1GXIE

Psae subunit of the photosystem i of the cyanobacterium synechocystis sp. pcc 6803
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
b'ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I REACTION CENTER SUBUNIT IV
publication title Solution NMR Structure and Backbone Dynamics of the Psae Subunit of Photosyetm I from Synechocystis Sp. Pcc 6803
pubmed doi rcsb
molecule tags Photosynthesis
total genus 10
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1gxiE00
2ZZDA 1PSEA 3X25B 3QZ5B 2CZ1B 2ZPHB 2O01E 3A8MB 3WVEB 2CZ0B 2CYZB 1DJ7B 4L6V5 2WSCE 1IREB 4RKUE 1GXIE 3QYHB 3VYGA 2D0QB 4XK8E 2QDYB 3QXEB 2PUOB 3A8HB 4ZGEB 1UGQB 2DD5A 3A8OB 4ZGJB 2ZPIB 2WSEE 3LW5E 4Y28E 3X24B 1UGPB 1PSFA 4FM4B 1JB0E 2PUKB 3WVDB 3A8GB 2AHJB 2DPPB 3X26B 2DXCA 2CZ7B 2CZ6B 2DXBA 1UGRB 3QYGB 1QP2A 2ZPFB 2PVOB 2PVDB 3HHTB 3VYHB 2ZPBB 3X20B 3A8LB 3QZ9B 4OB3B 1QP3A 2DD4A 4OB2B 5L8RE 2PU9B 4OB0B 1AHJB 3X28B 2ZPEB 2PVGB 2WSFE 2ZPGB 1UGSB 1V29B 4ZGDB 4OB1B 4KT0E 2ZCFB
chains in the Genus database with same CATH superfamily
1BIAA 2P84A 4PJNA 1NLOC 1M1GA 1OU9A 1M1KC 2CZ1B 2RJFA 3OYFA 2H3JA 2K2VA 2ABLA 2PNIA 1Y96A 1VQ6A 1ACMB 1IHVA 2YUQA 5GMKm 1FMVA 4M7AF 1WHGA 4J9DA 1YJ9A 3HTRA 3BE3A 1BK2A 1WFWA 1SHFA 1C6VX 2LCLA 1VQ5A 4YTLA 1NEGA 3L2VA 2DE0X 1YHQA 1N9RA 3LH0A 2YLCA 2YLBA 1R8OB 4Y92A 1BI1A 1QVFP 3E2UA 2LZ6B 1IB8A 3TCJA 4PJOD 4J6XA 2V8JA 2J6FA 1NE8A 1RL2A 2DEUA 1X01A 2DPPB 3X26B 1UB4A 3HRTA 2L89A 3CCVT 1BCOA 3M5AA 3R6OA 3MCAB 5AT1B 1YJNT 4MMKA 4C5HA 2ZPFB 3TSWA 2PVOB 1GRIA 3EG1A 1M3CA 3OMCA 3RDVA 4M78C 3OYBA 3RNJA 5HY6A 2RK2A 2VUBA 4J7IA 1RUWA 4C0DB 4FYVB 3OYAA 1ABQA 3GF5A 3KXTA 2JTFA 4QQGA 3RIRA 3UA6A 5GANh 4PKCC 3DLMA 8ATCB 3EGDA 3Q1JA 2LQKA 4M77G 2JXBA 3OYKA 2QTXA 4M7DB 4BUGA 1MMAA 2QTVA 4Z88A 4XU0A 5IHKA 4EMKB 2R5AA 4FYXB 2LJ0A 4PJOB 4JJDA 2LRQA 3LH5A 2J7IA 4AFSC 4C8QG 2MOXA 5GAOn 4RTVA 1M2VA 4IUUA 4N4IA 3CCST 1M30A 3CBPA 2YDLA 2AIRB 2VKNA 3FDRA 2CYZB 2E5QA 2GGRA 3CC2Q 1Q86U 3EG0A 4CC4B 2J06A 4LD9K 2ZAEA 4M78F 1AZEA 4X9CA 1BIBA 4K11A 4LDVA 1PG5B 3VUZA 2VASA 3QBYA 4PL6A 2LT4A 1D1CA 1R77A 3JB9G 2DIQA 2D8HA 5A0GA 3I35A 2HZYA 4E7IA 3EHQA 5M9OA 2KXCA 2NLUA 4J9HA 4N4HA 1NM7A 4C0GA 2EKHA 3FB9A 3MHXA 2HDAA 4FW1A 3CMET 3CC7Q 2DJQA 4J9BA 1K9AA 2FRWA 1Q82R 4MZMA 2ATCB 3OS2A 1BBZA 2CZ7B 1JO8A 1Y96B 4O6JA 2QDLA 1W1FA 1YBYA 2R5MA 1BKBA 1K73C 1B3QA 2C0OA 1G3YA 2I0NA 3M59A 2DJZA 4RTWA 2CKKA 5LJ5d 5GAMd 1QCNA 2AZSA 1TSFA 1ZSZC 1WHKA 4C92F 1KC8U 4J9CA 2XMFA 4M75E 1HSQA 3V8JA 1QWEA 4MDXA 2JNGA 3CCJT 2NYSA 3SHWA 1Q7YR 4LNPA 1ZBXA 1Y57A 2L3SA 2NUPB 3CCMQ 1M90U 3QZ5B 2PZ1A 1PWTA 3CC2A 1QCFA 3A8MB 2RN8A 2BZYA 1JXOA 5J3BA 1QCOA 4DBRA 4N0AA 2JW4A 1SSHA 2K3BA 3E1SA 1RI9A 4C92D 3EG9A 4XU2A 4HT8A 1WXUA 4C0ZA 4XK8E 1JJ2A 1KHIA 1FWZA 1WIEA 4J6YA 1OX8A 1IXDA 1K9MR 2YUNA 3EGDB 3A8HB 1M9SA 5DLOA 1WJQA 3MEUA 2DAQA 2M1HA 1HXDA 2L3RA 1W2BA 2DL3A 2RM4A 2LT1A 2VWFA 2FG0A 2XIDA 4F17A 3CC7A 2EJGA 1ZSGA 2M02A 1K8AC 1K0XA 3FJ5A 1YI2A 3QPHA 5EG2A 1T3SA 1CSKA 1M2VB 1WA7A 1JU5C 2KROA 5IHNA 2JT4A 2IVWA 1UGRB 3EFRA 2M51A 4O5VA 1CKAA 2EVRA 3HHTB 5KYXA 1JJ2S 5A0LA 3OYHA 2DRMA 3ZFJA 5FU6C 4OMOA 2VXFA 1VQ8T 4EPCA 2QQSA 3OY9A 5A0DA 1W2BS 2FPEA 2OI3A 1QWFA 4BI3A 3M0RA 1NZ9A 1S72Q 1AHJB 4HT9A 4F7UF 5GAN2 3CCMA 1T3LA 3TVTA 1VQ6T 3JCMd 1MMGA 3CMEQ 2ZZDA 1PSEA 5FWCA 3NHNA 5LJ5e 5GAMe 3J7AF 1UJ0A 4M7DE 4RTUA 1X75C 3I55Q 3S3NA 1ZQ1A 3CPWA 3ZL7C 3C94A 1VQ5T 5GAN7 4PJOE 2QGFB 2L3PA 2DIGA 1Z9QA 2GF7A 1YHQT 1KD1C 2KDSA 3EGXA 1G3TA 3VS3A 4AMCA 4JRKA 3FEOA 2CP6A 4RG8A 2AT1B 4LUEA 3JB9J 2LX7A 2LX9A 1UGQB 3JCMP 1UJYA 5GAOq 1ZX6A 1EFNA 4C5EA 5CCAA 3HKSA 4NL2A 1PSFA 3MEWA 2HQXA 1TS9A 4VUBA 4RMOA 1JBMA 2RO0A 5LJ5f 3CPWS 4DBFA 5GAMf 2CT3A 2DLPA 2EQKA 3LWHA 3RKYA 1RACB 4XTZA 3OBWA 2GTOA 1N8RR 4F16A 3H41A 2A37A 3L2ZA 4M77A 3CXCA 3JCMV 3RERA 2XKOC 2KXDA 2MK5A 5IXBA 2EFIA 3ER0A 5D6XA 1TXQA 1UHCA 3EG3A 3EG9B 4M75C 3VYHB 2XK0A 2FEIA 2YUPA 2FZGB 2GQIA 4C8QA 3RMQA 1QP3A 3HRUA 1WXBA 1S72A 2E3HA 1I81A 2K6DA 4X34A 4C92G 1LOJA 1Y7XA 4J9GA 4HKEA 2X4XA 4OGEA 1OQKA 2EYXA 1AZGB 3LGFA 1GFCA 1UUEA 1HYOA 3CMEA 1NEBA 1QMCA 2QASA 2RQUA 2DERA 4OB1B 4XTYA 1TUCA 4KRTA 2JUFA 1T0HA 3L2QA 1UE9A 5GAOl 1UEBA 3SEMA 3I55A 4E7KA 3HSBA 1SRLA 2BUDA 4PLIA 4J9EA 3CXCS 1AD5A 3G7ZA 4QT7A 4Y91A 5FWBA 4FYYB 2CZ0B 3ULRB 5CIUA 2X35A 1TOVA 2L3QA 5GANd 1ZUKA 4CRIA 5KYXB 1PRMC 1BI0A 1Q82U 4Z02A 2A0FB 2K7AA 4M75F 3V7RA 2O9SA 5GAN3 2YRVA 4LE9A 2KVQG 3JCMe 1VQ8Q 4FSSA 3NGPA 1VQ4Q 4AFQC 1QKXA 2E5KA 1RAFB 4LD6A 1H92A 5GAN6 2EYYA 4R55A 2A08A 2QI2A 2DTIA 3JRZA 2X4JA 4HCZA 3UATA 1V76A 3NTKA 4V2SA 2CS7A 1KC8R 3HL8A 2KQWA 3U23A 3WVDB 3GP8A 2DZCA 1KQ1A 1YWPA 2WACA 5KYNA 1HJDA 2CSIA 2O4XA 1WHLA 1OPKA 1D09B 2FHDA 2BE9B 1N5ZA 4A4HA 1M90R 5HK0A 2D8JA 1OU8A 1Q7YU 2XICA 2EJ9A 1I5OB 1OZ2A 1U1TA 4EMKA 4C0DC 1MNDA 1TU0B 4ZNXA 4JJNK 3QSUA 1H3ZA 3JCMf 1K0SA 3L2UA 5KE2A 4JJCA 4LDWA 2XHCA 2DA9A 1YITT 3M53A 2SRCA 3PMTA 2DRKA 2YSQA 4F7UG 3SWNB 4M7DC 3CC2T 1KK7A 2D9TA 1PRLC 1NYFA 3FLGA 2X51A 4DBHA 1WLPB 2JZ2A 3A5ZB 4PJOC 5GJWB 1PCXA 2VVKA 3SDZA 1NJIR 2DMOA 3FC3A 4OVAA 2DYIA 3M4YA 1P92A 2COZA 1AT1B 2KAFA 5CQYA 4M77B 2ECZA 3CCLQ 3DB3A 3UWNA 1VYTA 1D1AA 1D0XA 1M8VA 4J83A 1YCSB 2X4YA 3QJYA 4IUQA 1VQ8A 1GBRA 1VQ4A 2DL5A 4JLIA 3LWIA 1WPYA 2E65A 2LDMA 3CC7T 4OF1A 1XJWB 3CMAQ 1GCQC 5DLQE 1QVGA 1YI2T 2FPDA 3REAB 1QW1A 4ZGJB 4JZ4A 2HBPA 2HL3A 4OMMA 3NTHA 5GANe 1SPKA 5CR2A 1X43A 2LNVA 1WJSA 2Y4XA 2DO3A 4B9XA 2QXFA 2XDPA 3RESA 2RJEA 5ECAA 3X20B 2E12A 2DK3A 2RH2A 3VS6A 2J6OA 1KG1A 4DOVA 3CCMT 1QVGS 2NUPA 1KJWA 4PJLA 2O31A 3OYEA 4M7AD 4BE1A 4JPBW 5LJ3j 4PFPA 2PVGB 4ANJA 4PNOA 1RAIB 4GBQA 1OEBA 5GANf 4GLMA 4BY6B 5FRMA 2DF6A 2LNHB 1TH7A 2ZCFB 1M2OA 2X3XD 3HFNA 2C0IA 2O4XB 3CCLA 2EPDA 2YXYA 2O88A 5IAYA 2KRSA 1K73U 2L5QA 2MIOA 3CCQQ 3V7SA 1VQNQ 3G6ET 4P5NA 4L6V5 2M16A 2JMCA 4RTTA 1UTIA 2FB7A 1N8RU 3CMAA 2K5LA 2OX7A 2EWNA 2VXEA 4E47A 3CC4T 5L23A 2GQVA 5C6SA 1Q81C 4JRIA 2VYTA 4BACA 3QXEB 2NUTA 3M0QA 3MO8A 1YITQ 1VQMA 2F69A 1IO6A 4AG1C 1UG1A 2BE7D 1WQ7A 5LJ3g 3X24B 2G6FX 3MJXA 3V8KA 1NYGA 4QKUA 3LGLA 5FLXE 2RMOA 2ED1A 5KYUB 3A8GB 4C5GA 3OW2A 4BI4A 4C92A 5IXFA 4EDUA 1I07A 1N6AA 2EJFA 2HSEB 3CEYA 3OYYA 2K2MA 4CC2A 1S72T 4RCCA 5FU7B 2CUDA 2OTJT 1LJOA 2EW3A 3I5RA 3MKDA 4R56A 4LDUA 3S6WA 3CQTA 4CC3A 2E41A 1WHHA 1U5SA 1C1AA 5LL6S 2B8AA 2MWPA 