A; 
#chains in the Genus database with same CATH topology
 3BY7 A;  1KD1 U;  2JS0 A;  1BI2 A;  4FIB A;  2VYT A;  3GNG A;  2ROL A;  3CBP A;  3ZL7 C;  2CH4 W;  2P84 A;  1VQ9 A;  4BY6 C;  4FYV B;  4M77 A;  1IO6 A;  1NPP A;  1K76 A;  1EIF A;  1WXB A;  1VQM A;  1RAG B;  3QKJ A;  2A36 A;  2LDM A;  4M7A A;  1SKU B;  3VYG A;  3VS7 A;  3M0U A;  1G3W A;  3LWH A;  1IHV A;  1VQP T;  4IUR A;  2C0O A;  5DLO A;  2RHX A;  1D0Z A;  4M78 C;  3PMT A;  3MO8 A;  3EGD A;  1K73 C;  2MAM A;  2LQW A;  1B34 B;  1B07 A;  1S1N A;  1M27 C;  2H8H A;  2AZV A;  3OS5 A;  2AT1 B;  3CMA A;  1YIJ T;  1NEB A;  2H3J A;  3QYG B;  2KT8 A;  1KK7 A;  1AZE A;  2YWW A;  3CXC A;  4IUT A;  5GMK i;  1PM3 A;  1ZBX A;  5J39 A;  2QAZ A;  4OF1 A;  2K3X A;  4C92 D;  3REA B;  3QYH B;  4M75 B;  5I2M A;  1M1K R;  3QO3 A;  1TTH B;  2RN8 A;  2GCX A;  3L1A A;  4EIK A;  4LD6 A;  3L2Q A;  3HRU A;  2FG0 A;  2DIQ A;  1VUB A;  3CCU T;  2RA2 A;  3JB9 H;  4A54 A;  4CC4 B;  1C6V X;  2QA4 T;  1YI2 Q;  2KYB A;  4D6W A;  1I5O B;  3G6E A;  4C92 G;  1WDX A;  2HSE B;  5GMK j;  4AG1 C;  2DZC A;  2DRM A;  4Y92 A;  2RD1 A;  3I5R A;  1U06 A;  1N8R U;  3CD6 A;  2PTK A;  4ELY C;  4BI8 B;  5IXB A;  2A3L A;  2HKN A;  1RLP C;  1V1C A;  2MIO A;  3EG1 A;  1UEC A;  5FLX E;  3I55 A;  1QKW A;  3CC7 Q;  1KC8 C;  5FRN A;  4C0D B;  5AYF A;  2EPD A;  3LGF A;  3JCM e;  2RI5 A;  2RHU A;  2JNG A;  5GAM e;  3UT1 A;  2V8J A;  3OYK A;  1YJ9 A;  2RH2 A;  2R58 A;  3X24 B;  3P8H A;  2BZY A;  1B34 A;  2LCS A;  4WF2 A;  4M77 E;  3BW1 A;  4DEY A;  4AT1 B;  4FW2 A;  4CRI A;  2CZ7 B;  5CCA A;  2E1H A;  1D1A A;  2R5A A;  1N5Z A;  4M7A E;  2KMT A;  5CAI A;  4FSS A;  1X2Q A;  1VQ4 T;  3CCL A;  1ZA2 B;  4RCC A;  1Q81 C;  4M75 A;  4N0A C;  2OTJ Q;  4E7I A;  1BIA A;  2O4X B;  3UDC A;  4DQ2 A;  2VUB A;  4F7U B;  4CC3 A;  4F04 B;  4B9W A;  2EQK A;  3OYN A;  3E9G A;  2EYQ A;  2HQH A;  1NJI C;  4GBQ A;  1PSE A;  5LJ3 j;  1ZBJ A;  1M3B A;  4RTY A;  2L5Q A;  4BDZ A;  1TSF A;  2KSS A;  1IGU A;  2GNC A;  2GFA A;  2LX9 A;  3VS5 A;  3MEW A;  4R55 A;  1Q7Y U;  1OQK A;  2KGT A;  3P8B B;  1YJN A;  1UGQ B;  1VIF A;  2IG0 A;  2ROT A;  2D8H A;  1AWJ A;  4M7D C;  2PUO B;  3JCM b;  1BCM A;  3EHQ A;  1M90 R;  1IXD A;  4A4F A;  3KBG A;  2JM9 A;  1RAH B;  1I81 A;  3C12 A;  1XNI A;  3BDL A;  3MP8 A;  2FB7 A;  3REB B;  1QP3 A;  1S72 A;  1GRI A;  1NPR A;  2DAQ A;  2VGN A;  1QQJ A;  2X51 A;  2JOY A;  4XTU A;  4C92 C;  2BZ8 A;  1VQ6 Q;  2FHD A;  5I21 A;  2E3I A;  3JCM Q;  1CSK A;  2WSF E;  4NS5 A;  4N4I A;  3HFO A;  5GAN 3;  3Q1J A;  2YRC A;  2M0O A;  1K8A R;  3OYC A;  2ED0 A;  2CZ1 B;  5CR2 A;  1KD1 R;  2EKH A;  1KSW A;  3OBY A;  2J05 A;  3CBO A;  1RI9 A;  3OYD A;  4ZN3 A;  1VQO T;  2O4X A;  3VS4 A;  3RKW A;  3QJY A;  2K3Y A;  4F7U A;  3G71 Q;  3V7S A;  1X6B A;  1WXU A;  2P4R A;  3TSW A;  1TUG B;  3CC4 Q;  3RIR A;  2HL5 C;  4BD3 A;  2RJC A;  2P4T A;  2AHJ B;  3VS0 A;  1NYF A;  1UGV A;  2C0I A;  2L2P A;  4L59 A;  