1H9CA

Nmr structure of cysteinyl-phosphorylated enzyme iib of the n,n'-diacetylchitobiose specific phosphoenolpyruvate-dependent phosphotransferase system of escherichia coli.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
105
Chain Sequence
MEKKHIYLFSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of Cysteinyl-Phosphorylated Enzyme Iib of the N,N'-Diacetylchitobiose Specific Phosphoenolpyruvate-Dependentphosphotransferase System of Escherichia Coli
pubmed doi rcsb
molecule keywords PTS SYSTEM, CHITOBIOSE-SPECIFIC IIB COMPONENT
molecule tags Transferase
source organism Escherichia coli
total genus 34
structure length 105
sequence length 106
ec nomenclature ec 2.7.1.196: Protein-N(pi)-phosphohistidine--N,N'-diacetylchitobiose
pdb deposition date 2001-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1h9cA00
1GUDA 2MYPA 3MYYA 1ABEA 3BRSA 4WT7A 5BR1A 4UHJA 3N0RA 4KK4A 3UUGA 3K4HA 3Q15C 5T7BA 3QLUC 5JNTA 4LX8A 3CHYA 3BRQA 1SXGA 4WXMA 4EYKA 1D1QA 1ZGGA 5JNUA 3CTPA 1CEYA 2JVIA 3H5TA 4Z4EA 3SG0A 2IPAB 1LBIA 3LUFA 4G0YA 3CZ5A 2OENG 1RZRD 4LDAA 5TE9A 2CD7A 4D6YA 2FQXA 1DP4A 4JASB 2QW1A 3H5OA 4RK4A 2PKXA 2HQRA 1XHFA 1Z17A 4E7OA 2PUBA 1FFWA 2L19A 4ZMRA 1D2AA 2AYZA 3EAFA 5JNSA 3O1JC 4G86A 4LE1A 4W5RA 4H3HB 1L5ZA 1P6UA 2PUCA 3EODA 2WJWA 3MIZA 3HM9A 1S8NA 2JBAA 3CKMA 1NTRA 3I45A 4GPAA 4IRXA 5IC5A 3C6QA 3N75A 4RY0A 5TPZD 5IEBA 4LE2A 4IF4A 4YGXB 3RVSA 3A3KA 4Q6BA 3GBVA 4F11A 3LFTA 1M2EA 4S04A 1SXHA 4KNYA 3HZHA 3MMNA 8ABPA 2A9PA 2QXYA 5F64A 5CNJA 4RSMA 2PE5A 2LP4Y 1ZESA 1HEYA 2IPMA 2JRLA 4RXTA 1P6QA 4MPTA 1R8JA 3CG4A 3S99A 3T8YA 2PUAA 4FE7A 4WXEA 1DBWA 1K68A 1A2OA 2E4WA 2MYUA 4QYMA 3IPCA 4MR9B 3KLNA 4N47A 2QV0A 3CG0A 3C3MA 3HDVA 4QPJC 4Z4HA 3GV0A 2PUDA 4IILA 3OM0A 3QELB 1JFSA 4OBBA 1URPA 4MS4A 1OXKB 4ZMSA 4Z4GA 2LBPA 4D6XA 4TLMB 1JDPA 4MR8B 1MVOA 3O2SB 5CNMA 2RJNA 3KTOA 4OTZA 2M98A 4LDZA 3C3KA 2B4AA 2F8TA 1Z26A 3TB6A 4MQFB 4KREA 2IKSA 4KZKA 1VLZA 3T95A 4KQCA 5JNVA 4JOQA 3QEMB 1RPJA 1T34A 4ZPJA 1LJLA 1U0SY 3EJWA 3RVPA 4OLAA 4N0QA 4TLLB 3R0JA 4IMIB 1MB0A 2R4QA 5KWSA 3D8UA 1BDIA 2MYTA 5KQPA 3H5LA 3Q7RA 2E4ZA 1UDRA 4OATA 1QP0A 4N76A 1J56A 2IYNA 3I42A 2VK2A 1C4WA 2R25B 2MSKA 2RDMA 4NQRA 5TPWA 3A0RB 3QEKA 4OLBA 3RH0A 3GA5A 2FKAA 3O74A 4JB0A 1TLFA 3EQ2A 3KYJB 1A04A 2VYCA 4QYWA 5IBQA 3TD9A 3LUHA 5KC8A 4YR7A 2OQRA 4JA2A 1WETA 5HSGA 1XWWA 3EQZA 4KPYA 1U8TA 4WWHA 3LKBA 2F8SA 2JVJA 5B3JC 3VNBA 3BBLA 4KRFA 2WY2D 5IEJA 2FEPA 5EWMB 9ABPA 5D2CA 4KK3A 4EYOA 4N41A 4EYGA 5KQLA 3C97A 3TO5A 4DN6A 2O20A 3HDGA 3DGEC 2CWDA 3CLKA 3LUJA 1NXOA 4Q6WA 1JX6A 1LJUA 1TVMA 4KVFA 3KSMA 3TMYA 5TQ2B 1JHZA 2A9QA 5EWJA 1PNRA 3IP9A 4XAQA 2PUGA 3VNAA 4F8JA 3QELA 4H60A 3EGCA 3SAJA 2E4VA 2CHEA 2XDYA 3G1WA 4JP1A 1NXTA 1L5YA 3Q9SA 3CNBA 4MS1B 1ISSA 4MS4B 4MR8A 2PJUA 1JFVA 5C5EA 3N53A 2HJ9A 2N9UA 1YMVA 1PHRA 5DGCA 3OQNA 1USIA 4MQFA 1B00A 1EFAA 3JPYA 5FBHA 4XLTA 1P8AA 3H5WA 2NZUG 3NNDA 3QLTA 2FMIA 5GQSA 3QEMA 1VPWA 3K9CA 3HS3A 1Z16A 2AYXA 4RDCA 2FVYA 1JBEA 2FLKA 2I6FA 5IUNC 4WZZA 4YRZA 1MB3A 2GBPA 2FTKE 3IDOA 3RQIA 5KQMA 2PUEA 4Z0NA 4P98A 4IMJB 3C3WA 3M6MD 3HSYA 1JYFA 3OQOA 1ZN2A 5TPWB 4MRMB 1SXIA 1AB6A 1DRKA 1PEYA 5BRJA 2FQWA 1MAVA 4Z4CA 3HK2A 3HJFA 4RY8A 4KFCA 3F7NA 3HUUA 4L85A 2PLNA 3HCWA 3JVDA 2JB9A 3DZDA 3OO0A 3TX6A 3HXMA 4G0PA 5EWMA 4EYQA 3LUCA 5ED4A 4YCSA 1DZ3A 3RVMA 2ZWMA 5JS2A 5KQGA 3JTEA 4RZSA 4NV3A 4G97A 4YV7A 3N8IA 1D5WA 2GWRA 1KMIY 3Q7SA 5BRAA 3GT7A 4ETMA 1QQAA 3OLZA 1U2PA 5HQJA 2RGYA 4GNRA 1SRRA 3T6KA 3ILHA 2WB4A 1E6KA 5TQ2A 3OQMA 3JY6A 1QNLA 4Z4IA 3I5AA 4UHKA 5EWJB 1QO0A 2VUHB 3MM4A 4OG2A 1M5TA 3D02A 5JNWA 2W42A 1DG9A 5DKFA 5JS1A 4XFKA 3JPWA 4MS1A 3KS9A 2JCGA 3LUDA 2LPMA 3OMWA 4XARA 3IPAA 4ETNA 1DC8A 4RY9A 1DC7A 1BVHA 1SD5A 3KLOA 3ROFA 2JK1A 3LUGA 4XASA 1FFGA 1RXIA 2QZJA 3IP7A 3E3MA 4LRQA 3JVIA 4RV5A 3FMVA 1GCGA 5DTEA 4G0XA 5JNRA 2RJOA 2ZAYA 1PUXA 1JYEA 5ABPA 4RKRA 1BDHA 2MSLA 4F3TA 2FN8A 5CNIA 5TQ0A 3H1GA 3QLVA 1GLGA 1YK1A 4MRMA 4RKQA 1DJMA 1JFTA 2ID7A 2YHAA 4EVQA 4ML3A 4N03A 4RK1A 3URMA 4WUTA 1Z12A 3I09A 2QU7A 4RK6A 1GUBA 3DLBA 2FEWB 5IUKC 3OLVA 5HM6A 6CHYA 3P9YA 2FEKA 1KRXA 2GX6A 4FE4A 4JB2A 4PYRA 3HVRA 1Z25A 2IPLA 3O21A 3RVQA 4RS3A 1DCKA 2DRIA 3E61A 4KQ9A 5DCLA 3CS3A 2KYRA 3IP6A 1U2QA 2FXIA 2PUFA 1JL3A 3F6PA 1M5UA 1ZH2A 1D4ZA 1NXPA 4YLEA 4MR7A 3A10A 4W5OA 2BGGA 1I3CA 1DCFA 5I4CA 4KV7A 1EHCA 4RXMA 3CU5A 4NICA 3H6GA 3O1HB 3M9WA 3N0XA 5KI6A 3B2NA 1Z2EA 2FMKA 3OMXA 4Z99A 1F51E 1A0OA 1EWKA 2E4XA 1FFSA 1QP7A 3CFYA 4S05A 1YS7A 4MLCA 4ZJPA 3NNNA 3SNKA 1JWLA 3RVRA 1RNLA 3HUTA 3Q41A 4EVRA 2B1JA 1E6LA 3DBIA 1BA2A 3RVNA 3F73A 1ISRA 1QO0D 1BDJA 3O2QB 4HNSA 3UKJA 4W5TA 3KKEA 1F4VA 3N0WA 4G0MA 4MS3B 2PMCA 4MQEB 2ID9A 2PAFA 1QPZA 1ZHHA 1NXWA 3KJXA 4Z9AA 5GOTA 3ROTA 2P4UA 1JLKA 3QLVC 1YS6A 1USGA 4YP9A 4F06A 2NUBA 4PEVA 2L18A 1K66A 1ZGZA 4PZ0A 2L17A 2E4UA 3DLHA 1DBPA 1YK0A 4YS6A 3MA0A 3QX9A 2IDMA 2WJAA 1C0EA 2FW0A 2QSJA 3BREA 3LUKA 4YO7A 5TQ0B 3GRCA 3LMKA 2GI4A 1Z18A 4EGSA 3HV2A 2FMHA 5DLEA 4KMRA 3BILA 1QP4A 3FFWA 1E2BA 4RXUA 4TMYA 3EULA 5TQJA 1QMPA 4EVSA 4W5QA 1NXXA 2A9RA 1RZRA 4CBVA 2JVKA 3QX8A 2P9HA 2M1ZA 