5I22A 4J5YA 2JVVA 1YI2Q 2PTKA 3G4ST 1K1ZA 3I55T 2A3LA 1T0JA 3QWYA 1Z9ZA 1OZ3A 4M78D 2ZPGB 2E10A 3OW2S 5GAN8 2KRNA 2E64A 2EGAA 1S1NA 1K4US 3CCQA 2RJDA 1VQNA 4KH1B 1ZLMA 3N5BB 2KBTA 4C0FA 4EMHA 2COYA 4LDYA 1M1KR 1VQLT 3AHUA 3JV3A 4HCKA 4OP0A 2LQWA 3VUBA 1X2KA 2P0KA 1TTHB 4FT4A 1EZZB 5GMKi 3E9GA 2KR3A 3M4GA 1JXMA 1YITA 4BDYA 2P0PA 4FIBA 4C5IA 4M77E 1AWJA 3DB4A 1BU1A 4FCYA 1YWOA 2GBQA 3CCRT 4DA4A 2PUOB 4E7ZA 4ZGEB 4PLLA 4A4FA 3RBBB 3JCMb 1I1JA 4C8QE 1YNZA 4M7AG 4M78B 1Q86C 1XTDA 2EQJA 3CPFA 2M0OA 3C95A 3PTAA 1O9SA 2YWWA 9ATCB 3I56T 1VA7A 1M8MA 1KFZA 2AHJB 3F70A 2RHZA 3T9NA 2H3EB 2E6ZA 1ARKA 3HP9A 4D8DA 1FYNA 5CKHA 2PQWA 1TWBA 1EX4A 2DXBA 2JN0A 2W10A 4RUGA 2VB6A 4DOWA 2IIMA 4F7UA 5GAN4 4N0AC 2JTMA 3G6EQ 4F14A 1NJIU 1KD1U 3LLRA 2QQBA 2IPOB 1TG0A 2ZPBB 1W2BP 1KIKA 3LX7A 3QZ9B 3CC4Q 3PNWC 1SEMA 4RTXA 2VV5A 2EGCA 2NUTB 2X3WD 2DX1A 3H9NA 5GMKl 2E70A 2ROTA 5HKCA 1VQPT 2A7YA 3M0PA 3J80E 4MZPA 4LUDA 4PFOA 2DXUA 4D8KA 4ESRA 1IRXA 4BD3A 4EMGA 4MZTA 4QVDA 2XG8D 4C92B 1WDXA 5GMKj 1D0YA 4B6MA 1VQ4T 5KH6A 2LJ1A 4XTUA 1R0BG 5J39A 4XTWA 3M58A 2K5FA 2OAWA 2MMPA 3JAME 2OTJQ 1WHJA 1B7TA 1BB9A 2QQRA 4PFZA 2Z0WA 4R0KA 1GFDA 2RF0A 1ZHIA 4OMQA 1VQOT 3UA7A 3L1AA 4HVWA 1I8FA 2CGHA 1IGUA 4HCBA 3OQ5A 2LTOA 3VS0A 3G4SQ 5I11A 4OMNA 3MPUB 2XD0A 3OA6A 2EBPA 4Z89A 2DZ9A 2ROLA 5CO7A 2QEXQ 3CCET 1X2QA 4JRPA 2JM9A 1SSFA 3CPWP 2PUKB 4MDWA 3VS7A 3JB9I 4M78G 1IGQA 1M1FA 2KI7A 3G6EA 1RAGB 3I5SA 2CZ6B 2F5TX 1VQLQ 2HKQB 2QA4Q 5IN1A 4A4GA 4FL6A 3CC4A 6AT1B 3SWNA 5C0MA 3QO3A 1MMNA 2CSQA 1K73R 3CD6T 3V7CA 2AKKA 1AWWA 3C4SA 4Z8AA 3CCRQ 3E19A 3O5ZA 1E7OA 3MEVA 4FYWB 2CP3A 1KQSA 3GNGA 2L8DA 4A4EA 3TREA 3CCLT 3C0CA 1WNLA 3SWNC 3BDLA 3KFVA 1UGSB 2V8KA 4N4GA 3EAEA 5KCOA 4ELZC 3CXCP 5CQXA 2YUOA 4XAXB 5LJ3h 3I56Q 2LCCA 1TUDA 1SF9A 4OMFB 3QDFA 3H8ZA 3CMAT 3MP8A 2O01E 2YHTA 2K57A 2OTJA 1OULA 2QG9B 4M77C 2JS0A 3VU3C 4F7UB 4RCBA 3HFOA 2DL8A 1W70A 1PD0A 1GBQA 2FO0A 1VQMT 1OI1A 3P8HA 5KYYA 2LQ8A 1NPPA 4C8QC 4ZTJA 2DILA 3G4SA 1RAHB 2P0QA 1JRIA 2RHYA 1KQSS 3SFMA 2OTLT 4XTXA 2CP2A 2QEXA 3OYNA 1VYVA 5FW9A 3VJPA 1VQPQ 1A0NB 1RADB 2E4HA 2GCXA 2BIVA 3SB2A 4DBQA 2L2PA 3URGA 2KSSA 1VIEA 3H0HA 2VC8A 4X1VA 1H8KA 4E7LA 4QQ6A 5HCKA 1RAEB 1K76A 3RMSA 4WTOB 3VV0A 2CP5A 1VQLA 3QKJA 2QA4A 3PGGA 4J7FA 2LQNA 4A53A 1LNXA 2HD0A 2COWA 3EHRA 5I2SA 4FU6A 1D1BA 3CBOA 2F2WA 5EC7A 3CCRA 1VQOQ 1M1KU 4C8QF 2E3IA 2AKLA 3FRNA 2GFAA 2H8HA 1BYMA 3S3MA 3NMZC 2F2XA 3CCQT 1VQNT 4M75D 1VQ9T 2KT1A 3CCEQ 3I56A 2Y4YA 2KMTA 4BY6C 2DNUA 2DEQA 1B07A 2GFUA 1YIJT 1HD3A 3PFSA 1YCYA 2B86A 3WVEB 1UECA 1U3OA 5AYFA 2LCSA 4M7AA 1DJ7B 2KY9A 4C92E 2WSCE 2G3RA 4EMKC 2IG0A 1FMKA 4TVRA 3VS4A 1GXIE 3QYHB 2MAMA 4WF2A 1AEYA 4M4ZA 3CD6Q 2JJ9A 3GNFB 4J9FA 1LPLA 2RNAA 5KYUA 1KD1R 1VQPA 2XDBA 1M27C 1VIFA 2RQVA 3EGUA 2AZVA 2DD5A 1X6GA 2ZPIB 2MWOA 2KNBB 1ZUYA 5CKBA 2RI2A 4M75B 1ZUUA 1HK9A 1Q82C 1OV3A 1WI7A 3JB9H 2RQRA 2FPFA 1AOJA 1NLPC 3QIIA 2FRYA 3A1PA 4OGCA 2DM1A 1MUZA 2F1LA 3META 3GIBA 1D0ZA 1WZOA 5D7UA 2HKNA 1VQOA 1IHWA 1QVGP 4M7DF 4JDSA 1VQMQ 4ZN1A 5KYYB 5KE3A 1Q81U 1VQ7Q 3A8LB 2HNIA 4A4KA 3G1JA 1G83A 2MF2A 4PJOF 3OSSC 3H0IA 4IURA 2EGEA 3S3OA 2OTLQ 2K3XA 1MGQA 4IUPA 5KYWB 4XU3A 4E7SA 3CCEA 4E2FB 5DY9A 2M0YA 1VQKT 4AT1B 3M55A 1Q7YC 2RHUA 2QK0A 2Y90A 3OYDA 4JUVA 3RR6A 2JM8A 3KBGA 3OS1A 3X25B 7AT1B 3PT9A 4B9WA 2K4YA 1H641 1WQWA 1QVFA 3HRSA 4GLKA 4M7DD 3ASKA 5FROA 1IZ6A 1QKWA 5GMKh 2W0ZA 4RG2A 3TU4K 3CD6A 2XI9A 4D6WA 3PE0A 4RKUE 4M78A 4IUVA 2EQUA 1K9MC 4II1A 3PVLA 1FMWA 1I0CA 2QYZA 5CKDA 5LJ5j 4F7UE 3HPWA 5GAMj 4E6RA 2FYKA 4NOYA 3EFOA 2HMAA 1WGSA 3OYMA 4HA8A 1Q95G 2WSEE 3JCMX 1VQ9Q 4KBMB 1C0MA 3QWXX 1QQJA 1AWXA 4FM4B 1GL5A 1M4ZA 3OBYA 4M75G 3L2WA 3DKMA 4LN2A 1UDLA 1QVFS 3PIPA 2DVEA 5GAOp 2RB6A 1YIJQ 2NWMA 2RA2A 2CP7A 3TSZA 1JQQA 1M5Q1 1QP2A 3TEEA 4KH0B 4FW2A 1VQ7A 1U8RA 4M7AB 3ZEHA 2PVDB 2GNCA 1WYXA 1RABB 5IHIA 1QVPA 2HCKA 2OTLA 1PNJA 1JEGA 1CKBA 3R6NA 2DETA 4J6WA 1X6OA 4J8OA 5GAN5 2LC4A 5LJ5g 3IQLA 1G3WA 5GAMg 4F04B 1PM3A 2JS2A 2MCNA 4ATOA 3OW2P 2DL7A 2D6FA 2EQIA 4PK4A 1NPRA 3DLLA 3M0UA 3G71Q 1H3HA 1X27A 3GBQA 5KCHA 3CBMA 4C92C 2OJ2A 1BI2A 1F1BB 4JRQA 1QLYA 2KYBA 1D3BB 5D6WA 4PJJA 4BE2A 3UPUA 2QEXT 2EIFA 4AFUC 1X69A 3INZA 1G3SA 4DQ2A 3QHSA 1K8AU 4JJBA 3P8DA 4JS5A 1OX9A 4A54A 3M0SA 4J9IA 1RI0A 4RTZA 3I9QA 1ZSZA 5I21A 1VQ9A 5LJ3d 3OS5A 5GAOm 2QAZA 1VQKQ 2HEQA 1E6GA 2JOYA 4OMPA 2QA4T 1AWOA 1Y0MA 2KYMA 3TQ7P 1O75A 1YIJA 4NL3A 2RD1A 2BZ8A 1N8RC 1NBEB 2O2OA 2FVUA 1KHCA 2KRMA 3PMIA 4EIKA 4L5GA 1BI3A 1ABOA 1OPLA 5CAIA 2FZCB 1N27A 3QYGB 3THKA 1W4SA 4M7DG 2KEAA 4WCIA 4QVCA 3MEAA 2YT6A 2K5IA 5CK9A 4XU1A 1ZBJA 3RKWA 4PJOG 4RTYA 2BKDN 5J26A 2EYWA 4E7HA 2HQHA 2DBMA 1YJWT 4KUDK 2K79A 3CCVQ 3NFCA 2QQAA 3EFOB 1RLPC 1PD1A 4ZTFA 1JJ2P 2OAUA 2E6NA 1YJNQ 3G71A 2ZPEB 4XTVA 2LVMA 3PIOA 4CI0C 2RQWA 4JZ3A 4ZGDB 1W6XA 5CKFA 4BDZA 4DEYA 3SD4A 3QG1A 3BDUA 2P4RA 3JCMg 4E7JA 3OYCA 4FSXA 3EG2A 2DXTA 2DTOA 3JCMQ 2RQTA 1WHMA 2MYSA 1YN8A 2HQEA 4FT2A 1ZA1B 2AK5A 1FX7A 3KUFA 5A2QE 8AT1B 4IIMA 4NS5A 1IREB 4KGZB 4ELYC 3VYGA 3JCMJ 1SHGA 4BE0A 1Y07A 3J81E 4CC7A 2DBKA 3CCSQ 1VQKA 1V1CA 1Q81R 4HCCA 4IKFA 3L2RA 1KC8C 3CCUT 2DFUA 4Q5WA 2C0TA 3VKIA 3P8BB 2V1QA 4X9DA 4QVZA 3AT1B 2CDTA 2FZKB 1FXXA 3OS0A 1M90C 2KT8A 5DM7R 1SKUB 2MI6A 5IT9E 3OSVA 3JCMc 2CUBA 4DEXA 3BY7A 5LJ3e 3LYIA 2J6KA 4GY5A 2D0NA 1MV3A 3GPLA 1B34A 3ZBDA 2CREA 3M54A 5GANj 2D1XA 3CCVA 2X9HA 1G5VA 3H0FA 1ZSZB 1YJ9T 1YJNA 1EIFA 2O9VA 5IH2A 4M7AE 1ZA2B 4OB0B 3UF4A 1YFNA 3C12A 3UDCA 2DKGA 3JCMW 2EQMA 2EYQA 2VGNA 1RAAB 2M9UA 3NTIA 1WX6A 3WXMB 2DTHA 4QW2A 1NJIC 1UHFA 1LCKA 3JSCA 2ED0A 3VS2A 3VS1A 2I2LA 1WJRA 2V1RA 4JS4A 4A63B 2HSPA 2QGGA 3OYJA 5GJVB 2DL4A 4AG2C 1SRMA 2CH4W 4OMLA 5LJ3f 4IIOA 3CCJQ 3FIFA 4QQDA 2A28A 2XDDA 3H6ZA 2C06A 1G8XA 1UFFA 2QQ9A 1U06A 5GANg 3CCSA 1KQSP 4M75A 3VRZA 2BZXA 2RI3A 2CH4A 2D0QB 2F2VA 2CP0A 2QDYB 2BTTA 2LMJA 4ZN3A 1M3BA 1MMDA 1YJWQ 2ENMA 1XNIA 1N9SA 4BI8B 2GTJA 5LJ5h 1PHTA 2HBWA 5GAMh 1KQ2A 1UGVA 1JB0E 1MHNA 5D6YA 2EYZA 3E9FA 2J05A 2RI5A 2L0AA 1VQ7T 1M3AA 4UC4A 1Q86R 4JLGA 4IUTA 2EAYA 1MNEA 4KGXB 1X6BA 3QUIA 2F5KA 1U1SA 5KYWA 3M0TA 3REBB 3A98A 4HVVA 2A36A 4AFZC 2R57A 1Y71A 3MP1A 2HAXA 4KULA 1TUGB 2V8IA 3VRYA 5CVIA 3OYLA 2LJ3A 2JMAA 3OYIA 2E1HA 5FU6B 1RLQC 2XU8A 3ME9A 1PKTA 2DD4A 1PKSA 1K8AR 5L8RE 5FRNA 3GLXA 3NPFA 2DVJA 3CCUQ 3X28B 4M78E 4M77F 2NUZA 1XOVA 2KK4A 2WSFE 5I2MA 2DYBA 2RHIA 1V29B 4KT0E 4HXJA 3M9QA 2LP5A 2P4TA 3GOXA 4BB7A 3CCJA 2ZPHB 3O8VA 1I5LA 2V26A 2ZGWA 1VOMA 2SEMA 4MMLA 3M56A 1B34B 1BCMA 2YRDA 1VQ6Q 3EH1A 5GAOr 1YJWA 2VGMA 3OYGA 3RKXA 1OOTA 1KSWA 2RPNA 1YJ9Q 4M77D 3BFMA 1E6HA 2RJCA 1GCPA 3JB9F 3A8OB 1VQ5Q 4ORZA 3BW1A 2HL5C 3LW5E 1YP5A 4Y28E 3EFSA 3QDRB 2K9GA 1UGPB 4M7DA 2JTEA 3EH2A 1I4K1 4XQ3A 1YHQQ 4C8QD 1VUBA 3EGXB 1R0CB 4KUIA 2EKOA 2RK1A 4PJOA 2MPXC 4HVUA 3UT1A 3PVQA 1J3TA 2YRCA 1LVKA 4LDXA 5CKEA 1XQHA 4KGVB 2DXCA 2X4WA 2FL7A 3D7SB 4ME7A 2K3YA 2KE9A 3JCMh 4M7AC 4LXCA 3MP6A 1VYUA 1K9MU 3OMGA 1PC0A 4L59A 3G71T 4PJMA 3QJ6A 4OB3B 3RUXA 5GMKe 1SG5A 3CCUA 3M57A 3FJPA 3JB9D 4OB2B 1G2BA 1WXTA 2KGTA 1GCQA 2PU9B 3OB9A 5HK3A 3VS5A 2R58A 2ESWA 5FU7C 3V8LA 2CT4A 1D3BA 1OYXA 1MV0B 3L42A 2RHXA 1NG2A 1AVZC 4C8QB