4OB0 B;  3WVD B;  3E2U A;  1YHQ A;  1GXI E;  4M75 E;  3CPF A;  2PUK B;  2GFU A;  2COW A;  4DBH A;  3BFM A;  1QCN A;  3DKM A;  3JB9 I;  4J9B A;  3CCQ T;  1VQK Q;  4RTV A;  1MV3 A;  1W4S A;  5GJV B;  1N27 A;  3C4S A;  1R77 A;  3VYH B;  2F5K A;  4M77 D;  1MMA A;  4C8Q B;  3EG0 A;  4E7J A;  2HBP A;  1VQN A;  2YUP A;  3OB9 A;  4DOV A;  2QTV A;  4M7A D;  4PJN A;  1VQ5 Q;  1Y96 B;  2DBM A;  1HSQ A;  4QVC A;  1X2K A;  2FPD A;  2ATC B;  3HFN A;  2CZ6 B;  1VYT A;  2H3E B;  3THK A;  1Q95 G;  1UJ0 A;  4C5E A;  3S6W A;  1JO8 A;  4JLI A;  2KQW A;  3EH1 A;  2SEM A;  4BDY A;  4JRI A;  4M77 G;  4E7K A;  1QVF A;  2EKO A;  4LXC A;  1QWE A;  5J26 A;  1K9M C;  2AK5 A;  2KVQ G;  2CKK A;  2O9V A;  4A4E A;  2LP5 A;  3CCE T;  3E1S A;  4M7A G;  4J7F A;  4GLM A;  3OSV A;  4QQ6 A;  2D9T A;  2L3Q A;  2A37 A;  1BI3 A;  1X75 C;  1B7T A;  2COZ A;  3V7C A;  3DLL A;  1WJR A;  5FRM A;  5DLQ E;  4N4H A;  1VQ8 T;  4RUG A;  2JS2 A;  3FDR A;  2DVE A;  1MND A;  2DD4 A;  5LJ3 g;  3PMI A;  3AHU A;  1VQ9 Q;  3SWN B;  4XTY A;  1ZUY A;  1TH7 A;  2EYY A;  3D7S B;  2EBP A;  2EW3 A;  4BI4 A;  2X4J A;  1VQM Q;  4F7U E;  5GAN f;  3PTA A;  4LDU A;  2KBT A;  3VRZ A;  3RKY A;  3M59 A;  5A0D A;  3VS3 A;  5FU7 C;  5L23 A;  4E2F B;  2BE7 D;  4KGZ B;  4LDW A;  4C8Q A;  5IHI A;  4JDS A;  4C0Z A;  2CUB A;  5FWB A;  1PWT A;  3JRZ A;  3PGG A;  3CBM A;  2EGE A;  2YUN A;  1ZSZ C;  2DM1 A;  1G5V A;  2NUZ A;  2C0T A;  4PJO C;  2RMO A;  4KH1 B;  3EG9 B;  1Y96 A;  3H0I A;  3E9F A;  3CMA Q;  1E6G A;  3ZEH A;  3HKS A;  1IHW A;  1YWP A;  1XOV A;  2E41 A;  3JCM d;  1SF9 A;  2DKG A;  2M0Y A;  2JT4 A;  5GAM d;  2LRQ A;  2PNI A;  2JMC A;  1QWF A;  2BZX A;  1QVF P;  3JCM W;  4HVU A;  1PD1 A;  1H3Z A;  4RTW A;  3EGX B;  1ZA1 B;  1Q7Y R;  1XTD A;  4J9E A;  2CS7 A;  9ATC B;  3PNW C;  1M2O A;  2E10 A;  3DB4 A;  1K0S A;  5GMK m;  2DVJ A;  2GTO A;  2LCL A;  4JS5 A;  3CCU A;  5KCH A;  2DTO A;  4LDV A;  4M75 D;  3G6E Q;  2K5L A;  3O8V A;  1D0Y A;  3URG A;  2DZ9 A;  2LMJ A;  2J6K A;  2MF2 A;  4FYW B;  5KCO A;  2LQN A;  3SWN A;  4Z02 A;  1QVF S;  1WX6 A;  5LJ5 j;  4AFZ C;  1GCQ C;  4DBQ A;  5IXF A;  4IUQ A;  2RI2 A;  5CO7 A;  1YI2 T;  1LVK A;  2D0Q B;  1BBZ A;  4M7A C;  3JB9 G;  2ZGW A;  4KGV B;  2HKQ B;  1ZHI A;  1QP2 A;  4PNO A;  2X35 A;  4M75 G;  1QVG S;  2QEX A;  3CCJ A;  1RAF B;  4RTZ A;  2QK0 A;  5GAO m;  4J9D A;  3OYE A;  1YJ9 Q;  4ATO A;  1KHC A;  1OEB A;  1KIK A;  3I35 A;  3DLM A;  3M4G A;  3EG9 A;  2X4X A;  2J6O A;  3EGD B;  4OMO A;  1QKX A;  4J83 A;  5KYY B;  4L6V 5;  4HKE A;  1XJW B;  3TEE A;  3CC7 T;  1QLY A;  3LW5 E;  1X69 A;  4Z89 A;  1Q82 C;  1OYX A;  5I22 A;  5CQX A;  4LDY A;  8ATC B;  2AZS A;  2M9U A;  1OUL A;  5GMK e;  3S3M A;  3CCL Q;  3A5Z B;  3EGX A;  5EG2 A;  4C8Q E;  1PHT A;  4FW1 A;  2AKL A;  3PIO A;  4XU0 A;  1B3Q A;  2KK4 A;  5GAO n;  1UFF A;  3ER0 A;  1WHJ A;  2MWP A;  3INZ A;  2K2V A;  3JCM V;  4J9I A;  4BAC A;  1K8A U;  3E19 A;  2KRM