4DQDA 3OO1A 3MF4A 1M2FA 2QVGA 3RVJA 2J48A 4YWHA 4O1IA 5EWLA 4MR7B 3CZCA 4O5AA 1ZY2A 4EUKA 2E4YA 1JH9A 1Y1LA 3W9SA 4Z4FA 4MGEA 4RK0A 4MLDA 3F6CA 1YIOA 3GL9A 3H6HA 3H75A 1XHEA 1TJYA 3CRNA 3LKVA 4FB4A 3O75A 4ETIA 1APBA 3FGZA 1VRVA 3FFXA 4L4UA 4XXHA 1ZVVA 3SM9A 2LUOA 7ABPA 1ABFA 2HSGA 3T38A 4F12A 1Z2DA 4DADA 4Z9BA 3O2JA 4IGAA 3QK7A 4HNQA 4D74A 4G0QA 2FQYA 2H0AA 2X7XA 5B3JA 4MYRA 4MS3A 2FLWA 1OXBB 1PEAA 1E6MA 1CYEA 4MQEA 5PNTA 3KCNA 3H1EA 3M9XA 3HO1A 5HKOA 3O1IC 2PL9A 5FWYB 3ILYA 4B09A 1QKKA 2NT3A 4Y9TA 1QQBA 4W5NA 2QR3A 3LOPA 1DRJA 1ZH4A 3NHZA 3L6UA 2WWVD 1P2FA 4G0OA 5FWXB 4NCAA 4TN5A 3OM1A 4PICA 1CHNA 2PL1A 2VUIB 4P1ZA 4JAVC 4RWEA 3UK0A 1YTUA 2NZVG 3RVKA 3Q7TA 2FN9A 1KRWA 3KYIB 1D1PA 3GYBA 1LBHA 2L2QA 2Q5CA 1DCMA 4RU1A 2LIVA 2WMYA 1FSPA 3SY8A 1DBQA 1JF8A 3H1FA 6ABPA 3SQNA 5CHYA 1RXEA 2MYNA 1W9HA 5T3YA 3QLUA 3OLWA 1NXVA 1Z15A 2QVCA 2FMFA 2TMYA 5TPZA 4NCBA 1FQWA 1AB5A 3GBPA 1W25A 4G0ZA 5IX8A 1USKA 5C5CA 2H3HA 4E7PA 5KC9A 1NXSA 5IUJC 2GKGA 5EWLB 1LK0A 1IIBA 3RVOA 2R47A 2CHFA 3H5IA 3HEBA 1YMUA 1YVUA 2IPNA 3NHMA 1U04A 1EWVA 5FBKA 1BAPA 1ZITA 3KHTA 2YHBA 5CNKA 2V0NA 3G85A 2MSWA 2HQOA 3L49A 4HNRA 1TMYA 3DGFC 1JDNA 1KGSA 4O1HA 2JBAB 1H9CA 1PNTA 3A0UA 3FDFA 5IULC 4MAAA 1ZDMA 5E3JA 1NATA 4LE0A 4RK7A 1VKRA 3H5VA 4M88A 5BQ3A 3LTEA 2FSPA 1EWTA 3OLYA 3LUAA 3NBMA 4H3KB 4PE5B 3NNSA 4ZYLA 3MQ4A 4QICA 3EDCA 4Q7EA 2HPHA 2R48A 3GWGA 5FWYA 2WRZA 3N6VA 4MR9A 2HQBA 4RK5A 3FFTA 2NT4A 3JS5A 2A9OA 1EAYA 3OLXA 4LZLA 3RVLA 1NY5A 4HYEA 3KG2A 5FWXA 4N0PA 1TM2A 1GCAA 2IOYA 1ZAYA 1MIHA 1Z13A 4EY3A 3IP5A
chains in the Genus database with same CATH superfamily
4MVXA 1NQAO 2MYPA 4RKYA 4AK9A 3WYDA 1DQRA 1KO4A 4KK4A 1VDZA 2B7CA 2VDJA 1I80A 5CVTA 4AO8A 5AI0A 2QIOA 4GI7A 3KV1A 4TPKA 1LSUA 3EPKA 1YR8A 2XBMA 1UXJA 3ZJVA 3I04A 4CG3A 1ZVKA 1ADBA 1NLFA 4EYSA 2XA9A 5I7FA 4JASB 4WJZA 1JR2A 1F20A 3JATA 4UULA 1S8AA 3T54A 3W77A 2HQRA 3TLZA 1RZUA 1XHFA 4TT8A 2VQ6A 3FIJA 4P3PA 4YYZA 3J80A 1AM4D 1D2AA 1FZQA 2IYVA 4U7GA 1P1IA 4GX2A 4EFNA 1KE1A 2O8VA 4R2JA 5CFRA 4Y2RA 2ICAA 4GOND 3GHYA 3I34X 4FNMA 2A57A 4Q16A 3NM5A 4GI5A 1NJ8A 4N7BA 1QWSA 2KBFA 3HM9A 1MNQA 3R0ZA 4LRUA 3KP1A 4ZTZB 4UCXA 4ZYWA 3LQ4A 4EX7A 3DKVA 3IVAA 4LE2A 4IF4A 4CM9A 4X54A 3LFTA 5ALQA 3HZHA 2ZLBA 4U02A 4DA6A 1P77A 5EP3A 1SUIA 1KI6B 3QVJA 4DDHA 3R0QA 4TYYA 4CLOA 2AE1A 3DP9A 1ES9A 4RPIA 3DL0A 4BZQA 3FJOA 4HNVA 1NDUA 4LNUA 1OC2A 4I0WB 4RF3A 4F3YA 3FSRA 4M9XA 2YC4C 4ZANA 2CYAA 2Y92A 3O0TA 4MCHA 1GAJA 1L3BA 1ZW6A 4Q18A 4RMJA 5J5AA 4CI9A 2AEFA 1HZZA 1S6YA 1AJEA 3DEHA 4BLRA 5MN5A 4OHXA 1DKMA 1EFVB 3FNEA 1NMYA 2Z2ZA 3KD2A 4MEBA 1E3WB 4FGJA 1HNXB 3HJGA 3VR2A 1JDPA 2PIAA 4MR8B 4V38A 5EMHA 3BSYA 5BPHA 1BH2A 2CUZA 3FZQA 1DXYA 3VU3A 3T7SA 3HEAA 1NIJA 3T5BA 4GWKA 4RA6A 1HDGO 2FZLA 2HBZA 3AL2A 1YFZA 2DQZA 4FSXA 4MZXA 4OGLA 3UICA 1GPDG 1KS9A 1Z8FA 3D6MA 4J2OA 1KXZA 1Y8AA 1LJLA 3AFGA 3FBGA 4XSVA 2ODWA 1FFDA 1E20A 4WFJA 2LNDA 1WQ4A 2YN4A 3T4EA 1RYMA 3I01M 4HNTA 3ESCA 3HMKA 3CPJB 3DE2X 4L5BA 2WU1A 2VT3A 4Q4HA 2WT8A 4DLZA 4N76A 4RPHA 3AHJA 2OKCA 3RSGA 2QR2A 3TSWA 1XPUA 4PZLA 4DMCA 3VR5H 4KI7A 3THYA 3B3JA 1NBAA 1CP3A 3M3HA 2ZAOA 2X86A 3EQ2A 2JGMA 4PR3A 4RKFA 4CCYB 2WWWA 3H2JA 2PQMA 5HF5A 2VYFA 3DC2A 4JLVA 3ZQ4A 4YR7A 1KWKA 2VLIA 3ONVA 1SBIA 3WZMA 4ZVVA 3DA8A 2JFPA 5BUQA 5ELXA 2QE7A 2QNBA 3RFVA 1WB4A 4R83A 3D6NB 1JSCA 3VFDA 4BLSA 4DDWA 1T5SA 3QPWA 5D2CA 4PFSA 3H4VA 4F5DA 1VBMA 1Y81A 4K6OA 4B2YA 3C6KA 1EX1A 3LKDA 4CTOA 4HT3B 2YV5A 5HVNA 3ZKAA 3A9SA 1VE1A 1XZ8A 2O5EA 3UMGA 4ZV4A 4O08A 4DG8A 2H11A 2ZJ2A 2JAWA 3H1TA 4KDFA 1UK7A 2B4YA 3PTLA 4M0DA 5DULA 3LL4A 5FAXA 3UMVA 3VR3A 3DQQA 3M6XA 3ILXA 2VDWA 4N3GA 3WRWA 1UWLA 3KSMA 3M0EA 2A9QA 2VJBA 3EC7A 5ADHA 1XIVA 1E1RD 2QD5A 1CHDA 1VYVA 3U3OA 3WJ2A 4AJHA 3OA0A 2X6RA 4P5PA 4H60A 3EF3A 2FEAA 4N49A 5TGDA 2W4QA 4JBWA 2C2KA 2H1HA 1UBHS 1L5YA 4QUIA 4KE8A 2P2ZA 4JB3A 1AURA 1XFAA 3RS2A 2HJ9A 1GLNA 3N0TA 2QTTA 4V2IA 3RC9A 2OGWA 4DCTA 1U0TA 5CFNA 2C0QA 4P3YA 1BU5A 3K20A 4NZPA 1ZUWA 5JRZA 4KHPB 2A14A 2EP8A 1P8AA 4PQRA 2NZUG 2VC2B 2VP6A 4JCCA 4LCEA 4P4SB 4XRGA 2JLCA 3QE2A 4ZT7A 1VPWA 1P72A 4A8PA 1PR3A 4ENVA 3P2OA 2ON6A 3W8FA 5CDTA 3TKLA 3AUYA 3SC3A 3S28A 4V1CA 2NMVA 1I5EA 3D3JA 3E7DA 3VBEA 3LSTA 3LJKA 2GVZC 2QRGA 1HM5A 4LXYA 4EM6A 5IUNC 1ZD9A 4K0KB 3ICPA 3QWFA 4BWYA 1F6WA 4YO8A 1F2DA 2Y77A 4H17A 1LSSA 2I78A 3WGYA 4QHTA 3HFJA 3M6MD 1WM1A 3RK4A 2XVXA 1MDBA 3HGMA 1JHQA 3DF9A 1BMFD 1WDMA 5EKUA 2O5CA 1CE8A 2HCFA 1RACA 5I7SA 4B4UA 1V37A 3A05A 5E7IA 2I6SA 521PA 1ZH6A 1JXQA 1KHHA 5CYOA 1A8UA 4RY8A 3WKCA 4PBTA 5IZCA 1MAHA 1VCIA 2GJKA 3GH1A 5HKLA 3WL6A 1O9HA 1VBFA 3FLEA 3TLGA 5LU9A 1XQWA 2FW6A 3Q12A 4DLNA 5JS2A 3W8EA 1F14A 4U7DA 1WCIB 1PJLA 2XMSA 3F6RA 4E09A 1ZFNA 1KMIY 1KMHA 5BRAA 1A2QA 5EMKA 1OU0A 1PV2A 1U2PA 2A94A 2G5GX 1NJ5A 3V2IA 3O8CA 1HDZA 2IGTA 4HQLA 3EDYA 4TWAA 1F0YA 2XKBA 2DAPA 2JGEA 2VOJA 3SX4A 4R1PA 3TOCA 2VRNA 4RMIA 1DQYA 2J9RA 2RKWA 3D31A 1VLJA 1IUPA 1UP4A 4CKEB 4WCVA 1D1TA 3NFYA 4NSNA 3ZWNA 3A9WA 3IR5A 5DNWA 4G9BA 5ITSA 2V0GA 4R54A 3BA1A 2G1AA 3D8TA 3DMGA 1OA1A 1E6EA 2ERYA 2LCQA 4AZWA 2OC9A 1M6VA 4L75A 3IEKA 3KS9A 2OD9A 3D6UA 2DF8A 1EA7A 4PINA 