chains in the Genus database with same CATH topology
4EMGA 1BIAA 3CBMA 4MZTA 4QVDA 4C92C 2XG8D 4C92B 1UEBA 1BI2A 5GAOl 3I55A 1M1GA 5GMKj 4E7KA 3HSBA 1M1KC 2BUDA 4PLIA 1VQ4T 2CZ1B 2RJFA 5KH6A 3OYFA 3CXCS 2H3JA 3G7ZA 2K2VA 4JRQA 4XTUA 4Y91A 5J39A 1Y96A 1VQ6A 1D3BB 4XTWA 2CZ0B 3M58A 5CIUA 2X35A 2K5FA 2MMPA 5D6WA 5GANd 3JAME 4CRIA 4BE2A 3UPUA 5GMKm 2QEXT 4M7AF 1BI0A 2EIFA 1Q82U 4Z02A 3INZA 1G3SA 2QQRA 3QHSA 4DQ2A 1K8AU 3P8DA 1YJ9A 3V7RA 4M75F 4JS5A 1ZHIA 5GAN3 2YRVA 1VQOT 3L1AA 4A54A 1I8FA 2KVQG 3JCMe 2CGHA 2LCLA 1RI0A 1VQ5A 5I21A 4HCBA 4YTLA 1VQ9A 4LD6A 5LJ3d 3OQ5A 3OS5A 2LTOA 5GAN6 4R55A 3L2VA 1YHQA 5GAOm 1N9RA 2DTIA 2QI2A 3OA6A 2XD0A 2DZ9A 3JRZA 3LH0A 2YLCA 2X4JA 1R8OB 2YLBA 4HCZA 2JOYA 5CO7A 2QA4T 3CCET 3NTKA 4JRPA 1BI1A 2CS7A 3HL8A 4V2SA 2KQWA 1SSFA 2PUKB 4MDWA 3WVDB 3TCJA 3JB9I 3GP8A 2DZCA 4PJOD 4J6XA 1KQ1A 4M78G 1O75A 1YIJA 4NL3A 2RD1A 2V8JA 2WACA 1N8RC 1NE8A 1M1FA 2FVUA 1KHCA 2O4XA 1RL2A 3PMIA 2OTJT 3G6EA 1X01A 2DPPB 4L5GA 3X26B 1BI3A 1UB4A 3HRTA 2L89A 5CAIA 3CCVT 2CZ6B 2F5TX 2FHDA 3M5AA 1N27A 3QYGB 3R6OA 4A4HA 3MCAB 1W4SA 5HK0A 1YJNT 4MMKA 4C5HA 2ZPFB 1Q7YU 2PVOB 2EJ9A 2XICA 4FL6A 5IN1A 4A4GA 3CC4A 3OMCA 1OZ2A 3SWNA 4M7DG 5C0MA 4QVCA 4M78C 3MEAA 3QO3A 3OYBA 1U1TA 2K5IA 5HY6A 2RK2A 4EMKA 4XU1A 5CK9A 2VUBA 4J7IA 4C0DB 4C0DC 3CD6T 3OYAA 3RKWA 3V7CA 4JJNK 3QSUA 3JCMf 4PJOG 1H3ZA 5J26A 2BKDN 4E7HA 3GF5A 3KXTA 2JTFA 3C4SA 4QQGA 3RIRA 5GANh 3L2UA 5KE2A 4PKCC 3DLMA 4LDWA 1YJWT 2XHCA 3E19A 4KUDK 1YITT 3NFCA 2QQAA 3M53A 3MEVA 4ZTFA 3Q1JA 2OAUA 3PMTA 2E6NA 1KQSA 3GNGA 2L8DA 2LQKA 3TREA 4M77G 2ZPEB 4A4EA 4F7UG 3G71A 3CCLT 1WNLA 3SWNC 3SWNB 3OYKA 2QTXA 4XTVA 4M7DC 3BDLA 4M7DB 4BUGA 3CC2T 1UGSB 2LVMA 2D9TA 2V8KA 4N4GA 4XU0A 2R5AA 4EMKB 4CI0C 3PIOA 3FLGA 3EAEA 4ZGDB 5KCOA 4ELZC 5CQXA 4XAXB 5LJ3h 2JZ2A 3A5ZB 5CKFA 4PJOB 4PJOC 2LCCA 4BDZA 3SDZA 2LRQA 3SD4A 3QG1A 4C8QG 4OVAA 3FC3A 3M4YA 1P92A 4OMFB 5GAOn 3BDUA 3JCMg 4E7JA 4IUUA 3H8ZA 4FSXA 4N4IA 3OYCA 3CCST 2DXTA 3CMAT 2DTOA 3MP8A 2O01E 2YHTA 2K57A 3CBPA 3JCMQ 2OTJA 2KAFA 5CQYA 4M77C 4M77B 3VU3C 4F7UB 4RCBA 3HFOA 3FDRA 2CYZB 2E5QA 3DB3A 3UWNA 3L2QA 2HQEA 4FT2A 1Q86U 1FX7A 3KUFA 5A2QE 1M8VA 4J83A 2X4YA 3QJYA 4IUQA 4NS5A 1VQMT 1VQ8A 4LD9K 1IREB 1VQ4A 1OI1A 3P8HA 4M78F 4ELYC 3VYGA 3JCMJ 4JLIA 4X9CA 2LQ8A 1WPYA 1NPPA 4C8QC 3LWIA 4BE0A 1Y07A 3J81E 4ZTJA 2E65A 2LDMA 3CC7T 3G4SA 1BIBA 4LDVA 3VUZA 4OF1A 2P0QA 1JRIA 2RHYA 1KQSS 3SFMA 2OTLT 3QBYA 4XTXA 4PL6A 1VQKA 2QEXA 2LT4A 3OYNA 5DLQE 1QVGA 4HCCA 1YI2T 3L2RA 4IKFA 3VJPA 3JB9G 2DIQA 3CCUT 1KC8C 1QW1A 4ZGJB 4Q5WA 2GCXA 2BIVA 2HBPA 5A0GA 3SB2A 3VKIA 3P8BB 4E7IA 3URGA 3NTHA 5M9OA 2KSSA 1VIEA 5GANe 2NLUA 2VC8A 4N4HA 5CR2A 4C0GA 2LNVA 3FB9A 1WJSA 4X9DA 2Y4XA 3MHXA 4QQ6A 2DO3A 4QVZA 4E7LA 3CMET 3RMSA 3VV0A 4B9XA 1FXXA 1VQLA 4MZMA 3QKJA 2QA4A 3OS0A 3OS2A 3PGGA 1M90C 4J7FA 5DM7R 2QXFA 2MI6A 4A53A 5IT9E 3OSVA 2CZ7B 3JCMc 1LNXA 2HD0A 1Y96B 4O6JA 5LJ3e 3BY7A 5I2SA 3LYIA 2XDPA 1YBYA 4FU6A 2R5MA 4GY5A 3GPLA 1BKBA 1K73C 3CBOA 1B34A 3RESA 3ZBDA 3M54A 5GANj 2RJEA 1G3YA 3X20B 2E12A 2DK3A 2DJZA 3M59A 3CCRA 2CKKA 5LJ5d 2RH2A 3CCVA 1M1KU 1KG1A 5GAMd 4C8QF 1G5VA 4DOVA 3CCMT 1QVGS 1YJ9T 4C92F 1YJNA 1EIFA 3FRNA 1KC8U 2GFAA 4M7AE 4OB0B 3OYEA 4M7AD 4BE1A 3C12A 1BYMA 3S3MA 3UDCA 2DKGA 5LJ3j 4M75E 2EQMA 3JCMW 3V8JA 4MDXA 2PVGB 3CCQT 2EYQA 2JNGA 4M75D 2VGNA 4PNOA 1VQ9T 3I56A 3CCJT 2Y4YA 1VQNT 2KMTA 5GANf 2M9UA 3NTIA 3WXMB 4BY6C 4BY6B 2DTHA 4QW2A 5FRMA 1NJIC 1TH7A 2ZCFB 3JSCA 3HFNA 2DEQA 1ZBXA 2I2LA 1WJRA 1M90U 3QZ5B 2O4XB 4JS4A 3CCLA 2GFUA 1YIJT 3PFSA 3CC2A 3OYJA 1YCYA 5IAYA 3A8MB 5LJ3f 3WVEB 1K73U 2L5QA 5AYFA 5J3BA 3V7SA 3G6ET 3FIFA 4N0AA 4QQDA 4M7AA 2XDDA 1DJ7B 2KY9A 4C92E 3E1SA 4L6V5 2M16A 2WSCE 3H6ZA 2G3RA 4P5NA 4EMKC 2IG0A 4TVRA 2QQ9A 2C06A 4C92D 5GANg 3CCSA 4M75A 3QYHB 4XU2A 2FB7A 2MAMA 1N8RU 2D0QB 2RI3A 2K5LA 4WF2A 4C0ZA 2EWNA 2VXEA 4XK8E 2QDYB 1KHIA 4E47A 3CC4T 2GQVA 1JJ2A 3GNFB 1FWZA 4J6YA 4ZN3A 5C6SA 1Q81C 4JRIA 2VYTA 1VQPA 4BACA 2XDBA 3QXEB 1VIFA 3A8HB 1M9SA 1XNIA 3MO8A 5DLOA 1WJQA 3MEUA 2DAQA 1N9SA 2M1HA 1VQMA 2F69A 4BI8B 1HXDA 2DD5A 2L3RA 1W2BA 1WQ7A 5LJ5h 5LJ3g 2RM4A 2ZPIB 3X24B 5GAMh 1KQ2A 2LT1A 2XIDA 2MWOA 1GXIE 3CC7A 2EJGA 5CKBA 2RI2A 1JB0E 4M75B 3V8KA 1MHNA 5D6YA 1HK9A 1Q82C 3LGLA 3E9FA 5FLXE 1K8AC 2RI5A 3JB9H 1VQ7T 4UC4A 3A8GB 4C5GA 1YI2A 3QPHA 5EG2A 3OW2A 4BI4A 4JLGA 4C92A 4EDUA 3QIIA 4IUTA 1N6AA 2EJFA 2EAYA 3CEYA 2IVWA 3OYYA 4OGCA 3QUIA 2F5KA 1U1SA 3META 1UGRB 3EFRA 1S72T 4O5VA 3GIBA 4RCCA 5FU7B 1VQOA 2R57A 3HHTB 1Y71A 1LJOA 3MP1A 1JJ2S 4KULA 5A0LA 3OYHA 2HAXA 4M7DF 4JDSA 2V8IA 3ZFJA 5CVIA 4ZN1A 3OYLA 5KE3A 4R56A 1Q81U 3A8LB 2HNIA 4LDUA 3OYIA 4A4KA 3S6WA 2E1HA 5FU6C 2MF2A 5FU6B 2XU8A 3ME9A 4PJOF 3OSSC 2VXFA 1VQ8T 2DD4A 4IURA 2E41A 4EPCA 2QQSA 3S3OA 5LL6S 2B8AA 1MGQA 2K3XA 2MWPA 4IUPA 5A0DA 5L8RE 3OY9A 1W2BS 5FRNA 4XU3A 4J5YA 3CCEA 2JVVA 4BI3A 1NZ9A 3GLXA 3G4ST 3I55T 1AHJB 2A3LA 3X28B 4M78E 5DY9A 4HT9A 4M77F 1OZ3A 4M78D 4F7UF 1VQKT 1XOVA 2KK4A 2WSFE 2ZPGB 5I2MA 5GAN2 3M55A 3CCMA 2E10A 2RHIA 1Q7YC 3OW2S 5GAN8 1V29B 2RHUA 1VQ6T 4KT0E 2Y90A 3JCMd 3OYDA 4JUVA 3KBGA 2ZZDA 2E64A 3OS1A 1PSEA 3M9QA 3X25B 2P4TA 5LJ5e 5GAMe 3GOXA 3PT9A 4B9WA 3CCQA 2RJDA 4BB7A 1VQNA 3N5BB 3J7AF 2K4YA 2ZPHB 3CCJA 4M7DE 1H641 1WQWA 4C0FA 1QVFA 1X75C 3HRSA 3S3NA 1ZQ1A 4EMHA 4GLKA 3CPWA 3O8VA 4LDYA 4M7DD 3ASKA 5FROA 1IZ6A 2ZGWA 1I5LA 1VQLT 3AHUA 5GMKh 3C94A 4MMLA 4RG2A 1VQ5T 3M56A 4OP0A 3TU4K 5GAN7 1B34B 3CD6A 4PJOE 2XI9A 4D6WA 3VUBA 