A;  3EHR A;  3ZBD A;  4ANJ A;  3SEM A;  2MK5 A;  1M30 A;  1ZLM A;  1YJN Q;  1NEG A;  1NLO C;  3CCV A;  2L3S A;  2QGF B;  4ORZ A;  1M4Z A;  3VS1 A;  2DIL A;  4MZP A;  1AT1 B;  2P0K A;  4EMK C;  2MOX A;  2XDD A;  1S72 Q;  3OW2 S;  2NYS A;  2NLU A;  2MI6 A;  2DET A;  4F7U G;  1E7O A;  2DIG A;  4BB7 A;  4KGX B;  4BY6 B;  5DY9 A;  2LT4 A;  5IN1 A;  5CKF A;  2ESW A;  1UE9 A;  2RQT A;  3LH5 A;  2LJ3 A;  5CVI A;  2BIV A;  5KYY A;  1HK9 A;  2WSE E;  4PFO A;  4C5H A;  1EX4 A;  2KNB B;  1GBQ A;  5GAM h;  4HCC A;  4RCB A;  1OI1 A;  2CSI A;  2DTI A;  2JZ2 A;  4YTL A;  1VQL T;  1AVZ C;  5LJ3 e;  1TU0 B;  1Q86 C;  1UGP B;  2X3W D;  4FT4 A;  1WNL A;  4M78 B;  1UHC A;  4RG2 A;  1VQ7 T;  2FRY A;  4OGE A;  2L89 A;  4DEX A;  3JB9 F;  4M78 F;  2ZPG B;  3QDF A;  1WQ7 A;  1WPY A;  3KUF A;  2QYZ A;  2RPN A;  4M75 F;  4FL6 A;  3C95 A;  4PL6 A;  2QDY B;  3A98 A;  2LJ0 A;  3CCM A;  1V76 A;  1G3S A;  2HNI A;  4QKU A;  1RAI B;  1MMG A;  3UF4 A;  4XTV A;  3G71 T;  1YHQ Q;  2YRD A;  5GAN h;  1HXD A;  5FW9 A;  1ARK A;  3CC4 T;  4IIM A;  5CKE A;  4OMQ A;  2D1X A;  2YSQ A;  5LJ5 g;  3QWY A;  2D8J A;  1U1T A;  2ZCF B;  1W6X A;  3MP6 A;  4C0D C;  1K73 U;  1IB8 A;  4FM4 B;  2R5M A;  1BI0 A;  2D0N A;  3X26 B;  1UG1 A;  1VQN Q;  3CPW A;  4XTX A;  3I56 Q;  2RM4 A;  2PU9 B;  2R57 A;  1GL5 A;  1UDL A;  1N9R A;  1VQK T;  1U5S A;  3HRS A;  2V26 A;  5FWC A;  2B86 A;  4C8Q D;  4VUB A;  1ZSG A;  2XIC A;  4MML A;  2ZPH B;  3AT1 B;  2C06 A;  4OMP A;  2GBQ A;  3M0Q A;  1VYU A;  2E12 A;  2ZPE B;  3VUZ A;  4M78 A;  4B9X A;  3P8D A;  1WHL A;  1UJY A;  2A08 A;  4QW2 A;  3QWX X;  1VQ5 T;  2E5Q A;  1SHF A;  2Y4Y A;  4ZGD B;  3CCR T;  4LE9 A;  5IAY A;  1IZ6 A;  1W1F A;  3RER A;  4C8Q G;  4F7U F;  4J8O A;  2OTL T;  2XI9 A;  3OYM A;  1WZO A;  2J06 A;  2HCK A;  3LWI A;  8AT1 B;  1K4U S;  4CI0 C;  3NFC A;  2DE0 X;  1I1J A;  1HJD A;  1CKA A;  5IH2 A;  4JRQ A;  2BKD N;  4FCY A;  4HVW A;  2L3R A;  1WHG A;  1FMV A;  2B8A A;  1PNJ A;  3OYI A;  2F69 A;  2EFI A;  2DYB A;  2M51 A;  4EPC A;  3LX7 A;  4FYX B;  2DNU A;  4KUD K;  1JEG A;  1KQS A;  1SRL A;  2F2W A;  3L2V A;  2GQI A;  1YIT T;  2MWO A;  2CP7 A;  1YWO A;  3CPW P;  1X6O A;  4KBM B;  5AT1 B;  2K5I A;  5GAN 8;  4OP0 A;  2RO0 A;  1VQM T;  4P5N A;  4M7D B;  4F14 A;  3JSC A;  1M1F A;  3G4S A;  3OMC A;  1AWW A;  1WHM A;  1RLQ C;  4M7D F;  2WSC E;  3UA6 A;  2HEQ A;  1Q81 U;  1SRM A;  3CME T;  3CCS T;  1AHJ B;  2DLP A;  3MET A;  5GAN 5;  2QXF A;  1AZG B;  3HL8 A;  5D6Y A;  4C5I A;  2XKO C;  3OYY A;  4JLG A;  2EJ9 A;  2VGM A;  3PVQ A;  3V8L A;  3CC2 Q;  2DD5 A;  4OVA A;  2K79 A;  5IHK A;  1WA7 A;  2IVW A;  1NJI U;  4E6R A;  5KYW B;  3L2R A;  1R0C B;  3CMA T;  3TVT A;  1PC0 A;  3CPW S;  4JJC A;  4UC4 A;  1WYX A;  3MEA A;  2XDB A;  2HQE A;  4DA4 A;  5GAO q;  2ZAE A;  3CCU Q;  2P0Q A;  1OX9 A;  2HZY A;  3CEY A;  3V8J A;  4PFP A;  4XQ3 A;  5IT9 E;  4N0A A;  3EFO A;  1RAC B;  4M78 E;  4OMF B;  1UEB A;  2PVD