5IT9A 1RRGA 1OMOA 3CNHA 4XWTA 4PYJA 3IPAA 1L7RA 4GD3Q 5ALMA 1XDGA 3ZWOA 4U7JA 1BWRA 1SVNA 4B44A 1XWIA 2EW8A 1YJQA 2JI4A 1QE3A 4XASA 5C31A 1XU7A 4X8LA 4X64B 4X7RA 3EZYA 3FYUB 5FH9A 1DEOA 3MOIA 3MWDA 2XTAA 4CT5A 5KSYA 1XXLA 2W2TA 1BGVA 3RLFA 5DTEA 4K9OA 2RHGB 3D7RA 3W5BA 1PUXA 1JYEA 4JEHA 5I9BA 5ABPA 4DV6B 1GN9A 1CEXA 2XT0A 5SV2A 3SZRA 3WA7A 1ORIA 1PT7A 4WZBA 1UODA 4WA8A 1TA9A 5FIUA 3O8DA 4OXNA 2GWHA 4MUIA 3TRJA 1W94A 5ECWA 2P35A 4D9MA 2YHIA 1QBGA 3HH8A 5KMGA 3IGFA 4DE5A 3RIGA 2WWYA 4ML3A 3H3FA 1QV6A 4C07A 4C7XA 3PVZA 5BW6B 1Z5ZA 4QYIA 4K88A 1J20A 4N9QA 4CDGA 4MKIA 1GTRA 3HN7A 2J9YB 1EM8A 4F86A 5FBVB 2W6ID 5HRCA 1V7PC 4E94A 2OL4A 4CUKA 4CEHB 1YIDA 2QP4A 3TLYA 1LDBA 2G9RA 4UZSA 3U16A 2FF7A 2JHPA 1KH2A 4IO0A 4CF3A 2J4FA 3LQKA 2B21A 4OK6A 1KAQA 3LL7A 3NBYC 3IP6A 4I4NA 3I8XA 1SGWA 5JHGB 1CZNA 1YR2A 3VM6A 2NU9A 2X0NA 3U4HA 3WWEA 1D4ZA 2QXUA 1GQRA 1GZUA 5JVDB 1CRQA 4E5YA 1NNEA 4GI3A 1D8TA 4GR9A 3PCRB 3EEQA 3QP9A 1SCQA 1TC1A 4PZAA 2ISQA 2JA1A 3FOCA 1NNI1 2XRMA 4G85A 1V43A 2VBCA 2XYHA 2YY5A 1H2YA 2BMFA 4HQNA 2V4UA 2G67A 2QS9A 5KVVA 2V3CC 4L8WB 3R9WA 1ZD8A 4CRWB 3IIJA 1YZGA 4WLNA 5ICEA 4S05A 1H93A 2X1MA 1FRVA 3K1YA 4AJIA 5LOVA 4DIDA 4EVRA 4F7DA 2JCSA 1EVLA 2P6MA 2IV7A 1W2GA 4JT2A 1NI4A 1QANA 2JLXA 1RRFA 2O14A 4PSCA 3IQGX 3SC2A 5K03A 5KTTA 1QH0A 1ZIYA 5DWVA 4TV9F 2ID9A 3BXGA 4K46A 4TYNA 4H59A 4PU0A 5LA6A 1B2LA 2O3UA 4QRHA 2IUYA 5CB4F 4H1TA 2E89A 2R7NA 4WNAB 2ZSAA 2JL1A 2OCPA 5EESA 2GAOA 4ZJZA 3FLMA 3BE4A 4Q9NA 4X8HA 4AUKA 2P3OA 3KYDA 1MEEA 2OKGA 3TMKA 2R96A 3LCMA 2A6PA 5G1OA 3FOFC 4FWBA 1XAHA 3ZHCA 4L22A 4WCFC 1PYOA 3RNLA 3W90A 1P3JA 2AQIA 3NHPA 2UXDB 4NLLA 2FEXA 1L9KA 2YFHA 5TT0A 2O2DA 1Z36A 3JAKB 2DUWA 3IV9A 3GLIA 1EFDN 1VJGA 4RFSB 4W4TA 1UOEA 1WUJS 5KQSA 2WOOA 4PZDA 2BI4A 4Q9AA 2PH1A 3ZHUA 4GGPA 1ZHFA 4DXAA 3EULA 2WJ3A 5E6RA 3ZY5A 4UTRA 5KOJB 1NXXA 4NJMB 4PYQA 4B7UA 5IJ0B 3R7FA 5KJCA 4OYLA 3KCQA 2Q3LA 1D1SA 5D8DA 2B78A 3L0CA 5IVDA 3CWZA 3FF1A 4M98A 1JKIA 2P3LA 4WOKA 3EX7C 1UPFA 5AW5A 2EJWA 3DVLA 4V39A 5DM4A 1M0SA 4B79A 4C1BA 2ENUA 1SU7A 4MDHA 5KVAA 1Y80A 9GPBA 1Y34E 3TOSA 5DYTA 3QXXA 5GM1A 2E4YA 1JH9A 1Y1LA 2LCFA 2FZ5A 1XD2B 4RK0A 4R68A 1EIWA 3GL9A 1JDJA 3EIEA 3LHDA 3QYJA 1A2BA 4EMUA 1B0PA 3MTEA 3TGPA 1U0HC 2VBGA 3LPMA 2C92A 3FM9A 2ZYTX 2BFEA 3ZWVA 5FL7D 3TZEA 3EFEA 2ZAMA 4J91A 5LQJA 1CY1A 1PDVA 3OPVA 1I6KA 4M37A 4QPZA 1G8AA 3X1JA 4MKXA 1PQYA 3GFVA 1X7DA 3EGVA 2WJYA 3O2JA 3O83A 4IVQA 2CCGA 4U6QA 4XM2A 4O2AF 5FLXA 4UDNA 1KP2A 2OHVA 2X7XA 1CETA 4GKVA 2B34A 3BSFA 1K3TA 4FYWA 1ZZEA 2C4TA 3C15C 3H9CA 5KYWB 1QGDA 3LYLA 1FMTA 1D09A 1YR6A 2AWNA 2OQ2A 2VHYA 2ZK7A 3ICCA 4B09A 1VXRA 2XD9A 4CG1A 1QONA 3KX2A 1IM8A 1FQOA 1ZH4A 3KQNA 4A2PA 3NPMA 3LFUA 3T7CA 1I2AA 4J6EA 2R65A 1UR5A 3FSGA 3AO0B 5IMBA 1RM3A 4B6GA 2E37A 2CXRA 1MRZA 3WNZA 2K7FA 2XQJA 4L95C 2EBFX 1D2CA 2UVDA 2Y1FA 1MC1A 1JU4A 3NW9A 1JPJA 2R00A 4GI1A 5CUQA 5EPEA 2Y1KA 1A8QA 2ZR0A 3KM0A 3PUIA 1YTUA 3DE7X 3T5DA 4F4HA 2NXNA 1BO6A 1EB8A 2R6JA 3VKWA 1NR7A 2RC6A 2EP7A 4FILA 1EJ6A 4P4UA 5DHRA 4QEZA 3EOAI 2VXBA 3ZI4A 3FI0A 2OV3A 3NP7A 4BB9A 3RC7A 1FU7A 5AW7A 1RWNA 2ZIZA 5K3EA 2CLEB 1V1JA 3CX6A 1GYRA 3IP1A 1PIWA 3AW9A 4JWKA 2D2EA 2FQQA 2VTDA 2QVCA 1LNSA 5DTJA 3TOVA 3QTTA 3HTXA 1UBOS 5KSPA 1TZMA 3HDHA 1K06A 2A78A 3A27A 2D3WA 3H4IA 3REOA 2H8KA 4K26A 2FUG6 5CB8A 1G5FA 4FFBB 5LP6F 3G5AA 4R8VA 2FJUA 1LRJA 4HGPA 1DV2A 4W5HA 2GK4A 3K0AA 4MRAA 2BBSA 5C8YA 1H6DA 3F9RA 5K3CA 4M86A 4MYTA 9LDBA 4HB0A 4HNRA 2FQ1A 2XTNA 1BN7A 2ZYRA 2Q1UA 3ABQB 4DV0B 1RJFA 5HZHA 5EYPA 4UUPA 3T7TA 4OK3A 3V3TA 3EHEA 1K6EA 4KE7A 4NCKA 1DOZA 1NJFA 1TIKA 5I9MA 1JVBA 3DD1A 4BN5A 3DMNA 1IN5A 4NOLA 3PICA 4AN0A 2FSPA 4XVHA 4H3KB 3DHVA 2CLIB 1XEXA 4XJSA 4LYHA 3RHFA 5E9WA 1LPNA 1X7XB 3IT2A 3RUIA 1GGVA 1Y8QB 1PG5A 3ZPXA 3MQ2A 3MJSA 4XH9B 3DSRA 3NALA 1NLMA 2DCUA 2GHRA 2V6IA 1SQFA 4OPMA 3TEJA 4PSKA 1NLYA 2BF7A 4HZGA 4U9IS 2FW1A 1YQXA 3KG2A 4OM8A 3VR1A 4QX6A 4K9LA 3SFVA 5KWEA 2J46A 3RBZA 1A96A 3NBFA 3QPCA 1NRXA 1ABEA 4WT7A 4MYCA 1C8BA 1ACJA 2C20A 1NF8A 1BZYA 3RK1A 4YXFA 2IP1A 1LLCA 1OT3A 3M33A 3OCJA 5EC8A 5K6TA 2DFNA 2O2SA 1KYWA 1W75A 2JLBA 5JZMA 2YXPX 4WMLA 4LXXA 2PMFA 1QORA 3DP7A 3IPYA 2BVNA 2WA1A 1HY3A 2YYZA 3IKLA 4TWIA 4WXMA 5A4JA 1ZD5A 5JY6A 1V0JA 5LDGA 1GM5A 2Q5IA 1FB5A 2G9QA 3D1LA 2G36A 1S3SA 3SG0A 3HGTA 1E66A 3V33A 1S5PA 2Q07A 1U7PA 3KLBA 3QEJA 4MMXB 4LDAA 1PKEA 2PJZA 2XQGA 3LYHA 1N0VC 2V97A 2MSNA 4K9MA 4QUAA 5IM4F 2QYTA 2JC3A 4Y6SA 4BX2A 1GTL1 3M6UA 3BBPA 4RK4A 4REQA 5LC1A 3X2EA 2FZWA 3ZI0A 1BWSA 1TQ4A 2BE7A 4EUEA 3NHSA 1Q0TA 1M0EA 1X94A 1ZGAA 2VRBA 5ALDA 5AOAA 2NLOA 1U9IA 1MJHA 3EAFA 3CLSC 5DYYA 3L4KA 2QTMA 2O8EA 4BFXA 3C5HA 4NEQA 1HETA 2JCVA 4U3JB 1EFPA 2EZ9A 4EPYA 1Z06A 3UMBA 4Z53A 3U56A 3DMTA 4U2GA 2O0HA 5CDHA 2QZZA 3AI2A 3PC8C 4AF8A 1MX1A 3ABZA 1FYEA 2B4TO 4YJGA 1FK8A 1B3RA 3AU9A 2AZ4A 3D54D 4Y2VA 3SBOA 4ND6A 2X7HA 4P0PB 2A9PA 2P6OA 4J9VA 4MHTA 1B8VA 4F3NA 1V1RA 1XX6A 4QASA 1F6BA 1WXGA 4GBED 2CK3D 2X0IA 5FJIA 1K89A 1ZESA 1C3VA 1Y4UA 4NZ9A 1FJGB 2VAPA 1P9LA 2NACA 3EFHA 3T8YA 5A4IS 5A6VA 1YJXA 2XX3A 2I29A 4MCJA 2AKAB 2PPVA 4X95A 4X3OA 1AS2A 4NXMB 4QGAA 2APJA 3LUPA 2PUDA 