2P0KA 2DIGA 4FT4A 4RKUE 2GF7A 4M78A 1YHQT 1KD1C 4IUVA 2EQUA 2KDSA 3E9GA 5GMKi 5GAOr 1K9MC 4II1A 1YJWA 3M4GA 2VGMA 1G3TA 1YITA 3OYGA 4BDYA 4JRKA 3FEOA 2P0PA 4FIBA 3RKXA 5CKDA 4C5IA 4M77E 5LJ5j 4F7UE 3HPWA 4RG8A 3DB4A 5GAMj 4M77D 4DA4A 3BFMA 3CCRT 2PUOB 3JB9J 2FYKA 4ZGEB 2RJCA 4NOYA 2LX9A 1UGQB 3JCMP 5GAOq 3JB9F 4PLLA 4C5EA 1WGSA 3A8OB 5CCAA 3OYMA 4HA8A 4A4FA 3BW1A 3HKSA 3LW5E 2WSEE 4Y28E 3EFSA 3JCMX 4NL2A 3QDRB 4KBMB 3JCMb 1UGPB 4M7DA 4C8QE 1PSFA 3MEWA 2HQXA 4FM4B 4M7AG 1I4K1 1M4ZA 4M78B 1Q86C 4XQ3A 4C8QD 1VUBA 1XTDA 4VUBA 4RMOA 2EQJA 3CPFA 3OBYA 4M75G 3L2WA 2M0OA 3C95A 3PTAA 1O9SA 1JBMA 2EKOA 2RK1A 4KUIA 3I56T 2RO0A 3DKMA 4PJOA 3UT1A 2AHJB 3F70A 1QVFS 5LJ5f 2RHZA 3PIPA 3CPWS 2DVEA 3T9NA 5GAMf 2E6ZA 5GAOp 2RB6A 2EQKA 4LDXA 5CKEA 3HP9A 3LWHA 3RKYA 1XQHA 4XTZA 2PQWA 3OBWA 5CKHA 2DXCA 2X4WA 2RA2A 2FL7A 2DXBA 2JN0A 3L2ZA 4ME7A 2K3YA 1M5Q1 1QP2A 4M77A 3JCMh 3JCMV 3TEEA 4DOWA 2XKOC 4N0AC 2JTMA 4F7UA 5GAN4 3CXCA 3RERA 1VQ7A 1U8RA 2EFIA 4M7AB 4M7AC 3ZEHA 1NJIU 3ER0A 2PVDB 3MP6A 1KD1U 3LLRA 5D6XA 1K9MU 3OMGA 4M75C 4HT8A 2QQBA 3VYHB 4L59A 1QVPA 2ZPBB 2XK0A 3G71T 2OTLA 3LX7A 3QZ9B 3QJ6A 3PNWC 4OB3B 3RUXA 4C8QA 3RMQA 1QP3A 3HRUA 4J6WA 1X6OA 2VV5A 5GMKe 1S72A 1I81A 4X34A 4C92G 3M57A 3FJPA 4J8OA 3CCUA 3JB9D 4OB2B 1LOJA 1Y7XA 2LC4A 5LJ5g 5GAN5 4HKEA 5GMKl 1G3WA 5GAMg 2X4XA 2PU9B 4OGEA 2E70A 3CMAA 3OB9A 5HKCA 5HK3A 4ATOA 3LGFA 1VQPT 2D6FA 2R58A 2A7YA 5FU7C 3V8LA 3J80E 4MZPA 1D3BA 3CMEA 2DXUA 1OYXA 1NPRA 3DLLA 3L42A 2RHXA 4OB1B 4XTYA 4C8QB 2JUFA 5KCHA 4BD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZD A;  1PSE A;  3X25 B;  3QZ5 B;  2CZ1 B;  2ZPH B;  2O01 E;  3A8M B;  3WVE B;  2CZ0 B;  2CYZ B;  1DJ7 B;  4L6V 5;  2WSC E;  1IRE B;  4RKU E;  1GXI E;  3QYH B;  3VYG A;  2D0Q B;  4XK8 E;  2QDY B;  3QXE B;  2PUO B;  3A8H B;  4ZGE B;  1UGQ B;  2DD5 A;  3A8O B;  4ZGJ B;  2ZPI B;  2WSE E;  3LW5 E;  4Y28 E;  3X24 B;  1UGP B;  1PSF A;  4FM4 B;  1JB0 E;  2PUK B;  3WVD B;  3A8G B;  2AHJ B;  2DPP B;  3X26 B;  2DXC A;  2CZ7 B;  2CZ6 B;  2DXB A;  1UGR B;  3QYG B;  1QP2 A;  2ZPF B;  2PVO B;  2PVD B;  3HHT B;  3VYH B;  2ZPB B;  3X20 B;  3A8L B;  3QZ9 B;  4OB3 B;  1QP3 A;  2DD4 A;  4OB2 B;  5L8R E;  2PU9 B;  4OB0 B;  1AHJ B;  3X28 B;  2ZPE B;  2PVG B;  2WSF E;  2ZPG B;  1UGS B;  1V29 B;  4ZGD B;  4OB1 B;  4KT0 E;  2ZCF B; 
#chains in the Genus database with same CATH topology
 1BIA A;  2P84 A;  4PJN A;  1NLO C;  1M1G A;  1OU9 A;  1M1K C;  2CZ1 B;  2RJF A;  3OYF A;  2H3J A;  2K2V A;  2ABL A;  2PNI A;  1Y96 A;  1VQ6 A;  1ACM B;  1IHV A;  2YUQ A;  5GMK m;  1FMV A;  4M7A F;  1WHG A;  4J9D A;  1YJ9 A;  3HTR A;  3BE3 A;  1BK2 A;  1WFW A;  1SHF A;  1C6V X;  2LCL A;  1VQ5 A;  4YTL A;  1NEG A;  3L2V A;  2DE0 X;  1YHQ A;  1N9R A;  3LH0 A;  2YLC A;  2YLB A;  1R8O B;  4Y92 A;  1BI1 A;  1QVF P;  3E2U A;  2LZ6 B;  1IB8 A;  3TCJ A;  4PJO D;  4J6X A;  2V8J A;  2J6F A;  1NE8 A;  1RL2 A;  2DEU A;  1X01 A;  2DPP B;  3X26 B;  1UB4 A;  3HRT A;  2L89 A;  3CCV T;  1BCO A;  3M5A A;  3R6O A;  3MCA B;  5AT1 B;  1YJN T;  4MMK A;  4C5H A;  2ZPF B;  3TSW A;  2PVO B;  1GRI A;  3EG1 A;  1M3C A;  3OMC A;  3RDV A;  4M78 C;  3OYB A;  3RNJ A;  5HY6 A;  2RK2 A;  2VUB A;  4J7I A;  1RUW A;  4C0D B;  4FYV B;  3OYA A;  1ABQ A;  3GF5 A;  3KXT A;  2JTF A;  4QQG A;  3RIR A;  3UA6 A;  5GAN h;  4PKC C;  3DLM A;  8ATC B;  3EGD A;  3Q1J A;  2LQK A;  4M77 G;  2JXB A;  3OYK A;  2QTX A;  4M7D B;  4BUG A;  1MMA A;  2QTV A;  4Z88 A;  4XU0 A;  5IHK A;  4EMK B;  2R5A A;  4FYX B;  2LJ0 A;  4PJO B;  4JJD A;  2LRQ A;  3LH5 A;  2J7I A;  4AFS C;  4C8Q G;  2MOX A;  5GAO n;  4RTV A;  1M2V A;  4IUU A;  4N4I A;  3CCS T;  1M30 A;  3CBP A;  2YDL A;  2AIR B;  2VKN A;  3FDR A;  2CYZ B;  2E5Q A;  2GGR A;  3CC2 Q;  1Q86 U;  3EG0 A;  4CC4 B;  2J06 A;  4LD9 K;  2ZAE A;  4M78 F;  1AZE A;  4X9C A;  1BIB A;  4K11 A;  4LDV A;  1PG5 B;  3VUZ A;  2VAS A;  3QBY A;  4PL6 A;  2LT4 A;  1D1C A;  1R77 A;  3JB9 G;  2DIQ A;  2D8H A;  5A0G A;  3I35 A;  2HZY A;  4E7I A;  3EHQ A;  5M9O A;  2KXC A;  2NLU A;  4J9H A;  4N4H A;  1NM7 A;  4C0G A;  2EKH A;  3FB9 A;  3MHX A;  2HDA A;  4FW1 A;  3CME T;  3CC7 Q;  2DJQ A;  4J9B A;  1K9A A;  2FRW A;  1Q82 R;  4MZM A;  2ATC B;  3OS2 A;  1BBZ A;  2CZ7 B;  1JO8 A;  1Y96 B;  4O6J A;  2QDL A;  1W1F A;  1YBY A;  2R5M A;  1BKB A;  1K73 C;  1B3Q A;  2C0O A;  1G3Y A;  2I0N A;  3M59 A;  2DJZ A;  4RTW A;  2CKK A;  5LJ5 d;  5GAM d;  1QCN A;  2AZS A;  1TSF A;  1ZSZ C;  1WHK A;  4C92 F;  1KC8 U;  4J9C A;  2XMF A;  4M75 E;  1HSQ A;  3V8J A;  1QWE A;  4MDX A;  2JNG A;  3CCJ T;  2NYS A;  3SHW A;  1Q7Y R;  4LNP A;  1ZBX A;  1Y57 A;  2L3S A;  2NUP B;  3CCM Q;  1M90 U;  3QZ5 B;  2PZ1 A;  1PWT A;  3CC2 A;  1QCF A;  3A8M B;  2RN8 A;  2BZY A;  1JXO A;  5J3B A;  1QCO A;  4DBR A;  4N0A A;  2JW4 A;  1SSH A;  2K3B A;  3E1S A;  1RI9 A;  4C92 D;  3EG9 A;  4XU2 A;  4HT8 A;  1WXU A;  4C0Z A;  4XK8 E;  1JJ2 A;  1KHI A;  1FWZ A;  1WIE A;  4J6Y A;  1OX8 A;  1IXD A;  1K9M R;  2YUN A;  3EGD B;  3A8H B;  1M9S A;  5DLO A;  1WJQ A;  3MEU A;  2DAQ A;  2M1H A;  1HXD A;  2L3R A;  1W2B A;  2DL3 A;  2RM4 A;  2LT1 A;  2VWF A;  2FG0 A;  2XID A;  4F17 A;  3CC7 A;  2EJG A;  1ZSG A;  2M02 A;  1K8A C;  1K0X A;  3FJ5 A;  1YI2 A;  3QPH A;  5EG2 A;  1T3S A;  1CSK A;  1M2V B;  1WA7 A;  1JU5 C;  2KRO A;  5IHN A;  2JT4 A;  2IVW A;  1UGR B;  3EFR A;  2M51 A;  4O5V A;  1CKA A;  2EVR A;  3HHT B;  5KYX A;  1JJ2 S;  5A0L A;  3OYH A;  2DRM A;  3ZFJ A;  5FU6 C;  4OMO A;  2VXF A;  1VQ8 T;  4EPC A;  2QQS A;  3OY9 A;  5A0D A;  1W2B S;  2FPE A;  2OI3 A;  1QWF A;  4BI3 A;  3M0R A;  1NZ9 A;  1S72 Q;  1AHJ B;  4HT9 A;  4F7U F;  5GAN 2;  3CCM A;  1T3L A;  3TVT A;  1VQ6 T;  3JCM d;  1MMG A;  3CME Q;  2ZZD A;  1PSE A;  5FWC A;  3NHN A;  5LJ5 e;  5GAM e;  3J7A F;  1UJ0 A;  4M7D E;  4RTU A;  1X75 C;  3I55 Q;  3S3N A;  1ZQ1 A;  3CPW A;  3ZL7 C;  3C94 A;  1VQ5 T;  5GAN 7;  4PJO E;  2QGF B;  2L3P A;  2DIG A;  1Z9Q A;  2GF7 A;  1YHQ T;  1KD1 C;  2KDS A;  3EGX A;  1G3T A;  3VS3 A;  4AMC A;  4JRK A;  3FEO A;  2CP6 A;  4RG8 A;  2AT1 B;  4LUE A;  3JB9 J;  2LX7 A;  2LX9 A;  1UGQ B;  3JCM P;  1UJY A;  5GAO q;  1ZX6 A;  1EFN A;  4C5E A;  5CCA A;  3HKS A;  4NL2 A;  1PSF A;  3MEW A;  2HQX A;  1TS9 A;  4VUB A;  4RMO A;  