1H7VA

Rubredoxin from guillardia theta
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
MEIDEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a zinc substituted eukaryotic rubredoxin from the cryptomonad alga Guillardia theta.
pubmed doi rcsb
molecule keywords RUBREDOXIN
molecule tags Electron transport
source organism Guillardia theta
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1h7vA00
1SMMA 3KYUA 1FHMA 1YUXA 2V3BB 5RXNA 1LKMA 2PYAA 2KKDA 1CADA 1RB9A 2K2DA 1T9QA 1YK4A 1H7VA 1NNQA 1RYTA 4AR4A 1RDVA 3KYWA 5IY0A 1IROA 1YK5A 1R0HA 1QCVA 1BRFA 1T9OA 4POGA 1C09A 1LTLA 7RXNA 1LKOA 6RXNA 2PVEA 3QVDA 4ME3A 1E8JA 3RZTA 4K9FA 1VCXA 3RYGA 3PWFA 3SS2A 2GMGA 1R0IA 1RDGA 4AR3A 2HR5A 3KYYA 1IU6A 3KYXA 1SMUA 1R0FA 1IU5A 2DSXA 2LCQA 4AR5A 1SMWA 1R0GA 1DX8A 1FHHA 4TPUA 2KN9A 1CAAA 1T9PA 1B2JA 1ZRPA 4RXNA 1YV1A 2QL0A 2PVXA 1BE7A 5AI3A 2MS3A 2RDVA 3MPSA 1DVBA 1BQ9A 1B71A 1BFYA 8RXNA 1S2ZA 2M4YA 1LKPA 1RWDA 1B2OA 2VL6A 1R0JA 3PZAA 1B13A 1QYBA 1IRNA 1S30A 4AR6A 3RZ6A 1BQ8A 4POFA 3KYVA 1YUZA 1S24A 1JYBA 3A44A 5AI2A 4YWLA 4YWMA
chains in the Genus database with same CATH superfamily
4JAGA 3VPBE 3KYUA 2YU9L 1PFVA 1TWAL 3LNLA 2V3BB 2JI1A 2PYAA 3PKIA 4JADA 5IYBL 1RB9A 3H99A 1T9QA 1TWHL 1YK4A 3HOUL 3H9CA 5MLC3 3RZDL 4A3GL 4BY1L 3K35A 4WFN1 2CKCA 1NXGA 1R0HA 2JA5L 1PFYA 2XJSA 7RXNA 2XJUA 6RXNA 4U671 1VCXA 1R0IA 1I3QL 4BXXL 1IU6A 3KYYA 2R93L 3KYXA 3RZOL 1NXEA 1DX8A 5DM61 2CKAA 4C2M1 3H3VM 3NFPI 3S1QL 5FJ8L 1I50L 3P8BA 2ERSA 1BE7A 2H12A 2L0ZA 3MSUA 1B71A 5M3ML 1S2ZA 1LKPA 2XJVA 5M5WL 1RWDA 4E6YA 5AN9H 5MGNA 3GTLL 1Z92B 4Y7NL 3RZ6A 4A3BL 4AI2A 1WJVA 4POFA 1YUZA 1PFWA 3ZG6A 5IP9L 5GAEc 5MFPA 2V0EA 4LHLA 3J7Z1 3GTJL 3HOYL 2C6AA 3HJYB 1IW7D 4XGHA 1F4LA 2PMZP 5GAHc 1CADA 2R7ZL 3S1NL 5EINC 3JR7A 3MQKB 1WCML 1RYTA 5K2ME 4ZN1B 1K83L 2WAQP 2C6BA 5GAGc 5IYDL 4C3IL 1QCVA 2PVEA 3QVDA 3IU3I 4A3IL 1E8JA 4K9FA 3PWFA 2JI2A 5IYCL 1ODHA 5DM71 3FDJA 2XJPA 