B;  1NYG A;  4Q5W A;  3QHS A;  1SSH A;  5HK3 A;  3M58 A;  2K3B A;  2QTX A;  2VAS A;  3OBW A;  2K7A A;  3NHN A;  3G6E T;  1KQS P;  1BYM A;  1TXQ A;  2WAC A;  1I07 A;  2MPX C;  2QEX Q;  3CCJ Q;  4LNP A;  3DB3 A;  2DYI A;  3HTR A;  5FU6 B;  3M4Y A;  1IRE B;  1M5Q 1;  2JN0 A;  2KY9 A;  2EQI A;  2QGG A;  4M7D A;  1WGS A;  4TVR A;  4C8Q F;  2O31 A;  4IIO A;  1EFN A;  3A1P A;  5GAN j;  3VS2 A;  2G3R A;  2DEU A;  4HT9 A;  1M1K C;  2MMP A;  1YJW A;  3JCM f;  2QQA A;  5GAM f;  4XTZ A;  1PKT A;  1KQS S;  2ZPB B;  2EQJ A;  2F2V A;  4C92 A;  1O9S A;  3S3N A;  5KYW A;  5LJ5 e;  2CT3 A;  4PLL A;  2RQW A;  4IUP A;  1UGR B;  1T0H A;  1QW1 A;  2CZ0 B;  1D3B B;  5HK0 A;  5LJ3 d;  1QVG A;  1G3T A;  2LX7 A;  3RMQ A;  3MHX A;  1M3C A;  1K73 R;  1ABO A;  2DXB A;  3VJP A;  1M8M A;  1MMN A;  2EJG A;  2DL3 A;  3JCM J;  5D7U A;  5FRO A;  2BUD A;  1OOT A;  1GFC A;  3GP8 A;  2I2L A;  1QCF A;  3CCV Q;  1WJQ A;  5A0G A;  1V29 B;  4IUV A;  4DOW A;  4QT7 A;  2LCC A;  4KT0 E;  2VXE A;  1HYO A;  2DER A;  2QI2 A;  3KXT A;  1H3H A;  2K6D A;  3RES A;  3OS2 A;  3MEV A;  1C0M A;  1VYV A;  2AKK A;  4WCI A;  1YJN T;  1LJO A;  4MZT A;  4JZ3 A;  4D8D A;  4AFS C;  3PFS A;  2YUO A;  2DA9 A;  2ZZD A;  1RAE B;  2L8D A;  4CC7 A;  2E4H A;  1VQP A;  4J7I A;  2GQV A;  3LH0 A;  2CP6 A;  2XMF A;  4E7L A;  1G3Y A;  2DMO A;  1H8K A;  2CP5 A;  3VKI A;  3JCM c;  5FU7 B;  5DM7 R;  1K9M U;  1ACM B;  1QVP A;  3BE3 A;  1PKS A;  1X27 A;  2FZK B;  1YIJ A;  2JXB A;  2GGR A;  1VQL A;  1H64 1;  3MJX A;  2E70 A;  2CUD A;  2RJE A;  1UGS B;  1HD3 A;  1ZSZ B;  4JS4 A;  3EG2 A;  4PJO B;  3UWN A;  1VQ7 A;  2DL8 A;  1KC8 R;  4M7D E;  2LNH B;  1D3B A;  1OV3 A;  4N4G A;  4PJO F;  1YN8 A;  1K9A A;  2YRV A;  3GLX A;  4K11 A;  1QVG P;  1PSF A;  2DL4 A;  4RG8 A;  3OYB A;  1KFZ A;  1IGQ A;  2YLC A;  3OW2 A;  3CCM Q;  3JB9 D;  4LN2 A;  4M78 D;  4HA8 A;  1N9S A;  1YCS B;  1M90 C;  4R56 A;  4GY5 A;  1OZ3 A;  4FT2 A;  2QA4 A;  3C0C A;  4ZGE B;  4LDX A;  1TUD A;  1P92 A;  3RNJ A;  1AOJ A;  5M9O A;  2I0N A;  3VU3 C;  4A4G A;  2RHY A;  5I2S A;  4M77 C;  1M3A A;  3CD6 Q;  2CGH A;  3G1J A;  1D1C A;  3M55 A;  1NBE B;  3L2W A;  2E6Z A;  2CYZ B;  2RK1 A;  4AMC A;  1Q81 R;  4OMN A;  3QZ5 B;  4M78 G;  2RJD A;  2D6F A;  4OB3 B;  3I55 Q;  2RQV A;  1T3L A;  5CKD A;  2VWF A;  5KH6 A;  1KJW A;  1JJ2 P;  1JB0 E;  2EVR A;  2DJZ A;  2F2X A;  1YHQ T;  3X20 B;  4JJN K;  4BE1 A;  2K2M A;  1NJI R;  5ECA A;  4D8K A;  2JTF A;  3V7R A;  2QG9 B;  1KD1 C;  4E7H A;  2X4Y A;  5HKC A;  2DX1 A;  4KRT A;  1MGQ A;  2CDT A;  2RQR A;  2MCN A;  5D6W A;  1FMK A;  3OS1 A;  3QPH A;  2HQX A;  2KRN A;  1MUZ A;  2X4W A;  1UUE A;  3S3O A;  1OU9 A;  1Y7X A;  5GAN g;  3QUI A;  3GF5 A;  1VQN T;  2XK0 A;  3I56 T;  1AWO A;  2JUF A;  3NTI A;  1UB4 A;  4OML A;  3GBQ A;  4A53 A;  3PT9 A;  3J81 E;  2NUT B;  1ZSZ A;  3RDV A;  1JJ2 S;  1X43 A;  3JCM P;  4PJO A;  1VQ4 A;  2M16 A;  5LJ3 h;  1YBY A;  3PVL A;  1W70 A;  