4A0SA 1P31A 3L18A 3NEJA 4UEJA 3OM0A 3QELB 3BFXA 4XWWA 2W6ZA 2PFSA 4K8OA 1OXKB 1E5LA 4MS4A 4BB0A 4N5DA 3OIYA 4BBJA 3EASA 4MVJA 2FSUA 3AOEA 1PD0A 4XIJA 3REQA 4YRDA 4BP9A 3R3XA 1Q0QA 1V4NA 2M98A 2BDTA 4RCYA 4G5RA 1CZUA 1C8LA 1P0IA 5B3LA 4G84A 5AQEA 5D3MA 1XXHB 3GT0A 3JQFC 3ZGXA 2X8AA 4K9KA 1R0XA 3MCUA 1PWEA 1CUEA 1E1DA 1R6XA 3G8CA 4PGGA 1SQGA 1TF5A 2XHZA 1DMRA 3BXOA 3MBIA 4J4TA 4K6CA 1ZLYA 1X38A 1PZFA 2IELA 2R4QA 3X3HA 5FL3A 3CGGA 1JHXA 1X0VA 1KETA 1OJLA 5LQKA 2PGIA 3BD9A 3MWEA 4DLTA 3IYLW 4MARA 2ZJBA 1QMGA 1NN3A 3BJRA 4UM5A 3RTGA 3LVFO 3JTMA 3W1EA 2QBYA 2QQ0A 4A5SA 1U8UA 2VJAA 3ZI7A 4B45A 3QMWA 2VYCA 4NENA 3U26A 5JNLA 3FLBA 2IU6A 2PZGA 3NDPA 3E2IA 2KX7A 2LDBA 3VOSA 4P7JA 5B37A 4RMHA 3I2YX 4G37A 2JVJA 2GLTA 5E6UB 2CV0A 1YZLA 2WM3A 2CE2X 3WQSB 4RD1A 9ABPA 2QN1A 3BGWA 4G1MB 3JYHA 3R76A 2V6JA 3NOVA 1NW7A 4BFCA 1R8QA 3OD5A 5C7YA 3U6BA 3MCZA 5L7TA 5KVQA 4IIUA 1E7RA 3DLPX 4LJAA 3IEUA 2IIBA 2HC9A 3ODGA 3B9QA 4K9RA 4CKCA 1UBEA 4RVSA 3ZD8A 1DWOA 2FSHA 3MHTA 2QGNA 1ZN9A 2IT1A 3FKSA 5ESDA 2H52A 4AZ0A 4MW0A 1TA4A 3INYA 4OL9A 3G88A 4FD3A 2BFBA 4FZVA 4HQ6A 1KZ7B 2ZRMA 3TB4A 2NVBA 2CFIA 4J7UA 2QTFA 2ZFUA 2GBLC 1ST2A 3JALB 1SPXA 4MS1B 4LZAA 1C1DA 3PC4A 5KX5B 1ECFA 5GZ1A 3WYBA 4ZCSA 1CBUA 1LI7A 1YMVA 2GBFA 3H7IA 3L3BA 5I01A 4XX0B 4DGSA 3TGLA 5KYUA 4OXIA 3LPDA 3OQNA 3OJFA 4JDPA 3MUEA 1I14A 4D0RA 2Z2KA 3BHIA 3RLIA 1O08A 3IA2A 2IBMA 3QLTA 1MR3F 1NZFA 3A1WA 5THQA 4F96A 1ZK2A 1Z33A 4GZMA 2WK1A 4MRSA 1RKQA 4ERXA 1ISGA 821PA 4WFKA 4QNNA 1OFHA 3R5KA 3WL7A 1A8SA 4WLOA 3EMBA 2UZIR 3R9XB 1DDGA 1JE0A 4RPGA 2G4CA 1E9CA 3IDOA 2RBGA 1Z8DA 3BAFA 1H0KA 2BKXA 2DUMA 3PRKE 4IFBA 1WXEA 4RACA 1M1UA 4GHWA 1SB8A 3OQOA 4L72A 3RYFA 1E1QD 1N75A 4DLXA 3QI7A 1NGSA 2FR8A 2IL1A 5ENZA 4GVXA 2RGBA 5CITA 1ND5A 4MJXA 1EZZA 1FSZA 4HEA6 4LW8A 1SIUA 1B93A 2IHNA 1E2DA 3HK2A 3TUJC 2C0CA 2CDAA 4BZWA 4ZP1A 4RESA 3O8RA 3KVNA 4QBHA 3S1AB 4BAZA 1ORWA 3E1GA 4WCFB 1DZ3A 4EJSC 5D7BA 2ZBGA 1DKNA 1MO3A 2HO4A 1PQPA 2FY8A 3I04M 3JAWB 5I4IA 2EZUA 3N8IA 2X8LA 2ZANA 3HACA 1NG1A 3MTJA 3QVTA 4CFYA 4PPYA 2H1FA 3B9BA 1E8NA 3PYXA 1TO6A 4TTAA 2GS9A 2JI8A 3CQ9A 2PO5A 1HTBA 5F1PA 3VR0A 3OX3A 4IIJB 1PFQA 4G2NA 1EFKA 1PU2A 2WFLB 4Q02A 4UEWA 5IKPA 1X8KA 4Z4IA 1BVRA 2AFVA 2O8DB 1ULTA 2GJ4A 1R3UA 5G41A 1DIRA 2ZSFA 1F9AA 2PXCA 3FOAA 5EINA 4Q03A 3MRSA 2WF9A 1JI3A 1JGTA 2JANA 4GBJA 5LP1A 2HEGA 2OLJA 5AM0A 4AT1A 3WL8A 3PHHA 2BV3A 2H18A 3COWA 3Q72A 3TW6A 4FFWA 1QGZA 1C0LA 4X1YA 3UAOA 2C3MA 3WK7A 1KC1A 4R2LA 3HB1A 3UW1A 4F6RB 1L4NA 5IANA 3ER9A 3CUWA 1N6LA 5H81A 3GRAA 1PJ4A 2X0KA 3QY9A 1YB5A 3PWSA 2GLXA 2E0IA 1QV9A 1IU9A 2PTHA 2ODAA 3K96A 4US1R 4K3UA 1ZZGA 2O07A 5JXIA 1UWVA 1GCGA 1M2NA 4RSRA 3H83A 3WIBA 3VYWA 5LZ5A 2PU7A 4RWZA 3HJAA 4IXNA 3NJ8A 3NIBA 2YFQA 2CLHB 1EXNA 4TS3A 1Q44A 1ZSNA 4R4JA 4CMHA 2J7KA 4ZEMA 1AZWA 2HKIA 3TQCA 3GCGA 1X1QA 1EP9A 1R0ZA 4IKOA 1GKYA 1EE1A 1YO6A 3ICQB 2VNIA 1MORA 1K8QA 2FVXA 1E98A 2DH6A 5FI3A 4F60A 2JLZA 1DT3A 4NDZA 1UT6A 1Z2CA 5JISA 3UV3A 1FDIA 4WUTA 2VPPA 3ILVA 1PJ8A 2FUKA 4HY3A 4IW3B 2VHWA 5KNDH 4QBKA 1E3IA 5ALVA 3L7BA 4DB4A 3WRXC 4LYEA 1U7TA 4A8JB 1UC5B 1J6UA 4Y2QA 3JQQA 4BO7A 4CL3A 2WB2A 3PJGA 1PR6A 2ARKA 1VL2A 1E64A 3QXHA 4FYMA 3DFIA 2X8JA 3VJLA 4RTNA 3I61A 1NVVR 2FXIA 3GVIA 5MN6A 5KOHA 1K4MA 2J9XB 3G2NA 4Z9XA 4MICA 1CQIA 5IAKA 4WFIA 3BQ9A 1I1OA 4MR7A 3L4BC 4LMBA 1FDSA 1KNQA 2BZSA 1DX9A 1WSAA 1G3QA 2C5AA 3SVTA 2JIPA 3FDJA 2CNWD 3FR7A 4NESA 4GKAA 4GPD1 4J43A 1QQ7A 1SUAA 3UAYA 3BSWA 2RHLA 4K5QA 4TMZA 3KIPA 4BN4A 3TTXA 4RAQA 3WGLA 4C04A 1ILWA 5EVJA 3W5JA 4ZHQA 1OTYA 5GVRA 2Q49A 5H0IA 4BYMA 4RLFA 1CR0A 3ZJUA 1W48A 2IE8A 2Q3FA 2ZTUA 4E2FA 5JJLA 2OZLB 3JQGB 3HKDB 4TQAA 1WAMA 1CJMA 2W22A 4LZZA 1C0IA 2WINI 1ADJA 4OKNA 1BDJA 3EXIB 3WIVA 4BPBA 2C3PA 5MF6A 4FWTA 4MRPA 2FOLA 3D6FA 1NR5A 2EAUA 4XM1A 4CG2A 1KI9A 2C31A 2QF7A 3FUVA 1M2WA 3IBYA 3R77A 4J0GA 4XWYA 5G3ZA 2EKBA 4BRSA 2ZOSA 1OI4A 1TJ5A 4OI0A 4YAOA 3SJBA 2FXVA 1CKEA 3NTUA 4WOBA 5JYDA 4X7MA 5F3WB 4G1VA 3WVNA 2X9GA 4AROA 2BGWA 2W58A 3BREA 4JJ4A 5TQ0B 3U1TA 3VKGA 4OHRA 1WVIA 1TQ8A 1ZVJA 3HC7A 4KL8S 4LISA 1MV5A 5BYJA 3C7KA 2GYWA 5KEIA 1MQ9A 2R8PA 5BQ5A 2BGUA 1WR8A 5DLEA 2XGSA 4YQYA 3O5AA 2UU9B 1PJAA 1YOVB 2ZIGA 4XOUA 2DTXA 3V4PB 4RXUA 3IQFA 2PKEA 4MAFA 3ZNNA 4DBLE 4EVSA 4BQQA 6NULA 3O3CA 1SG0A 2C2XA 4H3VA 5AKHA 4ZQCB 5TARA 1XE3A 1UM9B 3AY6A 2ZJAA 3FVTA 5IG2A 1UZUA 4DQDA 4FSDA 3ZCXA 3MF4A 1M2FA 2AG1A 1AG9A 2PSSA 1L4LA 2Q62A 3EG9B 4ZAXA 4IZIA 4U0JA 3VU9B 1Y8RA 4I8IA 4D9JA 3TQSA 4HRYA 2N47A 4QTTB 3BMOA 3BH0A 3CX3A 3U4QA 4HDAA 5LXTA 3R7DA 3CZCA 3AM4A 5EIHA 1Q22A 1ZRHA 1D7AA 1YBAA 1NP7A 3HB9A 3P52A 1KAHA 2IYEA 4XWGA 3OTWA 4ZI5A 4AULA 4RM3A 3AFIA 4M8NE 2QTRA 4QUBA 2AR9A 4ZGGA 1ZEJA 3LBFA 1ECCA 4S2EA 4BAUA 3M49A 1E1RA 1APBA 4BASA 2O0LA 3JVUA 3ZXYA 1OKKA 1JEJA 4MIEA 1BQ4A 1XGKA 2CLKB 3KYBA 2BL4A 3SFZA 1M2KA 3N5CA 1EZ4A 1J97A 3HCAA 3P8ZA 3SZGA 1OGYA 5LYYA 3BIXA 3PSAA 4LKOA 5DXFA 2QMUA 4BVLA 2IS2A 4KVZA 1PI3A 2V5UA 2F17A 5BVHB 2I0FA 3QXJA 2P4HX 1X39A 4GQAA 5G02A 3R75A 2CVZA 1QKKA 3AERB 4Y9TA 4DCPA 1U4NA 1ZD2P 4W63A 4EWLA 3E8SA 4BE4A 1M7BA 3NHZA 2JGLA 1JDSA 2Q7XA 4GYYA 2EARA 5G0VA 3WV5A 2JI9A 