2JA6L 3LPEB 3S16L 2HR5A 2J9UB 3GTML 3S17L 2AQCA 1OWCA 4JAFA 1R0FA 1IU5A 4BY7L 2DSXA 1R0GA 4AHZA 5MF6A 1FHHA 4TPUA 3J7Y1 1B2JA 1ZRPA 3M4OL 4RXNA 4X6AL 3I4NL 4A3FL 5AI3A 2MS3A 2Z3RB 2RDVA 1DVBA 3FKIL 5JVH1 8RXNA 2M4YA 1R9TL 3K7AL 4TVMA 2VL6A 1R0JA 3HOWL 2VUML 4G6BA 1QYBA 2R92L 5C4XL 4AR6A 5H1Sc 4UY81 3CQZL 2XJQA 3I4ML 2NVYL 4ZN3B 2A68D 3PL5A 3P2AA 1SMMA 4Y52L 3GTOL 2HVYC 4AYBP 1FHMA 5RXNA 3GTGL 2EY4E 4AHXA 3PO2L 3B08B 1NNQA 2B63L 2JA8L 4AR4A 3S1ML 5IY0A 1YK5A 1BRFA 3H9BA 1C09A 1LTLA 4B8CD 2A69D 2M6PA 4BBRL 3PIP1 3GTQL 4ME3A 4A3JL 5M5XL 3SS2A 2GMGA 5C4JL 3S14L 1SMUA 1TWCL 2LCQA 4AR5A 2XJTA 2KN9A 5C44L 1PFUA 3PO3L 4A3DL 4A3EL 1SFOL 2ZIXA 3HJWB 2NYDA 3HOXL 4C3JL 3MPSA 4C3HL 3S15L 1BQ9A 3GTPL 2JA7L 1BFYA 1Y1VL 2ERJA 2M6OA 3PZAA 1OWBA 5M3FL 3HKZP 5C3EL 1IRNA 3WWNB 5GADc 2E2IL 1JYBA 3A44A 5AI2A 3H0GL 5IP7L 4YWMA 2AYJA 1TWFL 2AUSB 2PPTA 4AHYA 2E2HL 4GS7D 1YUXA 2XJRA 4A3LL 1LKMA 2KKDA 1P7PA 4V196 3PIO1 3GTKL 2K2DA 3PKJA 3HAXC 2B5ID 2V0FA 1H7VA 3S1RL 1RYQA 1RDVA 3KYWA 2Z3QB 2E2JL 1IROA 5JVG1 4QIWP 1T9OA 4POGA 3H97A 4A93L 4JAEA 4BBSL 1LKOA 2NVTL 2Y0SP 1VZHA 3RZTA 4LHNA 3HOZL 3LWPB 3S2DL 3RYGA 1RDGA 5FLML 4AR3A 2M4VA 3LWVB 4AI1A 1SMWA 3S2HL 1Y1WL 1I6HL 2PSMC 5M5YL 1CAAA 2RFKB 1T9PA 3QQCE 2WB1P 3LWOB 1QQTA 1YV1A 2QL0A 3LWRB 2PVXA 1TWGL 1VZIA 2JI3A 3WWLA 2NVQL 3M3YL 2O5JD 2BE5D 1PZXA 2APOB 1B2OA 1VZGA 4XXBB 4A3CL 4AHWA 1B13A 3B0AB 5EIOC 4A3KL 4AI0A 1S30A 5MFZA 1BQ8A 2A6HD 4AI3A 3KYVA 4A3ML 3LWQB 3HOVL 2CR8A 1S24A 4YWLA 2NVXL 2A6ED
chains in the Genus database with same CATH topology
1SMMA 4JAGA 3VPBE 5MFPA 3KYUA 2V0EA 4LHLA 2PPTA 4AHYA 3J7Z1 3LNLA 4GS7D 1FHMA 1YUXA 2XJRA 2V3BB 2JI1A 5RXNA 2C6AA 1LKMA 2PYAA 3PKIA 1IW7D 2KKDA 4JADA 4V196 4XGHA 3PIO1 5GAHc 1CADA 1RB9A 2K2DA 4AHXA 3PKJA 1T9QA 5EINC 2B5ID 1YK4A 2V0FA 1H7VA 3B08B 1NNQA 5MLC3 1RYTA 3K35A 1RYQA 4AR4A 5K2ME 4WFN1 1RDVA 2CKCA 4ZN1B 3KYWA 2Z3QB 1NXGA 5IY0A 2C6BA 1IROA 1YK5A 5GAGc 