1JBM A;  2RO0 A;  5LJ5 f;  3CPW S;  4DBF A;  5GAM f;  2CT3 A;  2DLP A;  2EQK A;  3LWH A;  3RKY A;  1RAC B;  4XTZ A;  3OBW A;  2GTO A;  1N8R R;  4F16 A;  3H41 A;  2A37 A;  3L2Z A;  4M77 A;  3CXC A;  3JCM V;  3RER A;  2XKO C;  2KXD A;  2MK5 A;  5IXB A;  2EFI A;  3ER0 A;  5D6X A;  1TXQ A;  1UHC A;  3EG3 A;  3EG9 B;  4M75 C;  3VYH B;  2XK0 A;  2FEI A;  2YUP A;  2FZG B;  2GQI A;  4C8Q A;  3RMQ A;  1QP3 A;  3HRU A;  1WXB A;  1S72 A;  2E3H A;  1I81 A;  2K6D A;  4X34 A;  4C92 G;  1LOJ A;  1Y7X A;  4J9G A;  4HKE A;  2X4X A;  4OGE A;  1OQK A;  2EYX A;  1AZG B;  3LGF A;  1GFC A;  1UUE A;  1HYO A;  3CME A;  1NEB A;  1QMC A;  2QAS A;  2RQU A;  2DER A;  4OB1 B;  4XTY A;  1TUC A;  4KRT A;  2JUF A;  1T0H A;  3L2Q A;  1UE9 A;  5GAO l;  1UEB A;  3SEM A;  3I55 A;  4E7K A;  3HSB A;  1SRL A;  2BUD A;  4PLI A;  4J9E A;  3CXC S;  1AD5 A;  3G7Z A;  4QT7 A;  4Y91 A;  5FWB A;  4FYY B;  2CZ0 B;  3ULR B;  5CIU A;  2X35 A;  1TOV A;  2L3Q A;  5GAN d;  1ZUK A;  4CRI A;  5KYX B;  1PRM C;  1BI0 A;  1Q82 U;  4Z02 A;  2A0F B;  2K7A A;  4M75 F;  3V7R A;  2O9S A;  5GAN 3;  2YRV A;  4LE9 A;  2KVQ G;  3JCM e;  1VQ8 Q;  4FSS A;  3NGP A;  1VQ4 Q;  4AFQ C;  1QKX A;  2E5K A;  1RAF B;  4LD6 A;  1H92 A;  5GAN 6;  2EYY A;  4R55 A;  2A08 A;  2QI2 A;  2DTI A;  3JRZ A;  2X4J A;  4HCZ A;  3UAT A;  1V76 A;  3NTK A;  4V2S A;  2CS7 A;  1KC8 R;  3HL8 A;  2KQW A;  3U23 A;  3WVD B;  3GP8 A;  2DZC A;  1KQ1 A;  1YWP A;  2WAC A;  5KYN A;  1HJD A;  2CSI A;  2O4X A;  1WHL A;  1OPK A;  1D09 B;  2FHD A;  2BE9 B;  1N5Z A;  4A4H A;  1M90 R;  5HK0 A;  2D8J A;  1OU8 A;  1Q7Y U;  2XIC A;  2EJ9 A;  1I5O B;  1OZ2 A;  1U1T A;  4EMK A;  4C0D C;  1MND A;  1TU0 B;  4ZNX A;  4JJN K;  3QSU A;  1H3Z A;  3JCM f;  1K0S A;  3L2U A;  5KE2 A;  4JJC A;  4LDW A;  2XHC A;  2DA9 A;  1YIT T;  3M53 A;  2SRC A;  3PMT A;  2DRK A;  2YSQ A;  4F7U G;  3SWN B;  4M7D C;  3CC2 T;  1KK7 A;  2D9T A;  1PRL C;  1NYF A;  3FLG A;  2X51 A;  4DBH A;  1WLP B;  2JZ2 A;  3A5Z B;  4PJO C;  5GJW B;  1PCX A;  2VVK A;  3SDZ A;  1NJI R;  2DMO A;  3FC3 A;  4OVA A;  2DYI A;  3M4Y A;  1P92 A;  2COZ A;  1AT1 B;  2KAF A;  5CQY A;  4M77 B;  2ECZ A;  3CCL Q;  3DB3 A;  3UWN A;  1VYT A;  1D1A A;  1D0X A;  1M8V A;  4J83 A;  1YCS B;  2X4Y A;  3QJY A;  4IUQ A;  1VQ8 A;  1GBR A;  1VQ4 A;  2DL5 A;  4JLI A;  3LWI A;  1WPY A;  2E65 A;  2LDM A;  3CC7 T;  4OF1 A;  1XJW B;  3CMA Q;  1GCQ C;  5DLQ E;  1QVG A;  1YI2 T;  2FPD A;  3REA B;  1QW1 A;  4ZGJ B;  4JZ4 A;  2HBP A;  2HL3 A;  4OMM A;  3NTH A;  5GAN e;  1SPK A;  5CR2 A;  1X43 A;  2LNV A;  1WJS A;  2Y4X A;  2DO3 A;  4B9X A;  2QXF A;  2XDP A;  3RES A;  2RJE A;  5ECA A;  3X20 B;  2E12 A;  2DK3 A;  2RH2 A;  3VS6 A;  2J6O A;  1KG1 A;  4DOV A;  3CCM T;  1QVG S;  2NUP A;  1KJW A;  4PJL A;  2O31 A;  3OYE A;  4M7A D;  4BE1 A;  4JPB W;  5LJ3 j;  4PFP A;  2PVG B;  4ANJ A;  4PNO A;  1RAI B;  4GBQ A;  1OEB A;  5GAN f;  4GLM A;  4BY6 B;  5FRM A;  2DF6 A;  2LNH B;  1TH7 A;  2ZCF B;  1M2O A;  2X3X D;  3HFN A;  2C0I A;  2O4X B;  3CCL A;  2EPD A;  2YXY A;  2O88 A;  5IAY A;  2KRS A;  1K73 U;  2L5Q A;  2MIO A;  3CCQ Q;  3V7S A;  1VQN Q;  3G6E T;  4P5N A;  4L6V 5;  2M16 A;  2JMC A;  4RTT A;  1UTI A;  2FB7 A;  1N8R U;  3CMA A;  2K5L A;  2OX7 A;  2EWN A;  2VXE A;  4E47 A;  3CC4 T;  5L23 A;  2GQV A;  5C6S A;  1Q81 C;  4JRI A;  2VYT A;  4BAC A;  3QXE B;  2NUT A;  3M0Q A;  3MO8 A;  1YIT Q;  1VQM A;  2F69 A;  1IO6 A;  4AG1 C;  1UG1 A;  2BE7 D;  1WQ7 A;  5LJ3 g;  3X24 B;  2G6F X;  3MJX A;  3V8K A;  1NYG A;  4QKU A;  3LGL A;  5FLX E;  2RMO A;  2ED1 A;  5KYU B;  3A8G B;  4C5G A;  3OW2 A;  4BI4 A;  4C92 A;  5IXF A;  4EDU A;  1I07 A;  1N6A A;  2EJF A;  2HSE B;  3CEY A;  3OYY A;  2K2M A;  4CC2 A;  1S72 T;  4RCC A;  5FU7 B;  2CUD A;  2OTJ T;  1LJO A;  2EW3 A;  3I5R A;  3MKD A;  4R56 A;  4LDU A;  3S6W A;  3CQT A;  4CC3 A;  2E41 A;  1WHH A;  1U5S A;  1C1A A;  5LL6 S;  2B8A A;  2MWP A;  5I22 A;  4J5Y A;  2JVV A;  1YI2 Q;  2PTK A;  3G4S T;  1K1Z A;  3I55 T;  2A3L A;  1T0J A;  3QWY A;  1Z9Z A;  1OZ3 A;  4M78 D;  2ZPG B;  2E10 A;  3OW2 S;  5GAN 8;  2KRN A;  2E64 A;  2EGA A;  1S1N A;  1K4U S;  3CCQ A;  2RJD A;  1VQN A;  4KH1 B;  1ZLM A;  3N5B B;  2KBT A;  4C0F A;  4EMH A;  2COY A;  4LDY A;  1M1K R;  1VQL T;  3AHU A;  3JV3 A;  4HCK A;  4OP0 A;  2LQW A;  3VUB A;  1X2K A;  2P0K A;  1TTH B;  4FT4 A;  1EZZ B;  5GMK i;  3E9G A;  2KR3 A;  3M4G A;  1JXM A;  1YIT A;  4BDY A;  2P0P A;  4FIB A;  4C5I A;  4M77 E;  1AWJ A;  3DB4 A;  1BU1 A;  4FCY A;  1YWO A;  2GBQ A;  3CCR T;  4DA4 A;  2PUO B;  4E7Z A;  4ZGE B;  4PLL A;  4A4F A;  3RBB B;  3JCM b;  1I1J A;  4C8Q E;  1YNZ A;  4M7A G;  4M78 B;  1Q86 C;  1XTD A;  2EQJ A;  3CPF A;  2M0O A;  3C95 A;  3PTA A;  1O9S A;  2YWW A;  9ATC B;  3I56 T;  1VA7 A;  1M8M A;  1KFZ A;  2AHJ B;  3F70 A;  2RHZ A;  3T9N A;  2H3E B;  2E6Z A;  1ARK A;  3HP9 A;  4D8D A;  1FYN A;  5CKH A;  2PQW A;  1TWB A;  1EX4 A;  2DXB A;  2JN0 A;  2W10 A;  4RUG A;  2VB6 A;  4DOW A;  2IIM A;  4F7U A;  5GAN 4;  4N0A C;  2JTM A;  3G6E Q;  4F14 A;  1NJI U;  1KD1 U;  3LLR A;  2QQB A;  2IPO B;  1TG0 A;  2ZPB B;  1W2B P;  1KIK A;  3LX7 A;  3QZ9 B;  3CC4 Q;  3PNW C;  1SEM A;  4RTX A;  2VV5 A;  2EGC A;  2NUT B;  2X3W D;  2DX1 A;  3H9N A;  5GMK l;  2E70 A;  2ROT A;  5HKC A;  1VQP T;  2A7Y A;  3M0P A;  3J80 E;  4MZP A;  4LUD A;  4PFO A;  2DXU A;  4D8K A;  4ESR A;  1IRX A;  4BD3 A;  4EMG A;  4MZT A;  4QVD A;  2XG8 D;  4C92 B;  1WDX A;  5GMK j;  1D0Y A;  4B6M A;  1VQ4 T;  5KH6 A;  2LJ1 A;  4XTU A;  1R0B G;  5J39 A;  4XTW A;  3M58 A;  2K5F A;  2OAW A;  2MMP A;  3JAM E;  2OTJ Q;  1WHJ A;  1B7T A;  1BB9 A;  2QQR A;  4PFZ A;  2Z0W A;  4R0K A;  1GFD A;  2RF0 A;  1ZHI A;  4OMQ A;  1VQO T;  3UA7 A;  3L1A A;  4HVW A;  1I8F A;  2CGH A;  1IGU A;  4HCB A;  3OQ5 A;  2LTO A;  3VS0 A;  3G4S Q;  5I11 A;  4OMN A;  3MPU B;  2XD0 A;  3OA6 A;  2EBP A;  4Z89 A;  2DZ9 A;  2ROL A;  5CO7 A;  2QEX Q;  3CCE T;  1X2Q A;  4JRP A;  2JM9 A;  1SSF A;  3CPW P;  2PUK B;  4MDW A;  3VS7 A;  3JB9 I;  4M78 G;  1IGQ A;  1M1F A;  2KI7 A;  3G6E A;  1RAG B;  3I5S A;  2CZ6 B;  2F5T X;  1VQL Q;  2HKQ B;  2QA4 Q;  5IN1 A;  4A4G A;  4FL6 A;  3CC4 A;  6AT1 B;  3SWN A;  5C0M A;  3QO3 A;  1MMN A;  2CSQ A;  1K73 R;  3CD6 T;  3V7C A;  