5KYN A;  4MDX A;  3CCR A;  3IQL A;  2GF7 A;  3VUB A;  3TQ7 P;  4ZTF A;  1MV0 B;  1PG5 B;  3OW2 P;  1Z9Q A;  1O75 A;  3I5S A;  2DEQ A;  3H6Z A;  3R6N A;  2OTL A;  4A63 B;  1KQ2 A;  4R0K A;  2VV5 A;  4II1 A;  2NUP A;  3PIP A;  2OTJ T;  1SPK A;  3OA6 A;  3OYL A;  1J3T A;  2K9G A;  1GFD A;  1PRM C;  3GNF B;  4CC2 A;  4LUE A;  3HRT A;  4DBF A;  5HCK A;  2DF6 A;  3U23 A;  3FC3 A;  5GAO r;  3QDR B;  2CH4 A;  4QVD A;  3M56 A;  4C0G A;  3OYG A;  2MYS A;  3M9Q A;  2RK2 A;  2E64 A;  1BIB A;  4FSX A;  1R8O B;  4BE2 A;  2KR3 A;  3FRN A;  4ZTJ A;  2LNV A;  1NG2 A;  2J6F A;  1YIT A;  3M54 A;  3OS0 A;  3RMS A;  1Q82 U;  3QBY A;  1GCQ A;  2X9H A;  3SB2 A;  3G4S Q;  2EGC A;  3RR6 A;  2FZC B;  2KRS A;  1BI1 A;  3NTK A;  3JCM h;  4ELZ C;  3M5A A;  4EMK B;  2JW4 A;  1OZ2 A;  1N8R C;  2YDL A;  1RL2 A;  2E65 A;  2Z0W A;  3CME A;  3CCS A;  4M7D D;  3A8H B;  5GMK l;  4AFU C;  2QQS A;  1VQ6 T;  2NUT A;  4J9F A;  4M75 C;  1Y57 A;  2DXC A;  3MCA B;  3BDU A;  3RKX A;  1I8F A;  1NM7 A;  1VQO A;  3OYF A;  4J5Y A;  3TCJ A;  2L0A A;  3HHT B;  3JAM E;  2O88 A;  2HDA A;  2K4Y A;  3CC2 T;  2BTT A;  4AG2 C;  4M7D G;  3OMG A;  2ED1 A;  5LJ5 d;  1BK2 A;  2JTE A;  1SEM A;  2VXF A;  2E3H A;  4PLI A;  3H0H A;  3SHW A;  4F16 A;  1JBM A;  4PJO E;  1M8V A;  3L42 A;  3V8K A;  2HMA A;  1AWX A;  5GAO l;  2F5T X;  3JB9 J;  3A8G B;  4X9D A;  1K9M R;  4JRK A;  3JV3 A;  3I9Q A;  3OYH A;  2OAW A;  4RTT A;  1WQW A;  1E6H A;  4ZN1 A;  2JM8 A;  3CCQ A;  1H92 A;  4XU3 A;  3MP1 A;  3GPL A;  2DXT A;  2AIR B;  3RUX A;  2KYM A;  4C5G A;  3SD4 A;  3X25 B;  2O2O A;  4ME7 A;  1MMD A;  2O9S A;  4JUV A;  1Q86 U;  2JJ9 A;  2Y90 A;  1TG0 A;  3QG1 A;  2DO3 A;  3EFR A;  1ZX6 A;  1SG5 A;  1Q7Y C;  4EMK A;  2EYZ A;  2QEX T;  3PE0 A;  3CCJ T;  4J9G A;  1U1S A;  1YJW Q;  1T0J A;  3T9N A;  2DXU A;  3TSZ A;  2JTM A;  1VIE A;  3TU4 K;  2RB6 A;  2A28 A;  4KH0 B;  3FLG A;  2GTJ A;  4E7S A;  4J6X A;  1AEY A;  1PRL C;  4GLK A;  1X01 A;  4DBR A;  3ME9 A;  4J9C A;  1QMC A;  5CQY A;  1RAD B;  4ZGJ B;  3CCE A;  2EAY A;  2PVO B;  2VB6 A;  3CQT A;  3CXC P;  1U3O A;  1NE8 A;  1WXT A;  2KEA A;  4Z8A A;  2RNA A;  2EGA A;  2K5F A;  2KXC A;  3A8L B;  5GAN 2;  1K1Z A;  3ASK A;  5KYX B;  3WXM B;  1WHH A;  3EFO B;  5GJW B;  5L8R E;  4F17 A;  1VQ8 A;  2V8I A;  4B6M A;  3VV0 A;  2PZ1 A;  3GIB A;  4HXJ A;  1KC8 U;  4X1V A;  1PCX A;  1TWB A;  5GAN e;  4QQD A;  2XDP A;  5A2Q E;  2NWM A;  2QQ9 A;  1YCY A;  1G2B A;  2KAF A;  4Y28 E;  1UTI A;  2QQB A;  1W2B A;  1RAA B;  3CXC S;  2A7Y A;  3TRE A;  3OY9 A;  2V8K A;  1VQ9 T;  3CCV T;  2KDS A;  5KYU B;  4XAX B;  1VQP Q;  4PJJ A;  1FX7 A;  5KE3 A;  3H8Z A;  1GBR A;  2OI3 A;  1BKB A;  4EDU A;  2RHZ A;  3ZFJ A;  3HP9 A;  3OYJ A;  3QJ6 A;  1BCO A;  2CRE A;  1ZUU A;  3H9N A;  5IHN A;  5GAN 6;  5GAN 7;  1ZQ1 A;  4LD9 K;  2RHI A;  1YIJ Q;  2L3P A;  4E47 A;  3NPF A;  4EMH A;  4J9H A;  1VQL Q;  2LZ6 B;  2F1L A;  1KQ1 A;  4HT8 A;  1OU8 A;  3FJ5 