5JVG1 1R0HA 1QCVA 1BRFA 1T9OA 4POGA 1C09A 1LTLA 4B8CD 2A69D 2M6PA 3PIP1 2XJSA 7RXNA 2XJUA 4JAEA 1LKOA 6RXNA 4U671 2PVEA 3QVDA 1VZHA 3IU3I 4ME3A 1E8JA 3RZTA 4LHNA 4K9FA 1VCXA 3RYGA 3PWFA 3SS2A 2JI2A 2GMGA 1R0IA 1RDGA 1ODHA 5DM71 2XJPA 4AR3A 3LPEB 2HR5A 2J9UB 1IU6A 2M4VA 3KYYA 4AI1A 1OWCA 4JAFA 3KYXA 1SMUA 1R0FA 1DX8A 1IU5A 1NXEA 2DSXA 2LCQA 1SMWA 1R0GA 4AHZA 4AR5A 2PSMC 5MF6A 1FHHA 5DM61 2XJTA 4TPUA 2CKAA 2KN9A 3J7Y1 1CAAA 1T9PA 3QQCE 1B2JA 3NFPI 1ZRPA 4RXNA 1YV1A 2QL0A 2ZIXA 3P8BA 2NYDA 2ERSA 2PVXA 1BE7A 5AI3A 2MS3A 2Z3RB 2H12A 2RDVA 3MPSA 1DVBA 2L0ZA 1VZIA 1BQ9A 3MSUA 2JI3A 1B71A 3WWLA 1BFYA 5JVH1 2O5JD 8RXNA 1S2ZA 2BE5D 2M4YA 1LKPA 2XJVA 1RWDA 1B2OA 4E6YA 1VZGA 4XXBB 4TVMA 2VL6A 2ERJA 1R0JA 5AN9H 2M6OA 3PZAA 4AHWA 5MGNA 1OWBA 1B13A 3B0AB 5EIOC 4G6BA 1QYBA 4AI0A 1IRNA 1S30A 1Z92B 4AR6A 3RZ6A 5MFZA 1BQ8A 3WWNB 4AI2A 5GADc 5H1Sc 1WJVA 4UY81 4POFA 2A6HD 3P2AA 3KYVA 4AI3A 1YUZA 2CR8A 2XJQA 3ZG6A 1S24A 1JYBA 3A44A 5AI2A 4YWLA 4ZN3B 4YWMA 5GAEc 2A68D 2A6ED 2AYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMM A;  3KYU A;  1FHM A;  1YUX A;  2V3B B;  5RXN A;  1LKM A;  2PYA A;  2KKD A;  1CAD A;  1RB9 A;  2K2D A;  1T9Q A;  1YK4 A;  1H7V A;  1NNQ A;  1RYT A;  4AR4 A;  1RDV A;  3KYW A;  5IY0 A;  1IRO A;  1YK5 A;  1R0H A;  1QCV A;  1BRF A;  1T9O A;  4POG A;  1C09 A;  1LTL A;  7RXN A;  1LKO A;  6RXN A;  2PVE A;  3QVD A;  4ME3 A;  1E8J A;  3RZT A;  4K9F A;  1VCX A;  3RYG A;  3PWF A;  3SS2 A;  2GMG A;  1R0I A;  1RDG A;  4AR3 A;  2HR5 A;  3KYY A;  1IU6 A;  3KYX A;  1SMU A;  1R0F A;  1IU5 A;  2DSX A;  2LCQ A;  4AR5 A;  1SMW A;  1R0G A;  1DX8 A;  1FHH A;  4TPU A;  2KN9 A;  1CAA A;  1T9P A;  1B2J A;  1ZRP A;  4RXN A;  1YV1 A;  2QL0 A;  2PVX A;  1BE7 A;  5AI3 A;  2MS3 A;  2RDV A;  3MPS A;  1DVB A;  1BQ9 A;  1B71 A;  1BFY A;  8RXN A;  1S2Z A;  2M4Y A;  1LKP A;  1RWD A;  1B2O A;  2VL6 A;  1R0J A;  3PZA A;  1B13 A;  1QYB A;  1IRN A;  1S30 A;  4AR6 A;  3RZ6 A;  1BQ8 A;  4POF A;  3KYV A;  1YUZ A;  1S24 A;  1JYB A;  3A44 A;  5AI2 A;  4YWL A;  4YWM A; 