2AKK A;  1AWW A;  3C4S A;  4Z8A A;  3CCR Q;  3E19 A;  3O5Z A;  1E7O A;  3MEV A;  4FYW B;  2CP3 A;  1KQS A;  3GNG A;  2L8D A;  4A4E A;  3TRE A;  3CCL T;  3C0C A;  1WNL A;  3SWN C;  3BDL A;  3KFV A;  1UGS B;  2V8K A;  4N4G A;  3EAE A;  5KCO A;  4ELZ C;  3CXC P;  5CQX A;  2YUO A;  4XAX B;  5LJ3 h;  3I56 Q;  2LCC A;  1TUD A;  1SF9 A;  4OMF B;  3QDF A;  3H8Z A;  3CMA T;  3MP8 A;  2O01 E;  2YHT A;  2K57 A;  2OTJ A;  1OUL A;  2QG9 B;  4M77 C;  2JS0 A;  3VU3 C;  4F7U B;  4RCB A;  3HFO A;  2DL8 A;  1W70 A;  1PD0 A;  1GBQ A;  2FO0 A;  1VQM T;  1OI1 A;  3P8H A;  5KYY A;  2LQ8 A;  1NPP A;  4C8Q C;  4ZTJ A;  2DIL A;  3G4S A;  1RAH B;  2P0Q A;  1JRI A;  2RHY A;  1KQS S;  3SFM A;  2OTL T;  4XTX A;  2CP2 A;  2QEX A;  3OYN A;  1VYV A;  5FW9 A;  3VJP A;  1VQP Q;  1A0N B;  1RAD B;  2E4H A;  2GCX A;  2BIV A;  3SB2 A;  4DBQ A;  2L2P A;  3URG A;  2KSS A;  1VIE A;  3H0H A;  2VC8 A;  4X1V A;  1H8K A;  4E7L A;  4QQ6 A;  5HCK A;  1RAE B;  1K76 A;  3RMS A;  4WTO B;  3VV0 A;  2CP5 A;  1VQL A;  3QKJ A;  2QA4 A;  3PGG A;  4J7F A;  2LQN A;  4A53 A;  1LNX A;  2HD0 A;  2COW A;  3EHR A;  5I2S A;  4FU6 A;  1D1B A;  3CBO A;  2F2W A;  5EC7 A;  3CCR A;  1VQO Q;  1M1K U;  4C8Q F;  2E3I A;  2AKL A;  3FRN A;  2GFA A;  2H8H A;  1BYM A;  3S3M A;  3NMZ C;  2F2X A;  3CCQ T;  1VQN T;  4M75 D;  1VQ9 T;  2KT1 A;  3CCE Q;  3I56 A;  2Y4Y A;  2KMT A;  4BY6 C;  2DNU A;  2DEQ A;  1B07 A;  2GFU A;  1YIJ T;  1HD3 A;  3PFS A;  1YCY A;  2B86 A;  3WVE B;  1UEC A;  1U3O A;  5AYF A;  2LCS A;  4M7A A;  1DJ7 B;  2KY9 A;  4C92 E;  2WSC E;  2G3R A;  4EMK C;  2IG0 A;  1FMK A;  4TVR A;  3VS4 A;  1GXI E;  3QYH B;  2MAM A;  4WF2 A;  1AEY A;  4M4Z A;  3CD6 Q;  2JJ9 A;  3GNF B;  4J9F A;  1LPL A;  2RNA A;  5KYU A;  1KD1 R;  1VQP A;  2XDB A;  1M27 C;  1VIF A;  2RQV A;  3EGU A;  2AZV A;  2DD5 A;  1X6G A;  2ZPI B;  2MWO A;  2KNB B;  1ZUY A;  5CKB A;  2RI2 A;  4M75 B;  1ZUU A;  1HK9 A;  1Q82 C;  1OV3 A;  1WI7 A;  3JB9 H;  2RQR A;  2FPF A;  1AOJ A;  1NLP C;  3QII A;  2FRY A;  3A1P A;  4OGC A;  2DM1 A;  1MUZ A;  2F1L A;  3MET A;  3GIB A;  1D0Z A;  1WZO A;  5D7U A;  2HKN A;  1VQO A;  1IHW A;  1QVG P;  4M7D F;  4JDS A;  1VQM Q;  4ZN1 A;  5KYY B;  5KE3 A;  1Q81 U;  1VQ7 Q;  3A8L B;  2HNI A;  4A4K A;  3G1J A;  1G83 A;  2MF2 A;  4PJO F;  3OSS C;  3H0I A;  4IUR A;  2EGE A;  3S3O A;  2OTL Q;  2K3X A;  1MGQ A;  4IUP A;  5KYW B;  4XU3 A;  4E7S A;  3CCE A;  4E2F B;  5DY9 A;  2M0Y A;  1VQK T;  4AT1 B;  3M55 A;  1Q7Y C;  2RHU A;  2QK0 A;  2Y90 A;  3OYD A;  4JUV A;  3RR6 A;  2JM8 A;  3KBG A;  3OS1 A;  3X25 B;  7AT1 B;  3PT9 A;  4B9W A;  2K4Y A;  1H64 1;  1WQW A;  1QVF A;  3HRS A;  4GLK A;  4M7D D;  3ASK A;  5FRO A;  1IZ6 A;  1QKW A;  5GMK h;  2W0Z A;  4RG2 A;  3TU4 K;  3CD6 A;  2XI9 A;  4D6W A;  3PE0 A;  4RKU E;  4M78 A;  4IUV A;  2EQU A;  1K9M C;  4II1 A;  3PVL A;  1FMW A;  1I0C A;  2QYZ A;  5CKD A;  5LJ5 j;  4F7U E;  3HPW A;  5GAM j;  4E6R A;  2FYK A;  4NOY A;  3EFO A;  2HMA A;  1WGS A;  3OYM A;  4HA8 A;  1Q95 G;  2WSE E;  3JCM X;  1VQ9 Q;  4KBM B;  1C0M A;  3QWX X;  1QQJ A;  1AWX A;  4FM4 B;  1GL5 A;  1M4Z A;  3OBY A;  4M75 G;  3L2W A;  3DKM A;  4LN2 A;  1UDL A;  1QVF S;  3PIP A;  2DVE A;  5GAO p;  2RB6 A;  1YIJ Q;  2NWM A;  2RA2 A;  2CP7 A;  3TSZ A;  1JQQ A;  1M5Q 1;  1QP2 A;  3TEE A;  4KH0 B;  4FW2 A;  1VQ7 A;  1U8R A;  4M7A B;  3ZEH A;  2PVD B;  2GNC A;  1WYX A;  1RAB B;  5IHI A;  1QVP A;  2HCK A;  2OTL A;  1PNJ A;  1JEG A;  1CKB A;  3R6N A;  2DET A;  4J6W A;  1X6O A;  4J8O A;  5GAN 5;  2LC4 A;  5LJ5 g;  3IQL A;  1G3W A;  5GAM g;  4F04 B;  1PM3 A;  2JS2 A;  2MCN A;  4ATO A;  3OW2 P;  2DL7 A;  2D6F A;  2EQI A;  4PK4 A;  1NPR A;  3DLL A;  3M0U A;  3G71 Q;  1H3H A;  1X27 A;  3GBQ A;  5KCH A;  3CBM A;  4C92 C;  2OJ2 A;  1BI2 A;  1F1B B;  4JRQ A;  1QLY A;  2KYB A;  1D3B B;  5D6W A;  4PJJ A;  4BE2 A;  3UPU A;  2QEX T;  2EIF A;  4AFU C;  1X69 A;  3INZ A;  1G3S A;  4DQ2 A;  3QHS A;  1K8A U;  4JJB A;  3P8D A;  4JS5 A;  1OX9 A;  4A54 A;  3M0S A;  4J9I A;  1RI0 A;  4RTZ A;  3I9Q A;  1ZSZ A;  5I21 A;  1VQ9 A;  5LJ3 d;  3OS5 A;  5GAO m;  2QAZ A;  1VQK Q;  2HEQ A;  1E6G A;  2JOY A;  4OMP A;  2QA4 T;  1AWO A;  1Y0M A;  2KYM A;  3TQ7 P;  1O75 A;  1YIJ A;  4NL3 A;  2RD1 A;  2BZ8 A;  1N8R C;  1NBE B;  2O2O A;  2FVU A;  1KHC A;  2KRM A;  3PMI A;  4EIK A;  4L5G A;  1BI3 A;  1ABO A;  1OPL A;  5CAI A;  2FZC B;  1N27 A;  3QYG B;  3THK A;  1W4S A;  4M7D G;  2KEA A;  4WCI A;  4QVC A;  3MEA A;  2YT6 A;  2K5I A;  5CK9 A;  4XU1 A;  1ZBJ A;  3RKW A;  4PJO G;  4RTY A;  2BKD N;  5J26 A;  2EYW A;  4E7H A;  2HQH A;  2DBM A;  1YJW T;  4KUD K;  2K79 A;  3CCV Q;  3NFC A;  2QQA A;  3EFO B;  1RLP C;  1PD1 A;  4ZTF A;  1JJ2 P;  2OAU A;  2E6N A;  1YJN Q;  3G71 A;  2ZPE B;  4XTV A;  2LVM A;  3PIO A;  4CI0 C;  2RQW A;  4JZ3 A;  4ZGD B;  1W6X A;  5CKF A;  4BDZ A;  4DEY A;  3SD4 A;  3QG1 A;  3BDU A;  2P4R A;  3JCM g;  4E7J A;  3OYC A;  4FSX A;  3EG2 A;  2DXT A;  2DTO A;  3JCM Q;  2RQT A;  1WHM A;  2MYS A;  1YN8 A;  2HQE A;  4FT2 A;  1ZA1 B;  2AK5 A;  1FX7 A;  3KUF A;  5A2Q E;  8AT1 B;  4IIM A;  4NS5 A;  1IRE B;  4KGZ B;  4ELY C;  3VYG A;  3JCM J;  1SHG A;  4BE0 A;  1Y07 A;  3J81 E;  4CC7 A;  2DBK A;  3CCS Q;  1VQK A;  1V1C A;  1Q81 R;  4HCC A;  4IKF A;  3L2R A;  1KC8 C;  3CCU T;  2DFU A;  4Q5W A;  2C0T A;  3VKI A;  3P8B B;  2V1Q A;  4X9D A;  4QVZ A;  3AT1 B;  2CDT A;  2FZK B;  1FXX A;  3OS0 A;  1M90 C;  2KT8 A;  5DM7 R;  1SKU B;  2MI6 A;  5IT9 E;  3OSV A;  3JCM c;  2CUB A;  4DEX A;  3BY7 A;  5LJ3 e;  3LYI A;  2J6K A;  4GY5 A;  2D0N A;  1MV3 A;  3GPL A;  1B34 A;  3ZBD A;  2CRE A;  3M54 A;  5GAN j;  2D1X A;  3CCV A;  2X9H A;  1G5V A;  3H0F A;  1ZSZ B;  1YJ9 T;  1YJN A;  1EIF A;  2O9V A;  5IH2 A;  4M7A E;  1ZA2 B;  4OB0 B;  3UF4 A;  1YFN A;  3C12 A;  3UDC A;  2DKG A;  3JCM W;  2EQM A;  2EYQ A;  2VGN A;  1RAA B;  2M9U A;  3NTI A;  1WX6 A;  3WXM B;  2DTH A;  4QW2 A;  1NJI C;  1UHF A;  1LCK A;  3JSC A;  2ED0 A;  3VS2 A;  3VS1 A;  2I2L A;  1WJR A;  2V1R A;  4JS4 A;  4A63 B;  2HSP A;  2QGG A;  3OYJ A;  5GJV B;  2DL4 A;  4AG2 C;  1SRM A;  2CH4 W;  4OML A;  5LJ3 f;  4IIO A;  3CCJ Q;  3FIF A;  4QQD A;  2A28 A;  2XDD A;  3H6Z A;  2C06 A;  1G8X A;  1UFF A;  2QQ9 A;  1U06 A;  5GAN g;  3CCS