3QUBA 1S8OA 1YQQA 4NCAA 4WZAB 4B9EA 4TTJA 1JFLA 3KEOA 2B1IA 4AY5A 3E81A 1LF5A 3NHWA 3IQWA 4NCNA 4U2FA 5GP1A 2GN9A 1XLVA 1J8YF 1WL8A 5B1EA 2CUKA 2CXXA 3AEUB 4MRVA 4A0GA 3GLHA 1IY0A 2O5RA 1LBHA 5EAIA 1BMFA 4F2PA 3ESRA 2WHEA 1NV9A 4RGQA 1T3TA 4A5OA 3R3ZA 4FONA 1JPNA 2OSVA 3JR3A 3EMVA 3PFHA 4J4BA 5BN4A 5CHYA 1LLFA 1RXEA 4YJHB 5JJKA 4U7FA 4AYWA 2IX3A 3NDJA 3GR6A 3OCVA 3QNWA 4EHDA 2POQX 1NXVA 1OPXA 2FAXA 1Z47A 2FR0A 2YXLA 5JDIC 3AL0C 2YJZA 4JI7B 2IHJA 4FJ0A 2P8JA 3E1SA 3E9YA 1MW9X 1W25A 2JGRA 4GUDA 4J16C 1JIUA 4MUFA 1MJGA 2Y9MB 4TXHA 4OHOA 2IYOA 4KXUA 4BQPA 5K0EA 2QM8A 1YKSA 2GAIA 3DOEA 4JI4B 2ZVQX 1YZNA 1EWVA 1Y9ZA 5H3CA 5LR6A 5JXGA 2AEEA 4MUNA 4P4LA 3AIMA 3UFXB 2DEUA 4QJ4A 3AYZB 1T2UA 5EMLA 2O8CB 5B2EA 3NATA 1XNRB 1H9CA 4IOMA 1T3HA 5KJ1A 4FKMA 2E21A 4EY8A 1G66A 3CKLA 2B0JA 1EXVA 2JGAA 1R5BA 4L73A 3CNQS 4UTXA 4Y67A 3ANYB 1IY9A 1QFMA 2VJYA 2XRFA 3NZEA 2CNNA 1WLYA 1I01A 3UEOA 3FGPA 4OLHA 4PE5B 4WH0A 1NV8A 2DFKB 2Z8YA 2VDRB 2H3EA 4Z1MD 1SVUA 4ZVMA 3KXKA 1JLRA 1LX6A 1TC2A 3A32A 4U2KA 4UBMA 4YNBA 4LTNA 3U9SA 4TROA 2I7TA 4FX2A 4AJKA 1XNJA 2XB2A 1MB2A 3SHTA 3PDCA 2A9OA 1TD1A 2DY0A 2W8BB 4KR7A 1EFVA 4OFZA 1PEKE 4LZLA 4JLJA 2BRUA 1E3WA 2HA7A 3L7LA 1YGPA 2CXQA 3BH6A 4M1MA 4YEDA 2I3BA 3MGCA 3M1IA 5CVUA 1PNOA 4YRSA 1ZAYA 1P8JA 1L4FA 4Y9DA 5HIAA 4PZCA 4ME6A 3J7TA 3BRSA 4FEYA 3RTBA 2D7CA 5JDCA 3N2EA 4ZPXA 3EQ9A 3W2EA 1EUZA 4KGXA 3A1NA 2WWFA 1P1FA 4QNRA 3RDPA 3QYAA 5HK8A 5T7BA 4JH0A 5C1IA 3AHEA 4BV2A 5JNTA 2H48A 1WUYA 4JCOA 5EL0A 1L4GA 2I22A 3GMDA 4IP0A 4CI0B 4MUYA 2JVIA 3RSHA 1KR5A 4E6PA 1W5BA 5CEJA 2IPAB 3DYIA 1PK8A 4TXMA 1G8JA 1W5SA 5FFFA 2X2FA 4GL2A 1YRBA 4FBLA 5KSOA 2KE5A 3UUWA 1CEQA 4FNGA 4D6YA 1Z22A 3NH9A 3ZJ4A 1W44A 4JJ6A 1VOTA 2DOKA 3BMNA 4JBXA 5ICSA 2JGDB 3EVTA 3PUVA 2HA3A 3D4NA 2A5YB 2E82A 3EGXB 4ZWNA 1V5FA 3UV6A 3H8WA 4JHXA 4KUEA 3L1HA 4GLOA 5JASA 1P6UA 1N7JA 4PHGA 5JH7A 4DT1B 3S29A 4BNTA 3RJ9A 5GIOE 1ZJWA 4OSOA 3N2GB 5LQMA 1K9SA 5IJ9B 3VUEA 1YZHA 4GLFA 3WKDA 3HXQA 2WU8A 2XQVA 3F7MA 3Q3HA 2P0YA 3P0IA 1FFBA 3AEQB 2F62A 1VLQA 2H1VA 1G38A 4ZZ3A 2G80A 2YBEA 4DC1A 2ZWVA 1JE1A 4ZZ2A 3MMNA 1Y7TA 2W6JD 1MZVA 4LPKA 3WQHA 4WXHA 3KETA 4AZSA 2CXTA 3QXCA 4BVGA 1Q6YA 1NBME 4UHFA 5JSFA 4WKGA 2OB1A 4MPJA 5DLYA 4LIPD 2ODNA 3DAPA 4M1TA 4RTRA 4JR0A 3BXPA 4BQOA 1DBRA 3ZK8A 1C0KA 1X1SA 2HDOA 3OSZA 5FI1B 2EG9A 4EJSB 1U2TA 1CLUA 1KI1A 2VCHA 3CLSD 3IEIA 4QG3A 4CL2A 4YK7A 3ZCSA 4EUNA 1GL6A 5CJ2A 1SUPA 3CR8A 4YCBA 2X5NA 2FV8A 5KINB 4DIBA 3WAGA 1DL5A 2IEAA 3H8VA 1CY7A 1S4MA 1G8MA 4P54A 2F1KA 2HADA 4TYPA 3A3PA 1FNDA 1NF9A 3X2SA 1Y7PA 4TTQA 5FJJA 4U8HA 4JJ7A 3TL2A 4IL5A 4PRZA 1YB2A 2YYSA 4Y2UA 1U7ZA 4G67A 1OC4A 4OQMA 1OI3A 5DMXA 2OP1A 3P9PA 3Q87B 4FGUA 4JT8A 2L69A 2X2PA 3CX8A 3DVRX 4TSRA 4JYCA 4INAA 4F6CA 1T25A 3C7DB 2NTYC 4MV0A 4X71A 1HT3A 1U3WA 1QG4A 3P71T 4EB0A 5CX1B 1J0CA 3FG9A 3TGWA 4MEJA 4X7PA 3THOA 4AB1A 5KBYA 2XRZA 1T6BY 3CZQA 2FFRA 3TEFA 2Q5OA 1J56A 3I42A 5J5CA 5JS1A 3UHJA 2VHUA 4J0KA 2H9YA 1Q57A 4AZVA 2RGNA 1XCLA 4FYKA 3N2ZB 1SVLA 2VG8A 4J75A 4ANFA 7REQA 1G18A 3BTOA 3QV2A 2O7QA 3K1AB 1Q77A 2I2DA 3WOHA 2J6BA 1VGRA 4I3HA 4DV3B 2RI1A 3DV0B 4QHYA 5BW4A 1ESMA 3D3KA 4KQGA 4N7RA 5JAQA 3LHFA 4KPYA 1NQXA 3DAGA 1KDRA 3IQDB 5AJZA 3V1UA 4FW9A 3OOEA 1C1XB 3ANTA 1TVKB 4BWGA 4B46A 3CCFA 1WCIA 1W6UA 3AR7A 3TM5A 3C97A 1EWRA 5IAJA 4GE0A 2OBFA 3MJTA 4AC9A 2XHEA 2AFHA 4H7KA 4RZQA 1JHVA 2G6BA 4E30A 3KTFA 1OBFO 2P40A 4XYBA 5DLQC 2O3SA 5AOVA 1D6MA 1J22A 1MNAA 3L4JA 2G82A 1RLUA 2Z5FA 1RJEA 4MWZA 5E1BA 3UMSA 1IZYA 3II6X 3VDXA 3CISA 1D4AA 4ITUA 3ZBUA 2RHHA 1D5CA 2FWPA 2NYRA 1NOKA 4PPFA 4GIBA 2YWDA 5A5DA 5FBQB 3KXPA 1M0TA 2CNOA 1QQ6A 3HA7A 4MUJA 3GRKA 2GMWA 1JSZA 4N54A 4XB6B 1C3EA 4XQEA 1A71A 4F5YA 1W85B 4M22A 2EKLA 4ZICA 3UG7A 1ONBA 1V6CA 4JQSA 2KI5A 1WXIA 4PC6A 3RWBA 1J7JA 4WINA 2PY6A 3MS2A 3A14A 1G6KA 2QUBA 4S3MA 2EVWX 2J32A 5ERXA 4JP5A 1QVAA 3L01A 1WHTB 1UKZA 4NMLA 4F3RA 4ENPA 1SKMA 2AYXA 5GONB 3DEIA 2BMWA 2GERA 4ND4A 1ZNXA 2Y1GA 2FN3A 1OXUA 4B3BA 2QD4A 2VQ3A 4E3ZA 3UCEA 1MOQA 2X14A 3NWJA 1KOJA 4ZYVA 3RQIA 3PQ3A 5KQMA 2I3ZA 5BMVF 2FWRA 3G9ZA 1P19A 3T06B 3CRZA 4QQRA 1JYFA 1NN1A 2VP2A 2X42A 5I9SA 3OCWA 1TZBA 4OX9B 2EZ4A 3VZRA 1X8JA 3JWHA 3OJLA 1NVVQ 1Q0RA 1QHNA 1S96A 4D2IA 3RC8A 3HXKA 1QG0A 2Y1EA 3D0OA 1RI5A 2C2HA 1MAVA 4G26A 2AZDA 4V0MA 3F7NA 1V8BA 4COOA 4CEHA 2JD2A 4WK4B 3K9WA 4RKEA 3AR5A 3DMHA 3RIEA 3H1PA 3ELBA 2Z04A 1RBMA 5A7HA 1ORDA 1VHWA 2DSTA 2RONA 1D5WA 4W9RA 1KAMA 2JFFA 5BQPA 3AR9A 2ZWAA 3GT7A 2I6TA 1G5IA 2BDUA 4CKZA 1XCOA 2O7VA 2WJ6A 3PUKA 2ZQYA 1H22A 3F2VA 2QUJA 3DKPA 1YHNA 3FCUB 5TIIA 3FSJX 2OWDA 4TKVB 4R6XA 2R86A 4I9NA 3I5AA 3ZNPA 1RWXA 3FFBA 3W9YA 2SKDA 1OR8A 2SHKA 4BGUA 3H9JA 4KZPA 5ALLA 3KQWA 3VV3A 2Z95A 5KYXB 3R5SA 5IDWA 4TSKA 3FCYA 1YNOA 2EFYA 4R5MA 2VT2A 4XI9A 1H69A 4C2TA 3UHFA 5C4IA 2ZBRA 2IX9A 2F3QA 2IZ6A 2XZTA 3HA2A 4XUEA 2D1FA 5AKXA 1FNSA 1RWVA 2P41A 4ETNA 5LB4A 5EJ5A 1DC7A 2MT9A 2GPNA 1GCOA 2ECFA 4MI9A 3D5QA 3V00A 1Q7RA 4LF4B 4BMOB 3CVOA 3SHWA 5A5VA 5KO2A 2A1IA 2B94A 3DEZA 2Y1CA 1ODJA 2NSLA 3B9PA 1CPYA 5DBOA 3AJ9A 1K5GA 1W35A 2JIZD 4G0XA 3T7RA 2XCQA 4G07A 1EGHA 1R0KA 4L8YA 4R51A 4E5NA 1ODLA 