#chains in the Genus database with same CATH topology
 4JAG A;  3VPB E;  3KYU A;  2YU9 L;  1PFV A;  1TWA L;  3LNL A;  2V3B B;  2JI1 A;  2PYA A;  3PKI A;  4JAD A;  5IYB L;  1RB9 A;  3H99 A;  1T9Q A;  1TWH L;  1YK4 A;  3HOU L;  3H9C A;  5MLC 3;  3RZD L;  4A3G L;  4BY1 L;  3K35 A;  4WFN 1;  2CKC A;  1NXG A;  1R0H A;  2JA5 L;  1PFY A;  2XJS A;  7RXN A;  2XJU A;  6RXN A;  4U67 1;  1VCX A;  1R0I A;  1I3Q L;  4BXX L;  1IU6 A;  3KYY A;  2R93 L;  3KYX A;  3RZO L;  1NXE A;  1DX8 A;  5DM6 1;  2CKA A;  4C2M 1;  3H3V M;  3NFP I;  3S1Q L;  5FJ8 L;  1I50 L;  3P8B A;  2ERS A;  1BE7 A;  2H12 A;  2L0Z A;  3MSU A;  1B71 A;  5M3M L;  1S2Z A;  1LKP A;  2XJV A;  5M5W L;  1RWD A;  4E6Y A;  5AN9 H;  5MGN A;  3GTL L;  1Z92 B;  4Y7N L;  3RZ6 A;  4A3B L;  4AI2 A;  1WJV A;  4POF A;  1YUZ A;  1PFW A;  3ZG6 A;  5IP9 L;  5GAE c;  5MFP A;  2V0E A;  4LHL A;  3J7Z 1;  3GTJ L;  3HOY L;  2C6A A;  3HJY B;  1IW7 D;  4XGH A;  1F4L A;  2PMZ P;  5GAH c;  1CAD A;  2R7Z L;  3S1N L;  5EIN C;  3JR7 A;  3MQK B;  1WCM L;  1RYT A;  5K2M E;  4ZN1 B;  1K83 L;  2WAQ P;  2C6B A;  5GAG c;  5IYD L;  4C3I L;  1QCV A;  2PVE A;  3QVD A;  3IU3 I;  4A3I L;  1E8J A;  4K9F A;  3PWF A;  2JI2 A;  5IYC L;  1ODH A;  5DM7 1;  3FDJ A;  2XJP A;  2JA6 L;  3LPE B;  3S16 L;  2HR5 A;  2J9U B;  3GTM L;  3S17 L;  2AQC A;  1OWC A;  4JAF A;  1R0F A;  1IU5 A;  4BY7 L;  2DSX A;  1R0G A;  4AHZ A;  5MF6 A;  1FHH A;  4TPU A;  3J7Y 1;  1B2J A;  1ZRP A;  3M4O L;  4RXN A;  4X6A L;  3I4N L;  4A3F L;  5AI3 A;  2MS3 A;  2Z3R B;  2RDV A;  1DVB A;  3FKI L;  5JVH 1;  8RXN A;  2M4Y A;  1R9T L;  3K7A L;  4TVM A;  2VL6 A;  1R0J A;  3HOW L;  2VUM L;  4G6B A;  1QYB A;  2R92 L;  5C4X L;  4AR6 A;  5H1S c;  4UY8 1;  3CQZ L;  2XJQ A;  3I4M L;  2NVY L;  4ZN3 B;  2A68 D;  3PL5 A;  3P2A A;  1SMM A;  4Y52 L;  3GTO L;  