A;  4ZNX A;  3LGL A;  1D0X A;  4NL3 A;  1QCO A;  4QQG A;  2HSP A;  1Y07 A;  4C92 B;  1VQ7 Q;  2LT1 A;  2DK3 A;  3F70 A;  5HY6 A;  4C92 F;  2XID A;  4NOY A;  4JRP A;  2DBK A;  4OB1 B;  1PD0 A;  1YNZ A;  4PJL A;  5LJ3 f;  3NGP A;  5LJ5 h;  2ZPF B;  2CSQ A;  2EYW A;  2HAX A;  5A0L A;  1WJS A;  4PJO D;  2QA4 Q;  1ABQ A;  2JMA A;  1I4K 1;  5GAM j;  2EWN A;  1G8X A;  5KYX A;  1Q82 R;  4FU6 A;  3J80 E;  2PQW A;  1Z9Z A;  4XK8 E;  2CT4 A;  1JXO A;  2XG8 D;  4OB2 B;  2RI3 A;  2FO0 A;  1G83 A;  3CCM T;  2PVG B;  3KFV A;  4V2S A;  1FYN A;  4FYY B;  5C0M A;  3EG3 A;  1K0X A;  2YT6 A;  2EQU A;  1YI2 A;  1W2B P;  3NMZ C;  2SRC A;  3L2Z A;  3QZ9 B;  4PJO G;  4X9C A;  2FL7 A;  2RF0 A;  4RTX A;  2LQK A;  2P0P A;  5FU6 C;  4M4Z A;  4C8Q C;  5KYU A;  4ESR A;  2E5K A;  1JXM A;  3EAE A;  3CD6 T;  1RI0 A;  1LOJ A;  3M0R A;  4MDW A;  2XU8 A;  3R6O A;  2W10 A;  3I55 T;  2IPO B;  3N5B B;  3HPW A;  2Y4X A;  2ENM A;  1WLP B;  3OYA A;  2LVM A;  2X3X D;  3CC7 A;  1LNX A;  4NL2 A;  1YJ9 T;  4OMM A;  3L2U A;  1D09 B;  1NLP C;  3M57 A;  4J6W A;  2KT1 A;  4JZ4 A;  2FRW A;  4Y91 A;  1W2B S;  3I56 A;  2M02 A;  1VQ4 Q;  4XTW A;  1VA7 A;  3C94 A;  5EC7 A;  3OQ5 A;  1JRI A;  1AD5 A;  2KE9 A;  4QVZ A;  3CCR Q;  1T3S A;  1BB9 A;  2J7I A;  2DJQ A;  3LYI A;  2VC8 A;  6AT1 B;  3EH2 A;  1MHN A;  1YP5 A;  2JVV A;  2HD0 A;  4IUU A;  2KRO A;  2OTL Q;  3CCL T;  1Y0M A;  2OAU A;  4C0F A;  4WTO B;  3MKD A;  4KUL A;  3M0T A;  3SDZ A;  4PK4 A;  1N8R R;  1WI7 A;  3HSB A;  2OTJ A;  3EGU A;  3SWN C;  4L5G A;  1YFN A;  1Q86 R;  2V1Q A;  2BE9 B;  1TOV A;  2EJF A;  2YUQ A;  4HCZ A;  2LQ8 A;  4JPB W;  4E7Z A;  2XHC A;  4O5V A;  2CP3 A;  2LTO A;  2DL5 A;  2FYK A;  2KI7 A;  4LUD A;  2EQM A;  3OSS C;  3M53 A;  2FVU A;  5GAO p;  3NTH A;  1EZZ B;  1KHI A;  1M1G A;  5CK9 A;  1F1B B;  1OPK A;  2HBW A;  1JJ2 A;  3EFS A;  3JCM X;  1VOM A;  1YIT Q;  1OX8 A;  5CIU A;  4RMO A;  1I5L A;  4OGC A;  1M1K U;  1D1B A;  2DL7 A;  2YXY A;  4BI3 A;  2G6F X;  1LCK A;  3FIF A;  4RTU A;  7AT1 B;  2W0Z A;  1M2V B;  1S72 T;  1IRX A;  3CME Q;  3CCS Q;  4BE0 A;  3J7A F;  3O5Z A;  1NZ9 A;  4HVV A;  3G4S T;  1SHG A;  3VS6 A;  1XQH A;  1ZUK A;  1LPL A;  2EYX A;  3H41 A;  1BU1 A;  4J6Y A;  1VQ6 A;  5I11 A;  2QAS A;  1VQO Q;  2YLB A;  2DRK A;  1RAB B;  2KXD A;  2M1H A;  2FZG B;  5D6X A;  5GMK h;  1FWZ A;  1N6A A;  3FB9 A;  2OX7 A;  2QQR A;  5CKB A;  2YHT A;  3M0P A;  3A8M B;  1WIE A;  4JJD A;  2A0F B;  5GAN 4;  3QSU A;  4A4H A;  3CC2 A;  4XU1 A;  3LLR A;  5C6S A;  3H0F A;  2NUP B;  4MZM A;  3GOX A;  1KG1 A;  3FEO A;  3RBB B;  3JCM g;  2COY A;  1DJ7 B;  2LC4 A;  4BUG A;  1FXX A;  4C92 E;  5GAM g;  3G71 A;  2IIM A;  4JJB A;  2VVK A;  3CC4 A;  1TS9 A;  4PFZ A;  1TUC A;  3ULR B;  3UA7 A;  4Z88 A;  4MMK A;  2FPE A;  3QII A;  1U8R A;  3CCQ Q;  4HCK A;  4X34 A;  2HL3 A;  2V1R A;  2EIF A;  2RJF A;  2FEI A;  3A8O B;  1OPL A;  1WFW A;  2CP2 A;  1K8A C;  4M77 B;  5GAN d;  2K57 A;  3X28 