A;  1KQS P;  4M75 A;  3VRZ A;  2BZX A;  2RI3 A;  2CH4 A;  2D0Q B;  2F2V A;  2CP0 A;  2QDY B;  2BTT A;  2LMJ A;  4ZN3 A;  1M3B A;  1MMD A;  1YJW Q;  2ENM A;  1XNI A;  1N9S A;  4BI8 B;  2GTJ A;  5LJ5 h;  1PHT A;  2HBW A;  5GAM h;  1KQ2 A;  1UGV A;  1JB0 E;  1MHN A;  5D6Y A;  2EYZ A;  3E9F A;  2J05 A;  2RI5 A;  2L0A A;  1VQ7 T;  1M3A A;  4UC4 A;  1Q86 R;  4JLG A;  4IUT A;  2EAY A;  1MNE A;  4KGX B;  1X6B A;  3QUI A;  2F5K A;  1U1S A;  5KYW A;  3M0T A;  3REB B;  3A98 A;  4HVV A;  2A36 A;  4AFZ C;  2R57 A;  1Y71 A;  3MP1 A;  2HAX A;  4KUL A;  1TUG B;  2V8I A;  3VRY A;  5CVI A;  3OYL A;  2LJ3 A;  2JMA A;  3OYI A;  2E1H A;  5FU6 B;  1RLQ C;  2XU8 A;  3ME9 A;  1PKT A;  2DD4 A;  1PKS A;  1K8A R;  5L8R E;  5FRN A;  3GLX A;  3NPF A;  2DVJ A;  3CCU Q;  3X28 B;  4M78 E;  4M77 F;  2NUZ A;  1XOV A;  2KK4 A;  2WSF E;  5I2M A;  2DYB A;  2RHI A;  1V29 B;  4KT0 E;  4HXJ A;  3M9Q A;  2LP5 A;  2P4T A;  3GOX A;  4BB7 A;  3CCJ A;  2ZPH B;  3O8V A;  1I5L A;  2V26 A;  2ZGW A;  1VOM A;  2SEM A;  4MML A;  3M56 A;  1B34 B;  1BCM A;  2YRD A;  1VQ6 Q;  3EH1 A;  5GAO r;  1YJW A;  2VGM A;  3OYG A;  3RKX A;  1OOT A;  1KSW A;  2RPN A;  1YJ9 Q;  4M77 D;  3BFM A;  1E6H A;  2RJC A;  1GCP A;  3JB9 F;  3A8O B;  1VQ5 Q;  4ORZ A;  3BW1 A;  2HL5 C;  3LW5 E;  1YP5 A;  4Y28 E;  3EFS A;  3QDR B;  2K9G A;  1UGP B;  4M7D A;  2JTE A;  3EH2 A;  1I4K 1;  4XQ3 A;  1YHQ Q;  4C8Q D;  1VUB A;  3EGX B;  1R0C B;  4KUI A;  2EKO A;  2RK1 A;  4PJO A;  2MPX C;  4HVU A;  3UT1 A;  3PVQ A;  1J3T A;  2YRC A;  1LVK A;  4LDX A;  5CKE A;  1XQH A;  4KGV B;  2DXC A;  2X4W A;  2FL7 A;  3D7S B;  4ME7 A;  2K3Y A;  2KE9 A;  3JCM h;  4M7A C;  4LXC A;  3MP6 A;  1VYU A;  1K9M U;  3OMG A;  1PC0 A;  4L59 A;  3G71 T;  4PJM A;  3QJ6 A;  4OB3 B;  3RUX A;  5GMK e;  1SG5 A;  3CCU A;  3M57 A;  3FJP A;  3JB9 D;  4OB2 B;  1G2B A;  1WXT A;  2KGT A;  1GCQ A;  2PU9 B;  3OB9 A;  5HK3 A;  3VS5 A;  2R58 A;  2ESW A;  5FU7 C;  3V8L A;  2CT4 A;  1D3B A;  1OYX A;  1MV0 B;  3L42 A;  2RHX A;  1NG2 A;  1AVZ C;  4C8Q B; 
#chains in the Genus database with same CATH homology
 4EMG A;  1BIA A;  3CBM A;  4MZT A;  4QVD A;  4C92 C;  2XG8 D;  4C92 B;  1UEB A;  1BI2 A;  5GAO l;  3I55 A;  1M1G A;  5GMK j;  4E7K A;  3HSB A;  1M1K C;  2BUD A;  4PLI A;  1VQ4 T;  2CZ1 B;  2RJF A;  5KH6 A;  3OYF A;  3CXC S;  2H3J A;  3G7Z A;  2K2V A;  4JRQ A;  4XTU A;  4Y91 A;  5J39 A;  1Y96 A;  1VQ6 A;  1D3B B;  4XTW A;  2CZ0 B;  3M58 A;  5CIU A;  2X35 A;  2K5F A;  2MMP A;  5D6W A;  5GAN d;  3JAM E;  4CRI A;  4BE2 A;  3UPU A;  5GMK m;  2QEX T;  4M7A F;  1BI0 A;  2EIF A;  1Q82 U;  4Z02 A;  3INZ A;  1G3S A;  2QQR A;  3QHS A;  4DQ2 A;  1K8A U;  3P8D A;  1YJ9 A;  3V7R A;  4M75 F;  4JS5 A;  1ZHI A;  5GAN 3;  2YRV A;  1VQO T;  3L1A A;  4A54 A;  1I8F A;  2KVQ G;  3JCM e;  2CGH A;  2LCL A;  1RI0 A;  1VQ5 A;  5I21 A;  4HCB A;  4YTL A;  1VQ9 A;  4LD6 A;  5LJ3 d;  3OQ5 A;  3OS5 A;  2LTO A;  5GAN 6;  4R55 A;  3L2V A;  1YHQ A;  5GAO m;  1N9R A;  2DTI A;  2QI2 A;  3OA6 A;  2XD0 A;  2DZ9 A;  3JRZ A;  3LH0 A;  2YLC A;  2X4J A;  1R8O B;  2YLB A;  4HCZ A;  2JOY A;  5CO7 A;  2QA4 T;  3CCE T;  3NTK A;  4JRP A;  1BI1 A;  2CS7 A;  3HL8 A;  4V2S A;  2KQW A;  1SSF A;  2PUK B;  4MDW A;  3WVD B;  3TCJ A;  3JB9 I;  3GP8 A;  2DZC A;  4PJO D;  4J6X A;  1KQ1 A;  4M78 G;  1O75 A;  1YIJ A;  4NL3 A;  2RD1 A;  2V8J A;  2WAC A;  1N8R C;  1NE8 A;  1M1F A;  2FVU A;  1KHC A;  2O4X A;  1RL2 A;  3PMI A;  2OTJ T;  3G6E A;  1X01 A;  2DPP B;  4L5G A;  3X26 B;  1BI3 A;  1UB4 A;  3HRT A;  2L89 A;  5CAI A;  3CCV T;  2CZ6 B;  2F5T X;  2FHD A;  3M5A A;  1N27 A;  3QYG B;  3R6O A;  4A4H A;  3MCA B;  1W4S A;  5HK0 A;  1YJN T;  4MMK A;  4C5H A;  2ZPF B;  1Q7Y U;  2PVO B;  2EJ9 A;  2XIC A;  4FL6 A;  5IN1 A;  4A4G A;  3CC4 A;  3OMC A;  1OZ2 A;  3SWN A;  4M7D G;  5C0M A;  4QVC A;  4M78 C;  3MEA A;  3QO3 A;  3OYB A;  1U1T A;  2K5I A;  5HY6 A;  2RK2 A;  4EMK A;  4XU1 A;  5CK9 A;  2VUB A;  4J7I A;  4C0D B;  4C0D C;  3CD6 T;  3OYA A;  3RKW A;  3V7C A;  4JJN K;  3QSU A;  3JCM f;  4PJO G;  1H3Z A;  5J26 A;  2BKD N;  4E7H A;  3GF5 A;  3KXT A;  2JTF A;  3C4S A;  4QQG A;  3RIR A;  5GAN h;  3L2U A;  5KE2 A;  4PKC C;  3DLM A;  4LDW A;  1YJW T;  2XHC A;  3E19 A;  4KUD K;  1YIT T;  3NFC A;  2QQA A;  3M53 A;  3MEV A;  4ZTF A;  3Q1J A;  2OAU A;  3PMT A;  2E6N A;  1KQS A;  3GNG A;  2L8D A;  2LQK A;  3TRE A;  4M77 G;  2ZPE B;  4A4E A;  4F7U G;  3G71 A;  3CCL T;  1WNL A;  3SWN C;  3SWN B;  3OYK A;  2QTX A;  4XTV A;  4M7D C;  3BDL A;  4M7D B;  4BUG A;  3CC2 T;  1UGS B;  2LVM A;  2D9T A;  2V8K A;  4N4G A;  4XU0 A;  2R5A A;  4EMK B;  4CI0 C;  3PIO A;  3FLG A;  3EAE A;  4ZGD B;  5KCO A;  4ELZ C;  5CQX A;  4XAX B;  5LJ3 h;  2JZ2 A;  3A5Z B;  5CKF A;  4PJO B;  4PJO C;  2LCC A;  4BDZ A;  3SDZ A;  2LRQ A;  3SD4 A;  3QG1 A;  4C8Q G;  4OVA A;  3FC3 A;  3M4Y A;  1P92 A;  4OMF B;  5GAO n;  3BDU A;  3JCM g;  4E7J A;  4IUU A;  3H8Z A;  4FSX A;  4N4I A;  3OYC A;  3CCS T;  2DXT A;  3CMA T;  2DTO A;  3MP8 A;  2O01 E;  2YHT A;  2K57 A;  3CBP A;  3JCM Q;  2OTJ A;  2KAF A;  5CQY A;  4M77 C;  4M77 B;  3VU3 C;  4F7U B;  4RCB A;  3HFO A;  3FDR A;  2CYZ B;  2E5Q A;  3DB3 A;  3UWN A;  3L2Q A;  2HQE A;  4FT2 A;  1Q86 U;  1FX7 A;  3KUF A;  5A2Q E;  1M8V A;  4J83 A;  2X4Y A;  3QJY A;  4IUQ A;  4NS5 A;  1VQM T;  1VQ8 A;  4LD9 K;  1IRE B;  1VQ4 A;  1OI1 A;  3P8H A;  4M78 F;  4ELY C;  3VYG A;  3JCM J;  4JLI A;  4X9C A;  2LQ8 A;  1WPY A;  1NPP A;  4C8Q C;  3LWI A;  4BE0 A;  1Y07 A;  3J81 E;  4ZTJ A;  2E65 A;  2LDM A;  3CC7 T;  3G4S A;  1BIB A;  4LDV A;  3VUZ A;  4OF1 A;  2P0Q A;  1JRI A;  2RHY A;  1KQS S;  3SFM A;  2OTL T;  3QBY A;  4XTX A;  4PL6 A;  1VQK A;  2QEX A;  2LT4 A;  3OYN A;  5DLQ E;  1QVG A;  4HCC A;  1YI2 T;  3L2R A;  4IKF A;  3VJP A;  3JB9 G;  2DIQ A;  3CCU T;  1KC8 C;  1QW1 A;  4ZGJ B;  4Q5W A;  2GCX A;  2BIV A;  2HBP A;  5A0G A;  3SB2 A;  3VKI A;  3P8B B;  4E7I A;  3URG A;  3NTH A;  5M9O A;  2KSS A;  1VIE A;  5GAN e;  2NLU A;  2VC8 A;  4N4H A;  5CR2 A;  4C0G A;  2LNV A;  3FB9 A;  1WJS A;  4X9D A;  2Y4X A;  3MHX A;  4QQ6 A;  2DO3 A;  4QVZ A;  4E7L A;  3CME T;  3RMS A;  3VV0 A;  4B9X A;  1FXX A;  1VQL A;  4MZM A;  3QKJ A;  2QA4 A;  3OS0 A;  3OS2 A;  3PGG A;  1M90 C;  4J7F