2HVY C;  4AYB P;  1FHM A;  5RXN A;  3GTG L;  2EY4 E;  4AHX A;  3PO2 L;  3B08 B;  1NNQ A;  2B63 L;  2JA8 L;  4AR4 A;  3S1M L;  5IY0 A;  1YK5 A;  1BRF A;  3H9B A;  1C09 A;  1LTL A;  4B8C D;  2A69 D;  2M6P A;  4BBR L;  3PIP 1;  3GTQ L;  4ME3 A;  4A3J L;  5M5X L;  3SS2 A;  2GMG A;  5C4J L;  3S14 L;  1SMU A;  1TWC L;  2LCQ A;  4AR5 A;  2XJT A;  2KN9 A;  5C44 L;  1PFU A;  3PO3 L;  4A3D L;  4A3E L;  1SFO L;  2ZIX A;  3HJW B;  2NYD A;  3HOX L;  4C3J L;  3MPS A;  4C3H L;  3S15 L;  1BQ9 A;  3GTP L;  2JA7 L;  1BFY A;  1Y1V L;  2ERJ A;  2M6O A;  3PZA A;  1OWB A;  5M3F L;  3HKZ P;  5C3E L;  1IRN A;  3WWN B;  5GAD c;  2E2I L;  1JYB A;  3A44 A;  5AI2 A;  3H0G L;  5IP7 L;  4YWM A;  2AYJ A;  1TWF L;  2AUS B;  2PPT A;  4AHY A;  2E2H L;  4GS7 D;  1YUX A;  2XJR A;  4A3L L;  1LKM A;  2KKD A;  1P7P A;  4V19 6;  3PIO 1;  3GTK L;  2K2D A;  3PKJ A;  3HAX C;  2B5I D;  2V0F A;  1H7V A;  3S1R L;  1RYQ A;  1RDV A;  3KYW A;  2Z3Q B;  2E2J L;  1IRO A;  5JVG 1;  4QIW P;  1T9O A;  4POG A;  3H97 A;  4A93 L;  4JAE A;  4BBS L;  1LKO A;  2NVT L;  2Y0S P;  1VZH A;  3RZT A;  4LHN A;  3HOZ L;  3LWP B;  3S2D L;  3RYG A;  1RDG A;  5FLM L;  4AR3 A;  2M4V A;  3LWV B;  4AI1 A;  1SMW A;  3S2H L;  1Y1W L;  1I6H L;  2PSM C;  5M5Y L;  1CAA A;  2RFK B;  1T9P A;  3QQC E;  2WB1 P;  3LWO B;  1QQT A;  1YV1 A;  2QL0 A;  3LWR B;  2PVX A;  1TWG L;  1VZI A;  2JI3 A;  3WWL A;  2NVQ L;  3M3Y L;  2O5J D;  2BE5 D;  1PZX A;  2APO B;  1B2O A;  1VZG A;  4XXB B;  4A3C L;  4AHW A;  1B13 A;  3B0A B;  5EIO C;  4A3K L;  4AI0 A;  1S30 A;  5MFZ A;  1BQ8 A;  2A6H D;  4AI3 A;  3KYV A;  4A3M L;  3LWQ B;  3HOV L;  2CR8 A;  1S24 A;  4YWL A;  2NVX L;  2A6E D; 
#chains in the Genus database with same CATH homology