1QRRA 2MOKA 2XR1A 2C7OA 2ZAGA 4PG4A 1YZKA 1K7FB 2V7QD 5BY2A 4L9RA 1RHJA 2XUOA 4W7SA 3BZUA 3E82A 2V03A 4PFKA 1XZBA 3ND6A 4EHKA 2RE8A 5JTTA 5H59A 4DXDA 4MVJM 3CVYA 1CXZA 3HR8A 4FBMA 2WKWA 2DECA 3JAKA 4CKBB 3F5DA 1Q7GA 2AIRA 3M4ZA 1DAGA 3QY0A 4DS3A 1VMIA 3Q8LA 3O9ZA 3CMCO 1GT6A 4HAWA 4JD5A 5CTAA 1DKQA 3W2TA 3BMCA 4FHEA 4TTPA 1DFHA 1ZMTA 4RTJA 5FPTA 3WK9A 1DCKA 4DDUA 3W2HA 1KK1A 3ME5A 5G0WA 4KPFC 3ZHVA 3NETA 4RZHA 3VVBA 2QHXA 4EENA 1IRIA 1DJQA 1ELOA 2OD7A 4MV3A 5KTMA 2IYUA 1NAHA 2FDRA 3MJVA 1H85A 4PXAA 1V5WA 4PY2A 4IEEA 3HA3A 3RTDA 2J3MA 4X84A 3UGTA 3KZXA 4DLLA 4EBFA 4EFDA 4IJ6A 1NQTA 1VBKA 1XD2A 3O1HB 3FE2A 5IDVA 3A3NA 3VR6D 4MV9A 3OU7A 5JE8A 3SX2A 5KI6A 4A73A 5ALZA 3OOHA 1E32A 3OQPA 1Z2EA 3GYGA 3IEPA 5JSYA 4J3NA 1HGXA 2O0MA 1AGNA 3DZCA 3OA2A 4TM8A 2ZE8A 4MVYA 3CVJA 3CWCA 1YS7A 2HGZA 1M34E 2XWJI 4KO3S 3NHJA 4MYHA 4XYGA 4BJ6A 2XQIA 2Q9BA 2GKOA 1PSZA 4WNYA 4EW1A 3N2KA 3UK6A 4GLBA 1T26A 2ZSKA 3DONA 1G3MA 3QI2A 4W5TA 3TE6A 3LYUA 3MBOA 2QVYX 1T5LA 2P5TB 1ZHHA 4WKCA 1NIPA 1MB4A 3ZVRA 1CRLA 4WQMA 5HMLA 3I92A 1F0KA 4NV0A 1L3IA 3QKSB 2IBSA 2W37A 1YS6A 2JFZA 4GBGA 1VHQA 4IV8A 4MB0A 4FDLA 4BLUA 5KAMA 3OIWA 5CD1A 3HNPA 1XCJA 1M76A 2L82A 4FFRA 5HJEA 3R6DA 1MVNA 5D1NA 5ALFA 2BFFA 4CMIB 2IDMA 3C7AA 2IUEA 2XMRA 3B9RA 3NTVA 4IIFA 1ZD3A 4DUYB 1JZQA 2WYIA 1YS9A 1K2WA 2HA0A 3LUKA 1E69A 3GRCA 2CVPA 3BGSA 1LSOA 4WUVA 3WSTA 4YJ2A 4ARBA 2O54A 4IJ5A 1CIPA 1IK6A 4V24A 4YRFA 3QENA 2JJ8A 5AI5A 4W99A 5E2IA 3CUUA 4FYPA 4BV9A 1I0IA 1DXOA 4EATA 1K7CA 5AW6A 1ODCA 1GGMA 3I5UA 4O25A 4A6DA 3ETJA 5ARDA 1A7AA 3P0HA 2P9HA 5L3QB 2GN2A 2M1ZA 3L1KA 4U9HS 1WDWB 3PIIA 5JRDS 2XV1A 2QQEA 2WMNB 4RD6A 3HJCA 3D43A 2DC1A 1LFDB 3PFWO 4HEQA 1LA2A 2O8BA 1KOLA 4OHBA 3VGJA 4MROA 3CEPB 4I99A 4MQBA 5SYAA 2VZ9A 5GV7A 3ZCVA 5G1PA 1I2MA 2XMGA 3DXXA 4YQFA 1N77A 4JSYA 5CT4A 4IZHA 1IOLA 5CVVA 2EKQA 1I13A 3A4NA 1GUZA 1PFYA 1Z5VA 3B6KA 3IAXA 3LKVA 3ND5A 1KJZA 1OIWA 1YHZA 1ZEMA 3GFSA 1E2PA 4K40A 3RODA 1JG2A 2AK3A 4LZNA 3UOAB 3AR4A 5JS8A 1RAAA 4GDMA 2AN5A 2OZPA 5BOVA 1SCIA 4UU1A 3SKXA 4B31A 4NXNB 5EJ6A 5CIYA 3TDMA 3GO4A 4HNQA 4MQ5A 4HQ0A 4OFBA 1J1IA 1UDXA 5FCDA 3AP3A 4M2LA 4UARA 1X7XA 2FLWA 1JMKC 5ALWA 1PZXA 3ESYA 2I03A 3PCXA 4JBHA 4QOIA 5KAPA 3REFA 4YMUA 1FSFA 1H5UA 2HMTA 1AQ6A 3K2IA 4FOTA 2HUNA 4OQXA 3UJ7A 1CJUC 3ZLTA 4LX0A 2B35A 2A1UB 3UJPA 5BSEA 5L4LA 3ZDDA 4X9XA 3D9QX 2BYTA 2NU6B 2XZOA 4TMFA 1OXSC 1JHYA 5L45A 3JWGA 3N28A 2QP9X 4L8FA 2OHFA 4P38A 4ZVNA 1RE0A 4QOSA 1CR1A 4EHLA 1ZJ6A 4ZKDA 2YVUA 2VN8A 2JRCA 5BV1A 1H6CA 2PL1A 2IDJA 2AI3A 4KITB 5HFNA 2C5LA 5IN5A 4AP6A 4FFVA 1E59A 5LWQA 4YI3A 1XTQA 1WOMA 1LVHA 2IXGA 3WYEA 1RMQA 3SY8A 3HN6A 3IT0A 1DC6A 2BHLA 4MRRA 4QNMA 4JROA 2NTNA 1CNFA 3LBAA 3NUQA 3S70A 1HDXA 4R9RA 3OLWA 4JVNA 1TAQA 3LK7A 4MJ7A 4JNKA 4QXMA 4YA6A 3PNMA 1Z4NA 2XA2A 4UQLA 4P2GA 2QN9A 3C6XA 4JUDX 2JGFA 1RKBA 3M8KA 4Q3CA 5B53A 4O2LA 3OESA 3T5CA 3UPDA 3ZE8A 3GLGB 2CHFA 3HEBA 4HDQB 3CYFA 5AVWA 5CDFE 2FPSA 5LQUA 2IYLD 2HFKA 3WZ2A 1G9TA 2HA2A 9MHTA 1PZHA 3G8BA 3KAPA 1Y7HA 4FYJA 4MK4A 4XJTA 4NBKA 4D43A 4PF1A 3GZTB 2ADMA 2DU8A 4HXGA 4XR9A 5HFAA 1P9WA 1GTZA 3DDOA 4GMDA 3RC3A 5HIKA 3ZVNA 1GQ2A 3I6IA 4Y2PA 4LF9B 4J6FA 2AQ8A 1IONA 1UFRA 3K5HA 4ND7A 4N7MA 4E5VA 6REQB 3PD1A 2OBYA 3SJZA 1ZOIA 3BK2A 4LOJA 4RA9A 4RNCA 5CXSA 2PMEA 3TW8B 1X7YB 3FTNA 5C1DA 4URHA 4ZT5A 2Q21A 2WT4A 1VJ5A 1IWPB 2WT9A 1DC3A 1VKJA 4NTZA 4C0SA 3VDQA 4C14A 1QHIA 4DR5B 1SCDA 3V1KA 4OHYA 4EMSA 1VYHA 2IYRA 1G2PA 1QFYA 1H3NA 2V9CA 2XB9A 1KJYA 5E7JA 1GGKA 3G2MA 4FFLA 1JRLA 1RHQA 1U80A 1ADFA 2VAXA 4OJKA 1WDTA 5D3KA 5LJLA 3I6YA 2FHSA 1EAYA 2NTVA 3MTDA 5AVOA 4Z4QA 1L1EA 2DPLA 3BFPA 4C6TB 2ISSD 4DRZA 1FZTA 4URWR 3BSSA 5EEGA 5LLDA 3S4YA 2EQ5A 4KU4A 1J9ZA 4BECA 1AN9A 1GCAA 1KJWA 1XP8A 4UUOA 3ZHOA 1H05A 4NP6A 4EQ6B 2OCXA 5H1YA 3GA0A 1DG3A 2BEUA 4JSRA 2Y6UA 4FDTA 2PSJA 1RI2A 1W46A 1BX1A 3WAJA 1ID8A 2ZBQA 5T4BA 1IZZA 1R0SA 1VPTA 3B13B 4R6WA 2DBQA 3VI4B 2QXTA 4H77A 3U6KA 4CIXA 3NHLA 2F8MA 2E6KA 3DBRB 3BRQA 1Z8NA 2PGJA 3GFTA 4NV1A 5LQSA 4EHFA 1H0SA 4X7BA 1LLUA 4MWEA 3DB2A 3EQ6A 5D85A 3VI3B 3U7IA 1N6RA 3A1UA 1EHIA 1EDBA 2HPAA 1IJFA 3CZ5A 5B55A 2EQBA 3U5TA 3FHTA 1CEYA 4QU9A 2JKVA 3FVVA 4Y2YA 4ND5A 2QW1A 5A3VA 3WB9A 3AJDA 5ITVA 2JEZA 4B6SA 4AXXA 4P31A 4L28A 1K86A 4XQCA 1JWAB 4ZDWA 4A23A 1FVHA 1RXSA 3N76A 2PKCA 1V71A 1GR0A 4HRXA 1EXDA 4L9WA 3L02A 3GFRA 4JDUA 3G6WA 3UA3A 1Y4DE 3FWPA 2ACVA 4ZMBA 3V8MA 1JKMA 4KGVA 4BNLA 3JASB 5C32A 4AN4A 4BE7B 2MHCA 4O2BA 2CZGA 2FUNB 3L6OO 5IBRA 5B4UA 4DJEC 2PRJA 2D62A 2NYVA 3BIOA 4N5LA 5TPZD 4YRRA 1FW6A 1T4CB 4TUYF 4Q6BA 1AKEA 4ZK6A 4HSGA 5J2TB 4ZI7B 5LMZA 5IM5A 2MR6A 5KYYB 3AY7A 4L8VA 1U8FO 3AI7A 1LPOA 2W71A 1QF7A 2C2OA 1Y9EA 2AXPA 3EAQA 3KB1A 3F6YA 3OKFA 3QHPA 5G4LA 3VAAA 3VC2A 1HE1C 2OFOA 3R8XA 4H6VA 4WXEA 5BWBA 3JQBC 5C5IA 1TKRA 1JJVA 2MYUA 3HL0A 5U4XA 4JXXA 5BYAA 2R79A 1EQAA 1Q7EA 1ZCAA 2YXDA 3KLNA 3L8HA 4MR9B 3FTQA 4QPJC 5DHFA 3NRBA 5AKLA 2AVDA 4JBNA 1FVXA 5LPNA 4LC1A 1M7HA 2R11A 3LY7A 2AFIA 2RHBA 4NPAA 4NULA 4UMFA 3UWDA 1CUWA 1E60A 1T9DA 3H5NA 1V8PA 4Q01A 4XX0A 1E5VA 3KBBA 4ER6A 2PVPA 4UZFA 4UVHA 5D51S 2HF8A 1E2GA 2VPQA 3GMIA 5IU6A 3O3NB 5JFTA 