A;  5DM7 R;  2QXF A;  2MI6 A;  4A53 A;  5IT9 E;  3OSV A;  2CZ7 B;  3JCM c;  1LNX A;  2HD0 A;  1Y96 B;  4O6J A;  5LJ3 e;  3BY7 A;  5I2S A;  3LYI A;  2XDP A;  1YBY A;  4FU6 A;  2R5M A;  4GY5 A;  3GPL A;  1BKB A;  1K73 C;  3CBO A;  1B34 A;  3RES A;  3ZBD A;  3M54 A;  5GAN j;  2RJE A;  1G3Y A;  3X20 B;  2E12 A;  2DK3 A;  2DJZ A;  3M59 A;  3CCR A;  2CKK A;  5LJ5 d;  2RH2 A;  3CCV A;  1M1K U;  1KG1 A;  5GAM d;  4C8Q F;  1G5V A;  4DOV A;  3CCM T;  1QVG S;  1YJ9 T;  4C92 F;  1YJN A;  1EIF A;  3FRN A;  1KC8 U;  2GFA A;  4M7A E;  4OB0 B;  3OYE A;  4M7A D;  4BE1 A;  3C12 A;  1BYM A;  3S3M A;  3UDC A;  2DKG A;  5LJ3 j;  4M75 E;  2EQM A;  3JCM W;  3V8J A;  4MDX A;  2PVG B;  3CCQ T;  2EYQ A;  2JNG A;  4M75 D;  2VGN A;  4PNO A;  1VQ9 T;  3I56 A;  3CCJ T;  2Y4Y A;  1VQN T;  2KMT A;  5GAN f;  2M9U A;  3NTI A;  3WXM B;  4BY6 C;  4BY6 B;  2DTH A;  4QW2 A;  5FRM A;  1NJI C;  1TH7 A;  2ZCF B;  3JSC A;  3HFN A;  2DEQ A;  1ZBX A;  2I2L A;  1WJR A;  1M90 U;  3QZ5 B;  2O4X B;  4JS4 A;  3CCL A;  2GFU A;  1YIJ T;  3PFS A;  3CC2 A;  3OYJ A;  1YCY A;  5IAY A;  3A8M B;  5LJ3 f;  3WVE B;  1K73 U;  2L5Q A;  5AYF A;  5J3B A;  3V7S A;  3G6E T;  3FIF A;  4N0A A;  4QQD A;  4M7A A;  2XDD A;  1DJ7 B;  2KY9 A;  4C92 E;  3E1S A;  4L6V 5;  2M16 A;  2WSC E;  3H6Z A;  2G3R A;  4P5N A;  4EMK C;  2IG0 A;  4TVR A;  2QQ9 A;  2C06 A;  4C92 D;  5GAN g;  3CCS A;  4M75 A;  3QYH B;  4XU2 A;  2FB7 A;  2MAM A;  1N8R U;  2D0Q B;  2RI3 A;  2K5L A;  4WF2 A;  4C0Z A;  2EWN A;  2VXE A;  4XK8 E;  2QDY B;  1KHI A;  4E47 A;  3CC4 T;  2GQV A;  1JJ2 A;  3GNF B;  1FWZ A;  4J6Y A;  4ZN3 A;  5C6S A;  1Q81 C;  4JRI A;  2VYT A;  1VQP A;  4BAC A;  2XDB A;  3QXE B;  1VIF A;  3A8H B;  1M9S A;  1XNI A;  3MO8 A;  5DLO A;  1WJQ A;  3MEU A;  2DAQ A;  1N9S A;  2M1H A;  1VQM A;  2F69 A;  4BI8 B;  1HXD A;  2DD5 A;  2L3R A;  1W2B A;  1WQ7 A;  5LJ5 h;  5LJ3 g;  2RM4 A;  2ZPI B;  3X24 B;  5GAM h;  1KQ2 A;  2LT1 A;  2XID A;  2MWO A;  1GXI E;  3CC7 A;  2EJG A;  5CKB A;  2RI2 A;  1JB0 E;  4M75 B;  3V8K A;  1MHN A;  5D6Y A;  1HK9 A;  1Q82 C;  3LGL A;  3E9F A;  5FLX E;  1K8A C;  2RI5 A;  3JB9 H;  1VQ7 T;  4UC4 A;  3A8G B;  4C5G A;  1YI2 A;  3QPH A;  5EG2 A;  3OW2 A;  4BI4 A;  4JLG A;  4C92 A;  4EDU A;  3QII A;  4IUT A;  1N6A A;  2EJF A;  2EAY A;  3CEY A;  2IVW A;  3OYY A;  4OGC A;  3QUI A;  2F5K A;  1U1S A;  3MET A;  1UGR B;  3EFR A;  1S72 T;  4O5V A;  3GIB A;  4RCC A;  5FU7 B;  1VQO A;  2R57 A;  3HHT B;  1Y71 A;  1LJO A;  3MP1 A;  1JJ2 S;  4KUL A;  5A0L A;  3OYH A;  2HAX A;  4M7D F;  4JDS A;  2V8I A;  3ZFJ A;  5CVI A;  4ZN1 A;  3OYL A;  5KE3 A;  4R56 A;  1Q81 U;  3A8L B;  2HNI A;  4LDU A;  3OYI A;  4A4K A;  3S6W A;  2E1H A;  5FU6 C;  2MF2 A;  5FU6 B;  2XU8 A;  3ME9 A;  4PJO F;  3OSS C;  2VXF A;  1VQ8 T;  2DD4 A;  4IUR A;  2E41 A;  4EPC A;  2QQS A;  3S3O A;  5LL6 S;  2B8A A;  1MGQ A;  2K3X A;  2MWP A;  4IUP A;  5A0D A;  5L8R E;  3OY9 A;  1W2B S;  5FRN A;  4XU3 A;  4J5Y A;  3CCE A;  2JVV A;  4BI3 A;  1NZ9 A;  3GLX A;  3G4S T;  3I55 T;  1AHJ B;  2A3L A;  3X28 B;  4M78 E;  5DY9 A;  4HT9 A;  4M77 F;  1OZ3 A;  4M78 D;  4F7U F;  1VQK T;  1XOV A;  2KK4 A;  2WSF E;  2ZPG B;  5I2M A;  5GAN 2;  3M55 A;  3CCM A;  2E10 A;  2RHI A;  1Q7Y C;  3OW2 S;  5GAN 8;  1V29 B;  2RHU A;  1VQ6 T;  4KT0 E;  2Y90 A;  3JCM d;  3OYD A;  4JUV A;  3KBG A;  2ZZD A;  2E64 A;  3OS1 A;  1PSE A;  3M9Q A;  3X25 B;  2P4T A;  5LJ5 e;  5GAM e;  3GOX A;  3PT9 A;  4B9W A;  3CCQ A;  2RJD A;  4BB7 A;  1VQN A;  3N5B B;  3J7A F;  2K4Y A;  2ZPH B;  3CCJ A;  4M7D E;  1H64 1;  1WQW A;  4C0F A;  1QVF A;  1X75 C;  3HRS A;  3S3N A;  1ZQ1 A;  4EMH A;  4GLK A;  3CPW A;  3O8V A;  4LDY A;  4M7D D;  3ASK A;  5FRO A;  1IZ6 A;  2ZGW A;  1I5L A;  1VQL T;  3AHU A;  5GMK h;  3C94 A;  4MML A;  4RG2 A;  1VQ5 T;  3M56 A;  4OP0 A;  3TU4 K;  5GAN 7;  1B34 B;  3CD6 A;  4PJO E;  2XI9 A;  4D6W A;  3VUB A;  2P0K A;  2DIG A;  4FT4 A;  4RKU E;  2GF7 A;  4M78 A;  1YHQ T;  1KD1 C;  4IUV A;  2EQU A;  2KDS A;  3E9G A;  5GMK i;  5GAO r;  1K9M C;  4II1 A;  1YJW A;  3M4G A;  2VGM A;  1G3T A;  1YIT A;  3OYG A;  4BDY A;  4JRK A;  3FEO A;  2P0P A;  4FIB A;  3RKX A;  5CKD A;  4C5I A;  4M77 E;  5LJ5 j;  4F7U E;  3HPW A;  4RG8 A;  3DB4 A;  5GAM j;  4M77 D;  4DA4 A;  3BFM A;  3CCR T;  2PUO B;  3JB9 J;  2FYK A;  4ZGE B;  2RJC A;  4NOY A;  2LX9 A;  1UGQ B;  3JCM P;  5GAO q;  3JB9 F;  4PLL A;  4C5E A;  1WGS A;  3A8O B;  5CCA A;  3OYM A;  4HA8 A;  4A4F A;  3BW1 A;  3HKS A;  3LW5 E;  2WSE E;  4Y28 E;  3EFS A;  3JCM X;  4NL2 A;  3QDR B;  4KBM B;  3JCM b;  1UGP B;  4M7D A;  4C8Q E;  1PSF A;  3MEW A;  2HQX A;  4FM4 B;  4M7A G;  1I4K 1;  1M4Z A;  4M78 B;  1Q86 C;  4XQ3 A;  4C8Q D;  1VUB A;  1XTD A;  4VUB A;  4RMO A;  2EQJ A;  3CPF A;  3OBY A;  4M75 G;  3L2W A;  2M0O A;  3C95 A;  3PTA A;  1O9S A;  1JBM A;  2EKO A;  2RK1 A;  4KUI A;  3I56 T;  2RO0 A;  3DKM A;  4PJO A;  3UT1 A;  2AHJ B;  3F70 A;  1QVF S;  5LJ5 f;  2RHZ A;  3PIP A;  3CPW S;  2DVE A;  3T9N A;  5GAM f;  2E6Z A;  5GAO p;  2RB6 A;  2EQK A;  4LDX A;  5CKE A;  3HP9 A;  3LWH A;  3RKY A;  1XQH A;  4XTZ A;  2PQW A;  3OBW A;  5CKH A;  2DXC A;  2X4W A;  2RA2 A;  2FL7 A;  2DXB A;  2JN0 A;  3L2Z A;  4ME7 A;  2K3Y A;  1M5Q 1;  1QP2 A;  4M77 A;  3JCM h;  3JCM V;  3TEE A;  4DOW A;  2XKO C;  4N0A C;  2JTM A;  4F7U A;  5GAN 4;  3CXC A;  3RER A;  1VQ7 A;  1U8R A;  2EFI A;  4M7A B;  4M7A C;  3ZEH A;  1NJI U;  3ER0 A;  2PVD B;  3MP6 A;  1KD1 U;  3LLR A;  5D6X A;  1K9M U;  3OMG A;  4M75 C;  4HT8 A;  2QQB A;  3VYH B;  4L59 A;  1QVP A;  2ZPB B;  2XK0 A;  3G71 T;  2OTL A;  3LX7 A;  3QZ9 B;  3QJ6 A;  3PNW C;  4OB3 B;  3RUX A;  4C8Q A;  3RMQ A;  1QP3 A;  3HRU A;  4J6W A;  1X6O A;  2VV5 A;  5GMK e;  1S72 A;  1I81 A;  4X34 A;  4C92 G;  3M57 A;  3FJP A;  4J8O A;  3CCU A;  3JB9 D;  4OB2 B;  1LOJ A;  1Y7X A;  2LC4 A;  5LJ5 g;  5GAN 5;  4HKE A;  5GMK l;  1G3W A;  5GAM g;  2X4X A;  2PU9 B;  4OGE A;  2E70 A;  3CMA A;  3OB9 A;  5HKC A;  5HK3 A;  4ATO A;  3LGF A;  1VQP T;  2D6F A;  2R58 A;  2A7Y A;  5FU7 C;  3V8L A;  3J80 E;  4MZP A;  1D3B A;  3CME A;  2DXU A;  1OYX A;  1NPR A;  3DLL A;  3L42 A;  2RHX A;  4OB1 B;  4XTY A;  4C8Q B;  2JUF A;  5KCH A;  4BD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...