 1SMM A;  4JAG A;  3VPB E;  5MFP A;  3KYU A;  2V0E A;  4LHL A;  2PPT A;  4AHY A;  3J7Z 1;  3LNL A;  4GS7 D;  1FHM A;  1YUX A;  2XJR A;  2V3B B;  2JI1 A;  5RXN A;  2C6A A;  1LKM A;  2PYA A;  3PKI A;  1IW7 D;  2KKD A;  4JAD A;  4V19 6;  4XGH A;  3PIO 1;  5GAH c;  1CAD A;  1RB9 A;  2K2D A;  4AHX A;  3PKJ A;  1T9Q A;  5EIN C;  2B5I D;  1YK4 A;  2V0F A;  1H7V A;  3B08 B;  1NNQ A;  5MLC 3;  1RYT A;  3K35 A;  1RYQ A;  4AR4 A;  5K2M E;  4WFN 1;  1RDV A;  2CKC A;  4ZN1 B;  3KYW A;  2Z3Q B;  1NXG A;  5IY0 A;  2C6B A;  1IRO A;  1YK5 A;  5GAG c;  5JVG 1;  1R0H A;  1QCV A;  1BRF A;  1T9O A;  4POG A;  1C09 A;  1LTL A;  4B8C D;  2A69 D;  2M6P A;  3PIP 1;  2XJS A;  7RXN A;  2XJU A;  4JAE A;  1LKO A;  6RXN A;  4U67 1;  2PVE A;  3QVD A;  1VZH A;  3IU3 I;  4ME3 A;  1E8J A;  3RZT A;  4LHN A;  4K9F A;  1VCX A;  3RYG A;  3PWF A;  3SS2 A;  2JI2 A;  2GMG A;  1R0I A;  1RDG A;  1ODH A;  5DM7 1;  2XJP A;  4AR3 A;  3LPE B;  2HR5 A;  2J9U B;  1IU6 A;  2M4V A;  3KYY A;  4AI1 A;  1OWC A;  4JAF A;  3KYX A;  1SMU A;  1R0F A;  1DX8 A;  1IU5 A;  1NXE A;  2DSX A;  2LCQ A;  1SMW A;  1R0G A;  4AHZ A;  4AR5 A;  2PSM C;  5MF6 A;  1FHH A;  5DM6 1;  2XJT A;  4TPU A;  2CKA A;  2KN9 A;  3J7Y 1;  1CAA A;  1T9P A;  3QQC E;  1B2J A;  3NFP I;  1ZRP A;  4RXN A;  1YV1 A;  2QL0 A;  2ZIX A;  3P8B A;  2NYD A;  2ERS A;  2PVX A;  1BE7 A;  5AI3 A;  2MS3 A;  2Z3R B;  2H12 A;  2RDV A;  3MPS A;  1DVB A;  2L0Z A;  1VZI A;  1BQ9 A;  3MSU A;  2JI3 A;  1B71 A;  3WWL A;  1BFY A;  5JVH 1;  2O5J D;  8RXN A;  1S2Z A;  2BE5 D;  2M4Y A;  1LKP A;  2XJV A;  1RWD A;  1B2O A;  4E6Y A;  1VZG A;  4XXB B;  4TVM A;  2VL6 A;  2ERJ A;  1R0J A;  5AN9 H;  2M6O A;  3PZA A;  4AHW A;  5MGN A;  1OWB A;  1B13 A;  3B0A B;  5EIO C;  4G6B A;  1QYB A;  4AI0 A;  1IRN A;  1S30 A;  1Z92 B;  4AR6 A;  3RZ6 A;  5MFZ A;  1BQ8 A;  3WWN B;  4AI2 A;  5GAD c;  5H1S c;  1WJV A;  4UY8 1;  4POF A;  2A6H D;  3P2A A;  3KYV A;  4AI3 A;  1YUZ A;  2CR8 A;  2XJQ A;  3ZG6 A;  1S24 A;  1JYB A;  3A44 A;  5AI2 A;  4YWL A;  4ZN3 B;  4YWM A;  5GAE c;  2A68 D;  2A6E D;  2AYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...