1B14A 1IRXA 3MFQA 3D7KA 1XDZA 3A06A 1UPCA 1VLZA 3INNA 4DUZB 2FE4A 3B3QA 1JHRA 1C41A 4JOQA 3NYIA 5K2MA 1R10A 4B2IA 4DY6A 1O96B 4PZYA 2CCJA 5K3AA 4UFNA 3R23A 3WLKX 4HL6A 4FCVA 3R9XA 2IKQA 3IPXA 2WJ4A 3BIFA 3Q3JB 1IN7A 2MYTA 5KQPA 4PLZA 1JLHA 3ZIDA 3R3YA 3JZDA 3GZNB 4JP2A 1ZRMA 3DH0A 1RE1A 3RJTA 1SVIA 3N3BC 3ML1A 3V8EA 3KQOA 1XRSB 5CM2Z 3H97A 3RH0A 3ANNA 1W0JD 3TLMA 2HJSA 4PAQA 3FYCA 4YROA 3TVTA 1EWQA 2FDXA 5JYBA 3LUHA 4HGYA 2R6AA 3UPUA 3T1OA 5L3SB 2QSYA 3WYAA 1V3VA 5EG5A 4WECA 4Q93A 3RVDA 4EPTA 3FYHA 4IIGA 5B3JC 3BBLA 3D1JA 4GAEA 2Z5LA 2PRZA 3I9OA 4ISBA 2QJWA 3BJMA 5F5XA 2XNDD 4X20B 4M1EA 2RH8A 1AIPA 2XE6A 2ZR8A 3UW3A 4A1OA 5KQLA 1A9XA 1Q92A 2QMZA 5K0SA 1DBIA 4RH3A 1X1RA 2I1WA 1C9YA 5MFZA 1W76A 2WG0A 1F60A 2X9LA 1OFGA 3AJEA 3ZKWA 2WFLA 3KJQA 4RD4A 2VJMB 3TMYA 5H4GA 3AM1A 3O95A 5CLGA 1MJGM 2IEBA 3ACCA 1N5RA 5FEUA 2UUBB 2I6QA 2J5QA 2Y67A 3KOXA 1Z34A 2P2GA 2VTBB 2DERA 3CF4A 3KHKA 1JIQA 1Q16A 3I9LA 1SOUA 4P53A 3E05A 4II3A 1UDWA 4B1FA 2C1XA 3D6HA 1BFKA 3I8OA 3D6VA 1HLPA 3G1WA 4DIOA 3BXHA 3PNYA 1VFPA 4OQQA 4MB2A 4H7JA 4UBOA 1CZKA 4JOCA 4R98A 4ZC1A 1UP6A 2WSMA 1Q1ZA 3GJ6A 1EFHA 3AMVA 3B3AA 3OFKA 4DA4A 2RSLA 1JG6A 2AC4A 3K0KA 4UBJA 1NL3A 4US2R 3FZYA 3TG8A 1HYEA 2NSHA 2QDXA 5G4KA 3V4RA 4H7DA 1KYYA 3RT7A 3VU1A 2VK1A 2Z8YM 4GPTA 3SJ7A 1L8AA 4CMEC 5CG2A 1E63A 1HE8B 4OP2A 5DYNA 5FFMA 2GD1O 1A5AB 5DH9A 4DIMA 1HE5A 3ELWA 5IHXA 2F9FA 2FLKA 5LN1A 2ILTA 1A9TA 3H2ZA 1SQ5A 4Z9FA 2WM2A 3LDHA 3SEAA 3DHWC 1TRKA 1R1DA 2ZB3A 1P3Y1 3SZOA 3UY4A 4AL4A 3K15A 5GY7A 4B34A 3CZ9A 1CZRA 3F8SA 3QU4A 5TPWB 3ICOA 2W8ZA 2ZJ5A 3HJUA 5EUQB 1UBSB 1EP3B 1NRIA 4WDQA 3CVUA 2V55B 5EGNA 4BNNA 4AP9A 3OF2A 2WP8J 3FUTA 1P4GA 2IYYA 1IOZA 1L4KA 1XD8A 2QIPA 3HM2A 3HNRA 3HXMA 3DMPA 2P65A 4BZZA 5ED4A 4C0HA 3ZNQA 1XZMA 5M2QA 5A3QA 2ODEA 2PUVA 3O31A 4EPVA 4YHHB 4U5XA 4WAUA 1YJAA 3GCZA 5F98A 5EHIA 1SKAA 2VHQA 3DWFA 3EBPA 4GMKA 5AJHA 3U2QA 2QRLA 1MEJA 1FTWA 3BMQB 1CY8A 3R74A 1KZGB 1TKBA 1YL6A 2J0EA 2O2EA 1KARA 3HL4A 5CIWA 3VU8A 4L5AA 2ZCJA 3KB6A 1FYVA 2PMWB 3QOFA 3FOWA 4LYGA 3FPGA 1FNCA 1RAFA 1AU9A 5DWDA 3ITDA 3DDHA 3NVKI 4QTZA 5HZKA 6GPBA 3VQTA 1A5TA 1QR2A 4ARZA 5AK5A 2M6RA 2GRAA 3D02A 1DCTA 5JNWA 4PR0A 3U37A 4JP8A 5EA2A 4WZBE 3H5RA 3N74A 1YL7A 1NKSA 3KKKA 2JCGA 4X63A 1ZICA 2J7PA 3HSKA 2QX7A 3OMWA 5SZHB 3BIWA 2OZLA 1UWKA 3PWKA 2DFPA 4KUGA 1L7MA 1SD5A 5JS6A 2A2ZA 3EXIA 1WTCA 1A50B 3KDAA 3GXOA 4BLPA 1RCFA 3OZVA 4CF6A 3W3ZB 3UT6A 3FTCA 1SXPA 3K8OE 1J06A 3ZWCA 4AF6A 2B25A 3P9RA 3MW8A 2VH2A 4QODA 2C00A 3B38A 2EGGA 3KZKA 721PA 1M6NA 1PBNA 2PSHA 3K16A 3LWZA 3DPIA 3QBDA 3EUWA 3SEZA 4O3MA 3LVQE 3KKNA 4KOAA 4N1AA 2G1JA 3GFGA 1JKFA 1X7WA 3DE0X 5LJIA 2OCLA 2WSSD 1F17A 1UKYA 4I08A 4IDBA 5TQ0A 4BCDA 3TIFA 1ZI8A 3EDQA 1NUUA 3L7NA 4Y2JA 1U0JA 5CFMA 5K01A 1RKXA 4HXFB 4TRMA 2EXXA 2ID7A 3AZQA 5EUMA 1IYZA 3LDAA 3GPBA 3IMEA 4N82A 3VSEA 4HVCA 2R7LA 4MLPA 2E1PA 1I6MA 2FWJA 3QM1A 4TLBA 4G6ZA 2A88A 2GEKA 2HYDA 1FRQA 4RK6A 3ZN2A 4KYUA 1CY2A 221PA 3EJ6A 3QFSA 5JSUA 3B6IA 2GM3A 3NOOA 2SCUA 2AKEA 1JP7A 3C5WP 1EUCA 1TDJA 1Q7TA 3D0QA 3F96A 4UPVA 4Q9LA 2NSYA 4ACAA 1UM9A 4J49A 2BD0A 1QQ5A 1E2HA 1JG4A 2DRIA 3ROXA 1B3BA 2PX5A 1R00A 2QT1A 1ETHA 1JBKA 2FSVC 2XVZA 3T3PB 2F55A 5GM2A 1UADA 1WSDA 4E3WA 1NW5A 4HRVA 4GGOA 3VU9A 1JAIA 2UKDA 4LGVA 5AJWA 3PNOA 1M9NA 3MJHA 3NBQA 3V80A 1NG9A 2ZUFA 1A1SA 4WLFA 2W6JA 4E5SA 3PE6A 1U1GA 1JHMA 2DTDA 1JDVA 4JOSA 4RXMA 5K0CA 1V8FA 1XU9A 5F9FA 2RK3A 3K9HA 5H70A 3HY4A 2FPRA 3HKCA 2GZDA 5CG1A 1MENA 1UXOA 1XDBA 3K1TA 3BCRA 3W5IA 4DY4A 1HI9A 3PF8A 1EE2A 4JUAA 3AFHA 3B5JA 4GH5A 2Q6VA 3U4GA 3UJHA 2HHCA 1CJVC 1FTGA 3R20A 5B1SA 1KMNA 2H57A 4WVLA 1MX3A 2PH5A 4MAMA 5DM70 1EQUA 1N8NA 4IMPA 2G09A 4R9VA 3R7SA 2JHGA 3ZQUA 1LTQA 3GP3A 1SOVA 1PGOA 3W5CA 1K8RA 1Y9AA 2XCOA 4TTIA 3KSZO 4IICA 3PC8A 4BL5A 1FXSA 5AIBA 1W4CA 1T9HA 2GM5A 4HD8A 5EZQA 1QNFA 1U2EA 4OHUA 1XYGA 4UKDA 2P4UA 1WWKA 4IQFA 4YP9A 1IQPA 1NDQA 1Z6ZA 2GNAA 3ADBA 8MHTA 1P6XA 4DQXA 3G9QA 2QW0X 1K66A 1KFJB 4FOOA 4OQDA 4GXNA 3MWLA 4AKGA 2E85A 4XEHA 4DJ5X 3H16A 3UB4A 3D4BA 5IYZA 3Q5GA 1TM3E 4BU1A 1B1AA 2P27A 2R84A 2I66A 2CMDA 3QLEA 3CF6R 3R6LA 5EXDA 4YUXA 4Z7OB 1FXWA 5CXQA 2Z30A 3F49S 3AVYA 3TFQA 2EERA 1SKBA 1J39A 2AQKA 1RJ9B 1PWZA 3AEUA 5BSMA 3BS4A 3I4LA 3LI2A 5ALNA 3ZE7A 3UJ3X 3N3AC 4V0SA 3GFBA 2NXWA 3I53A 3PX3A 3N58A 1V8DA 1NF3A 3RHTA 4BNZA 5AVXA 2ZXFA 4FMDF 4ZV9A 4QLAA 2DT8A 2OVFA 2PNFA 5JEDA 4PG5A 1L3CA 4AWXA 4DV2B 2QRNA 4CBVA 2KMLA 3JQFA 4HDNA 1X14A 2K6GA 2Z3WA 3NHFA 3KLMX 4P86A 2EIHA 3P2KA 3GLFE 4KQWA 2QVGA 1TYZA 4UC0A 1XL1A 3IE0A 3Q8WA 2H9AA 2WYVA 3KE9A 4UM9B 4LK2A 3M89A 1AXRA 2A3NA 3HA5A 1MO5A 4ALNA 4ZYUA 4QO7A 1ZY2A 3WE7A 1LPBB 1VP9A 2HHAA 4QARA 1NUTA 2XB4A 4MEAA 1SO8A 4RDIA 2UAGA 3L0DA 4F4CA 5K0BA 3HKBB 1QK3A 2O8CA 5CJPA 1U2DC 1ZP6A 4ZODA 1UKCA 2QUZA 4UUAA 1E7SA 1E79D 2F1IA 5DSXA 1YL5A 1Z7EA 3L1JA 5C37A 4F12A 2FPGB 2CBXA 3AGQA 4WK2B 1D7OA 3SHVA 3T7KA 3VKVA 3T0GA 3OICA 2R68A 1IPFA 3PHIA 1CQJB 5CM9C 3SDSA 4O59O 1TJ3A 1E0JA 3ZUPA 5BSUA 4ZAGA 4GOOD 4MQEA 1JQEA 1MCZA 2G9UA 3IS3A 4BQFA 3PNPA 3UK1A 1QOQB 4RZ2A 1IG3A 2BH9A 1AUXA 1QYIA 2Y4OA 4TXLA 2RBKA 3AM3A 3ZJ5A 1TJPB 1LC3A 3L6UA 