B;  4PJM A;  4AFQ C;  4M77 F;  5J3B A;  4PKC C;  1GCP A;  4M7A B;  1M2V A;  1UHF A;  1VQK A;  2CP0 A;  2OJ2 A;  3FJP A;  4M7A F;  1WHK A;  3UPU A;  1A0N B;  3M0S A;  4IKF A;  2DTH A;  3UAT A;  1RUW A;  2ABL A;  2E6N A;  2DFU A;  2ECZ A;  4KUI A;  1CKB A;  2VKN A;  1M90 U;  3CCE Q;  1VQ5 A;  1FMW A;  3SFM A;  4EMG A;  1SSF A;  3VRY A;  1YJW T;  4HCB A;  1M9S A;  4RKU E;  1MNE A;  3MPU B;  1JQQ A;  2DPP B;  1X6G A;  2ZPI B;  2FPF A;  2QDL A;  1JU5 C;  5LJ5 f;  1R0B G;  1VQ8 Q;  1C1A A;  2O01 E;  4O6J A;  2XD0 A;  3MEU A;  1I0C A;  2LJ1 A;  3QXE B;  2RQU A;  5CKH A;  4XU2 A;  5LL6 S;  3WVE B;  1Y71 A;  5KE2 A;  3G7Z A;  4A4K A; 
#chains in the Genus database with same CATH homology
 2A28 A;  1YWP A;  1XOV A;  1SSH A;  2JS0 A;  2GTJ A;  2M0Y A;  2JT4 A;  2PNI A;  2K3B A;  1PRL C;  2ROL A;  1AEY A;  2JMC A;  2K7A A;  3NHN A;  4J9C A;  1QWF A;  2BZX A;  3ZL7 C;  4HVU A;  2CH4 W;  4RTW A;  1I07 A;  1IO6 A;  1K76 A;  3CQT A;  4LNP A;  1U3O A;  1WXB A;  1WXT A;  4J9E A;  2KEA A;  4Z8A A;  2A36 A;  2RNA A;  2EGA A;  2KXC A;  2EQI A;  3VS7 A;  1K0S A;  3M0U A;  1K1Z A;  2DVJ A;  2GTO A;  2O31 A;  4IIO A;  1EFN A;  2C0O A;  5GJW B;  4F17 A;  3VS2 A;  2PZ1 A;  4HXJ A;  2LMJ A;  2J6K A;  4X1V A;  2LQW A;  1B07 A;  1S1N A;  1M27 C;  2LQN A;  2H8H A;  2AZV A;  2NWM A;  1G2B A;  1WX6 A;  1PKT A;  1UTI A;  4AFZ C;  1NEB A;  1GCQ C;  2F2V A;  2KT8 A;  5IXF A;  1AZE A;  2CT3 A;  1BBZ A;  2RQW A;  1T0H A;  1GBR A;  2OI3 A;  3REA B;  4RTZ A;  2LX7 A;  2RN8 A;  2CRE A;  4EIK A;  1ZUU A;  5IHN A;  4J9D A;  1M3C A;  1ABO A;  2FG0 A;  1M8M A;  1OEB A;  1KIK A;  3I35 A;  2L3P A;  2DL3 A;  3NPF A;  2J6O A;  4J9H A;  1OOT A;  2LZ6 B;  4OMO A;  1GFC A;  1QKX A;  4CC4 B;  1QCF A;  3FJ5 A;  4ZNX A;  2KYB A;  1QLY A;  4Z89 A;  1X69 A;  2HSP A;  5I22 A;  4QT7 A;  1WDX A;  4AG1 C;  2DRM A;  1H3H A;  2K6D A;  4Y92 A;  2AZS A;  3I5R A;  1U06 A;  2DBK A;  1PHT A;  1VYV A;  2PTK A;  2AKK A;  4WCI A;  1YNZ A;  5IXB A;  4JZ3 A;  4D8D A;  3NGP A;  4AFS C;  2YUO A;  2DA9 A;  1RLP C;  2CSQ A;  1V1C A;  2MIO A;  2EYW A;  3EG1 A;  4CC7 A;  1UEC A;  2AKL A;  1ABQ A;  1QKW A;  2JMA A;  1B3Q A;  1UFF A;  2XMF A;  2EPD A;  1Z9Z A;  4J9I A;  2CT4 A;  2DMO A;  1JXO A;  1H8K A;  2FO0 A;  2KRM A;  1G83 A;  2BZY A;  3EHR A;  1PKS A;  1X27 A;  2LCS A;  3KFV A;  2JXB A;  2GGR A;  1FYN A;  3SEM A;  3EG3 A;  1M30 A;  1ZLM A;  1NEG A;  1NLO C;  4DEY A;  2YT6 A;  1K0X A;  2CUD A;  3NMZ C;  2SRC A;  2L3S A;  1N5Z A;  2RF0 A;  1HD3 A;  3EG2 A;  4ORZ A;  4RTX A;  4M4Z A;  3VS1 A;  2DIL A;  4ESR A;  2E5K A;  2DL8 A;  1JXM A;  4FSS A;  2LNH B;  1OV3 A;  1X2Q A;  1YN8 A;  1K9A A;  2MOX A;  4K11 A;  3M0R A;  2DL4 A;  1KFZ A;  4LN2 A;  2W10 A;  1E7O A;  1YCS B;  4CC3 A;  2ENM A;  1WLP B;  3C0C A;  1TUD A;  2ESW A;  1UE9 A;  2RQT A;  2X3X D;  3LH5 A;  2LJ3 A;  3RNJ A;  1AOJ A;  4OMM A;  2I0N A;  4GBQ A;  2KNB B;  1NLP C;  1GBQ A;  2KT1 A;  4JZ4 A;  