1TZCA 1XKTA 1D8AA 4FFPA 4IDGA 4XKJA 5ARBA 3OZBA 2A5JA 4QLOA 3BGIA 4DCUA 1HQDA 4HGZA 4YV1A 1NQUA 4S0ZA 2NV6A 4LEIA 3SZUA 2ZIXB 1DRWA 1DV1A 1M75A 3Q8XB 4P1ZA 4PANA 3TI7A 4R81A 1O87A 3X1KA 4B33A 1HWYA 5A0TA 3EDOA 2YMQA 4NDAA 4OB7A 1P75A 4LA4A 5E7MA 5CA1F 3R9KA 5CFQA 3ZX4A 1YJCA 3Q9UA 3OTGA 3SS7X 4YMGA 3MRTA 5EZYB 3CRRA 1F4LA 1AKVA 1RMYA 2WMYA 3AG6A 2NP6A 5HHTA 1M2VB 4D9GA 3CE6A 5J63A 3Q9LA 5H02A 3AJ8A 1XDSA 1Z4QA 2NUTB 5E9AA 1NURA 3N2NA 3WIUA 3OT4A 5JT1A 3EGXA 4I5GA 2I67A 5TF0A 1U7DA 2ZRCA 4CMJA 1G59A 5C34B 3VHQA 1RJWA 5CVEA 5CYPA 1DOAA 3G9XA 7ADHA 2X1HA 2EWWA 2SECE 3VJRA 1VCMA 5F73A 2FUCA 1OBOA 1QCDA 2OV8A 3PLRA 4G9GA 4PHTA 4IFTA 4QPPA 4ZA2A 4C29A 4EB6A 2AXEA 5J2UB 3L8FA 2HNAA 3G85A 4TTSA 5IJ9A 1FYWA 1VECA 5FHRA 1WCWA 5KNBA 3DWEX 2HMUA 3GUHA 4UTOA 5JATA 3WXMA 1QLWA 2HU7A 3AEQA 3ZU6A 1GEEA 2GJAA 4O4JF 3KQTA 4DLSA 1P2GA 2OY0A 4GZLA 4C22A 4ZEXA 5HKKA 3WKBA 1KERA 4PZZA 5A1JA 1WZNA 1XCGB 1Y1TA 2D54A 2P1ZA 1UBJS 3ADKA 3AOGA 3DE5X 3DV2A 3IAAA 3LTEA 3LX5A 1XTIA 3NU1A 1NU8A 4WASA 5AM4A 5ER6A 2LGJA 3B3GA 3VH2A 4BNDB 4F2DA 3IBFA 2I3GA 2IY7A 3CY6A 4QUJA 3R5JA 3JRXA 3UANA 3VPAA 1JKJB 2O7NA 2P1RA 4LDPA 4TWRA 3SEQA 1N2XA 4UE6A 5EQFA 5DNEA 2XE4A 2I1LA 3TNYA 5J23A 4I2VA 3W3AA 5G2OA 1VSUA 2OFPA 3MVEA 1H5QA 1H2ZA 5IMSA 4LHYA 5EP4A 2FG6C 4OCZA 1GTVA 1JTFA 1QUEA 5M29A 1VI2A 3E3OA 3HRIA 4ARIA 5HP4A 3KJZA 2I2AA 3L7MA 3MINA 2H17A 3R0XA 4ZCRA 1N6PA 3ELDA 4MV7A 3NTLA 1L1FA 1OBHA 5FTJA 1CDZA 5CK4A 1Y6RA 2QY6A 2VUTA 1BROA 2XKAA 4PCAA 1UK8A 4S1VA 2AH5A 4XLZA 5DFAA 3DUWA 1N3YA 4UHJA 3TZ6A 4KJZA 3HCRA 4LQLA 3ZCQA 4LRYA 6YASA 1NFFA 2XCLA 3Q15C 2ZE6A 3K71B 5C9ZA 5H9WA 2JAOA 2D1YA 2X6TA 4H4EA 4B82A 5HQ3B 4BV3A 1VTKA 2Q5LA 5CX1A 3M4JA 3LRXA 2BGKA 3EBLA 3P9XA 4IIXA 4P7FA 2WSLA 1DAEA 3ZDEA 5TE9A 1JEYA 3SN6A 3UA4A 5DBFA 3U81A 1EGAA 4MO9A 5IARA 3EZ6A 1O54A 3BB4A 1CFJA 2NZJA 2R6R1 1CJBA 3O8QB 1NFRA 1HT2E 2PKXA 2H5LA 2UYQA 4JL5A 4PFQA 1QIHA 4B3XA 4F4IA 2XYGA 4L5YA 1IEWA 3K1AA 4TOIA 3R7WB 4B83A 4DBZA 4ZVLA 4B5LA 4HNUA 1JAYA 2QKYA 8ATCA 1NUQA 1Z0JA 3DV0A 3M6IA 1QE5A 4L50A 1RYYA 2FP4B 2OHOA 1JJBA 3FGNA 3WJ1A 3O9MA 1DTEA 1TVKA 3M2TA 2I9KA 4UM9D 5IEBA 3ZY4A 3DULA 1ULSA 3KQLA 2DLCX 3GU3A 1E1LA 3QKUA 4C7JA 4OQFA 5KDLA 4M4SA 4TM7A 4JJEA 5D6NA 1DTWB 5JG7A 3CEAA 3F4KA 4N8EA 1OAAA 2HLPA 3TL3A 3WRXA 5IVKA 4JXKA 5CU7A 4BO3A 4QDZA 4FDVA 4NS4A 3T0FA 2XYVA 4RXTA 4MPTA 4B87A 1KY5A 3E7PA 3KBOA 1Z37A 2WAAA 4YJ3F 3NH6A 4S35A 5CFLA 3DDCA 1A27A 2ZP1A 2VXYA 1KI4A 3JARB 5AI8A 1EK6A 2QLFA 1VA4A 4GW3A 4IILA 2OPHA 2X6QA 4OA8A 2O4UX 1ESDA 1JFSA 4RD3A 1KU0A 1ZJJA 4Z4GA 2HU8A 2HX1A 3ZGLA 3HXOA 1FP2A 1EGVB 2PD4A 2PRIA 4XOIA 4XQGA 1KVTA 1W85A 3UGJA 4ZOLF 3DPUA 1YVRA 1JHUA 2VHCA 4B73A 5B30A 1Q91A 1W0KA 4FEGA 2ZJFA 3CR3C 1QGED 3PUYA 2PXHA 3NAZA 4IJVA 4FZ3A 1W93A 2OGUA 1IXZA 1KE2A 3CUEF 2ANCA 3T3DA 1MZPA 1WHTA 3RT9A 2BF4A 1K2VN 1MGPA 2P78A 3I30X 4MPDA 4ZQIA 5GONA 4H0FA 3F1LA 3KUXA 2PUGA 3K92A 4YP1A 2CWWA 2FH5B 1QE0A 5HZGA 3BDAA 5WRFA 1STOA 1GPLA 1IATA 3H5LA 4C0XA 2NU8B 1KDYA 2ZIFA 1TKAA 2R66A 4NZMA 5A9SB 2P2CA 3IVRA 1XRJA 3CX4A 5GINE 1Y33E 4ZVRA 4C6RA 2VWQA 1RC0A 3I5YA 3FMIA 2O05A 4LDJA 3E0QA 3SK0A 3MCAA 2DFLA 3DFFA 5IP5A 2O4CA 4P80A 3LC2O 1QHXA 3P2EA 1JA1A 1H4VB 4MQ4A 2OQRA 2WVHA 1QIGA 4LGMA 1XWWA 1P7VA 4QGHA 1F3OA 4WWHA 5HBGA 1L7XA 5AM3A 1GQQA 3THWA 1DAMA 2PZLA 2CB9A 4NPHA 2WY2D 2I7CA 1HNWB 3ER6A 5T8KA 3LQ2A 1A7KA 3NHYA 3Q1LA 2QMHA 3ZZ1A 1KVSA 1KQOA 5HZMA 3ZZMA 2AA3A 2GXAA 1QC5B 4GM0A 2ZPTX 2AZXA 2W2QA 1JW9B 3GNSA 3UWPA 4R1LA 5FWNA 1X3SA 4JZYA 2DWQA 5JWRA 5B3KA 2J3KA 1X8XA 2WA2A 1JHZA 1JU3A 4GEKA 4OLFA 3IP9A 4QPCA 5E6SB 2NUPA 1AKMA 2B3DA 2WJVA 2ZJZA 4EJMA 1OLXA 5KYXA 3G2OA 3MGKA 1VPEA 2IHTA 4OXKA 4AAYA 1UJ6A 1WMAA 3M6AA 2CEAA 4CTKA 3EGCA 1SCUB 1VBNA 3G5UA 5CCXA 2ZTVA 2XWSA 1PN3A 1PR5A 3W6ZA 3FAKA 1W5EA 2YXBA 5K3FB 3EZFA 3V7WA 1W87A 4RIGA 5J43A 2QT0A 3FCXA 5HE8A 1JHAA 4FW8A 2B2CA 5DGHA 1B00A 3A6JA 1HSZA 4MVCA 4FNOA 4JLWA 4OK5A 4R2IA 4XFDA 3PYMA 4U7HA 1MPTA 4WL0A 2ECPA 1A7UA 4RAOA 3MELA 2FLVA 5TVGA 3WGJA 2GSDA 2V7TA 1CS4C 4LJ9A 1WW2A 4HGNA 5DWQA 4E12A 5DHTA 4KDRA 5TDHA 2XQFA 4DLAA 2ZTSA 3DEFA 3KWFA 2C4VA 4MV1A 2PLAA 4HBGA 4P22A 4PIVA 4CMAA 3TTTA 1USWA 4IMJB 1VLLA 4P5EA 4EA8A 1ZCZA 3S8YA 3GPLA 1REQB 3M2PA 2OYRA 4I4TA 3RARA 1FLDA 1BE8A 3GLKA 4K6GA 5DYIA 5K20A 5D5PA 3R5XA 4BJ3A 2FQWA 2VDUE 1GUAA 2GXUA 3QVUA 5HCNA 4CXMA 2JLRA 3QSYA 3A9RA 3K4QA 4KPUA 1YUMA 4BP8A 2J0UB 3ED5A 4P7KA 3RRYA 2P91A 3RBVA 5HIMA 3BCSA 2WLSA 5HTKA 5L7WA 1YI1A 1YD7A 4RZSA 5HIJA 4NV3A 4UJ3A 4AG3A 3UIEA 1S2NA 3K6RA 2GHQA 3PITA 3CH7A 2CVFA 2ISCA 1XMSA 3A04A 4HMPA 4F45A 4Q4JA 1RAIA 4HAZA 1KA9H 1GPBA 1OAKA 2GRUA 2ZGVA 4D79A 3TE7A 3EK2A 2VPWA 4D4MA 4KAJA 3CLHA 2I2CA 4LI3X 1QO0A 4KNWA 5JQGF 4XGNA 4IGKA 2J0QA 1D6SA 4A8TA 4ZYZA 4J16A 3DUFB 4MUXA 2BSAA 2C03A 4RVOA 4BB6A 1QSGA 3LDGA 2BKEA 3PYLA 4JEIA 3MXOA 2LPMA 3OVMA 3TQHA 3PWTA 3TTUA 1EI9A 1F8UA 4I2NA 5AVYA 5EJMA 4RPLA 1QH8A 3LUGA 1A9RA 1DEHA 3ZV3A 1L5WA 4MYDA 1EK2A 2HRQA 3GJ8A 4IXMA 3VSCA 1R18A 4WESA 2VCEA 3KR2A 2ZRDA 1R0LA 5KOIA 3EGWA 2DLDA 4KSYA 4NG4A 4R8LA 5IW8A 5HQTA 3OE4A 4I55A 4OM7A 4PS1A 4TZTA 5KTOA 1GAEO 1L7QA 5AK0A 5ETJA