2FRW A;  1M3A A;  1ZBJ A;  1M3B A;  4RTY A;  2CSI A;  1VA7 A;  2GNC A;  1AVZ C;  5EC7 A;  2X3W D;  3VS5 A;  1AD5 A;  2KE9 A;  2KGT A;  1T3S A;  4OMN A;  1BB9 A;  2J7I A;  2ROT A;  2DJQ A;  1T3L A;  2D8H A;  1AWJ A;  2RQV A;  2VWF A;  1KJW A;  2EVR A;  2F2X A;  1UHC A;  3EHQ A;  2FRY A;  1YP5 A;  4DEX A;  2JM9 A;  2KRO A;  2K2M A;  1Y0M A;  5ECA A;  4D8K A;  2RPN A;  3M0T A;  3REB B;  1WI7 A;  1GRI A;  3EGU A;  2DX1 A;  4KRT A;  2LJ0 A;  3A98 A;  2CDT A;  2RQR A;  2MCN A;  1FMK A;  2V1Q A;  2YUQ A;  2BZ8 A;  2KRN A;  1MUZ A;  1UUE A;  4JPB W;  3UF4 A;  1CSK A;  2DL5 A;  5FW9 A;  1AWO A;  4LUD A;  1ARK A;  4OML A;  3GBQ A;  4IIM A;  1X43 A;  1OPK A;  2HBW A;  4OMQ A;  2D1X A;  2YSQ A;  2ED0 A;  3QWY A;  3PVL A;  1W70 A;  2D8J A;  2EKH A;  1KSW A;  2DL7 A;  3IQL A;  1W6X A;  2G6F X;  2J05 A;  1LCK A;  1RI9 A;  4RTU A;  1MV0 B;  1Z9Q A;  2D0N A;  3VS4 A;  3I5S A;  1UG1 A;  3R6N A;  2W0Z A;  4A63 B;  1X6B A;  4R0K A;  1WXU A;  2P4R A;  3TSW A;  1SPK A;  1J3T A;  1GL5 A;  1UDL A;  2K9G A;  1GFD A;  1PRM C;  3O5Z A;  4CC2 A;  4HVV A;  4LUE A;  1U5S A;  3VS0 A;  1NYF A;  1UGV A;  1SHG A;  2C0I A;  2L2P A;  5FWC A;  2B86 A;  3VS6 A;  1ZUK A;  2EYX A;  3H41 A;  5HCK A;  1BU1 A;  2DF6 A;  1ZSG A;  3U23 A;  5I11 A;  2CH4 A;  4OMP A;  2GBQ A;  3M0Q A;  1VYU A;  2DRK A;  2KXD A;  1UJY A;  2A08 A;  3QWX X;  2KR3 A;  3M0P A;  1SHF A;  1NG2 A;  2J6F A;  1WIE A;  4LE9 A;  4J9B A;  4JJD A;  4RTV A;  1GCQ A;  1MV3 A;  1W1F A;  5GJV B;  2EGC A;  3H0F A;  3RBB B;  2KRS A;  3EG0 A;  2J06 A;  2HCK A;  2JW4 A;  1K4U S;  2YUP A;  2YDL A;  2IIM A;  4JJB A;  2DE0 X;  2VVK A;  1I1J A;  1HJD A;  1TUC A;  3ULR B;  1CKA A;  3UA7 A;  2DBM A;  1HSQ A;  5IH2 A;  1X2K A;  2FPD A;  4Z88 A;  4HVW A;  1VYT A;  3THK A;  1PNJ A;  2FPE A;  4AFU C;  1UJ0 A;  2DYB A;  4J9F A;  4HCK A;  2M51 A;  1Y57 A;  2V1R A;  2FEI A;  1JO8 A;  1OPL A;  2SEM A;  1NM7 A;  2DNU A;  1WFW A;  1JEG A;  1QWE A;  1SRL A;  2L0A A;  2F2W A;  2AK5 A;  2GQI A;  2O9V A;  2LP5 A;  4AFQ C;  1YWO A;  2O88 A;  2HDA A;  1GCP A;  2BTT A;  4AG2 C;  4GLM A;  1UHF A;  2ED1 A;  1BK2 A;  2L3Q A;  2OJ2 A;  4F14 A;  2A37 A;  2JTE A;  1SEM A;  1AWW A;  1A0N B;  3H0H A;  1RLQ C;  3SHW A;  3M0S A;  4F16 A;  3UA6 A;  2HEQ A;  3UAT A;  1RUW A;  2ABL A;  1SRM A;  1AWX A;  2ECZ A;  4RUG A;  2JS2 A;  2DLP A;  1AZG B;  1CKB A;  2VKN A;  3JV3 A;  1ZUY A;  3VRY A;  3I9Q A;  2EYY A;  3PVQ A;  2OAW A;  4RTT A;  2EBP A;  2EW3 A;  2K79 A;  1E6H A;  5IHK A;  1WA7 A;  2JM8 A;  1H92 A;  4E6R A;  1JQQ A;  3TVT A;  2KBT A;  3VRZ A;  3VS3 A;  1X6G A;  4JJC A;  5L23 A;  1WYX A;  2KYM A;  2FPF A;  2O2O A;  2O9S A;  2QDL A;  1JU5 C;  1TG0 A;  5IHI A;  2CUB A;  5FWB A;  1PWT A;  1ZX6 A;  2EYZ A;  3PE0 A;  1I0C A;  2EGE A;  4J9G A;  2YUN A;  2LJ1 A;  2DM1 A;  2RQU A;  2NUZ A;  1T0J A;  2C0T A;  2RMO A;  3H0I A;  3TSZ A;  1E6G A;  1NYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...