1HA6A

Nmr solution structure of murine ccl20/mip-3a chemokine
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
b'ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE INFLAMMATORY PROTEIN 3 ALPHA
publication title NMR Solution Structure of Murine Ccl20/Mip3-A, a Chemiokine that Specifically Chemoattracs Immature Dendritic Cells and Lymphocytes Through its Highly Specific Interaction with the Beta-Chemokine Receptor Ccr6
pubmed doi rcsb
molecule tags Immune system
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ha6A00
2B2WA 1PFBA 4ZAIA 1KNAA 3IFDA 2BDNA 4U68A 1G6ZA 4RWSC 1F9QA 1X3QA 1EQTA 1PLFA 1RODA 2FHTA 4IUPA 1G2SA 5E4WC 5EPLA 5EQ0A 3N52A 1NCVA 1IKLA 2HCCA 2JYOA 1WTVA 1WTRA 4LMQD 4X3UA 2CVRA 1JE4A 4UAIA 1CA6A 1ML0D 2B2VA 1B2TA 2NWGA 1ILPA 1HA6A 1B3AA 2M2LA 2L9HA 1CA5A 3HP3A 3ONAB 1DOMA 4IUUA 1A15A 1HRJA 1AZQA 5EPJA 2NYZD 5CMDA 2MPMA 2MP1A 2KECA 4OIKA 5EPKA 1HUNA 2B2YC 1SSOA 2IL8A 1XX8A 2X69A 1EL0A 1BF4A 1JICA 2HUGA 3GV3A 2Q8TA 5EKIA 1F9SA 2EE1A 1U4MA 2NZ1D 4XT3B 1PFNA 3F2UA 3Q6SA 2VXWA 4ZKCB 2FJ2A 3TZDA 5D65A 2B2TC 3MWYW 2H1EA 1G2TA 2L4NA 1LV9A 5CBEE 2R3ZA 4HEDA 4R8IA 1BO0A 4O42A 2K01A 2L12A 1WTQA 4HSVA 1QNKA 2MJ8A 4RA8A 3DEOA 4QUFA 4ZKBB 1WTPA 1DOKA 2KEDA 4CJ0B 1S4ZA 2L11A 4R9WA 2N55A 1U4LA 2HDMA 1J9OA 5D14A 1O80A 1MI2A 1MSHA 1DOLA 1HFGA 1RJTA 1ZXTA 1WD1A 1DZ1A 1AZPA 3P7JA 1QG7A 2L1BA 1B53A 3DEPA 2B2TA 2X6GA 2N88A 4XT1B 1HUMA 4NW2A 4X3KA 4CJ1B 1HHVA 2HDLA 1ILQA 2D9UA 4RAUC 4HCSA 1GUWA 2K03A 4ZLTF 1WTOA 1NAPA 1F9RA 1NR2A 2K05A 5EJWA 1QE6A 1F9PA 1HFNA 2KEEA 1IKMA 2EOTA 1CM9A 2J7ZA 1DONA 1TVXA 2B2UC 2SDFA 2DY7A 3I8ZA 5T1IA 3KUPA 2B2YA 1WVLA 4IUQA 1M8AA 1X32A 2X6LA 3QO2A 2MGSA 1WTWA 1ESRA 3UI2A 1O7YA 1PFMA 3LWEA 1SAPA 1PDQA 1B4OA 4OIJA 1EIHA 1O7ZA 1G91A 1MSGA 2KVMA 2K1BA 1XYIA 1VMCA 1B50A 2EPBA 3FPUB 3DM1A 1MGSA 1BBXC 2K04A 2FMMA 1ICWA 2B2UA 1U4PA 1RTNA 4MHEA 2FINB 2KUMA 1EOTA 1U4RA 3G7LA 5DNFA 1J8IA 5CBAE 2Q8RE 1Q3LA 2RSOA 3I91A 4IUVA 1VMPA 4HAEA 1WTXA 1IL8A 4QUCA 3GV6A 5T1GA 5JJZA 1NR4A 1F2LA 3IL8A 2XIWA 5COYA 4DN4M 2B2WC 2DY8A 2RSNA 1WD0A 2K28A 1RTOA 3H91A 4MN3A 4X3TA 4ZK9B 3TN2A 2RVLA 4IURA 3FDTA 3MTSA 1SDFA 3I3CA 1E0BA 2RA4A 1C8CA 4IUTA 1X3PA 5AFWA 3R93A 2JP1A 2B2VC 4XDXA 4CJ2C 1RHPA 4X3SA 1BNZA 1AP0A 2HCIA 2FFKB 5E4XA 2KOLA 3I90A 3SVMA 3D6WA 1KNEA 1EIGA 3KBXA 5CORA
chains in the Genus database with same CATH superfamily
3IFDA 3QOLA 1Q90A 4DV1L 3FVQA 1EQTA 3CCRA 1RODA 2JA5G 3AYHB 4K0KL 3AFPA 3G48A 1K8OA 1YNXA 1TKWB 4BXXG 1AE3A 5DM73 4A3LH 2UUAL 4POGA 1CA5A 1FNVA 1XPUA 3RUZA 2YTYA 4JI8Q 1IZ6A 1C7YA 5E7NA 3KJPA 1K8MA 5EPKA 1BDOA 1EL0A 2AKWB 1HNZL 1S3OA 2XRSD 4BY7G 4DF7A 2VB3X 4B9XA 5BN4A 1SE3A 1I4RA 1VQNA 3MWYW 1PTOH 3I4MH 5FLXc 2N8NA 1WTQA 5M5WB 3D0FA 5C4ZA 2L15A 4WRDA 4XQQA 4X66L 3S2DH 2HIVA 1Q7YC 1RJTA 5IWAQ 3HOXG 2CH4A 4C3JH 1H9RA 5IP7G 4OO1I 4C3HG 5K5PA 3G6EA 2BH8A 1XNQQ 1HFNA 1IKMA 1E24A 1LM0A 4UP8A 4QCLA 3L9AX 1BVSA 4Q0FA 1HNWL 3GTOH 2B2YA 3BZCA 4IUQA 4A76A 2BOSA 4H02A 4G57A 2B8GA 1E1OA 4QMGA 1PTOF 4A3EG 5FLXL 1YVCA 3JAMc 1EIHA 4KK7A 4OIJA 5BN5A 4DR1Q 2K04A 1YJWA 3Q23A 2Z9HA 2A19A 4QY7A 1O7IA 2KUMA 3FHWA 1S5BD 5M5XH 1AN8A 5J22A 5M3FB 2PQEA 1M4VA 4IUVA 5GQOA 2I5MX 3M7NA 1IL8A 2CKZB 1C48A 3KK7A 4DV4Q 3NWTA 1HH2P 1P8LA 3CMAA 5JJIA 3TP8A 1N36L 2WB1E 4NMZA 2OQ0A 2RA4A 1B50A 4CJ2C 1AP0A 1NMFA 1GM5A 1NMGA 3MAQA 3NELA 4LW1A 1FVIA 3JAML 4A3BG 1ZEQX 1PFBA 1JWSD 3NK9A 1X3QA 1G2SA 3H3VC 1LTTD 3A5UA 3CCEA 2M2LA 5KYIA 4JBWA 3SK6A 4JYAL 3MFYA 5JAVA 3PGZA 3T1YL 3K6OA 4PQXA 1TWGB 4MZ9A 5JEAH 1TY2A 4DV0L 4BY7B 1M1KC 4FP5D 2K52A 3FPPA 3TZDA 1ONLA 1ENFA 5CBEE 1TU2B 2EYMA 3EJIA 2Z4IA 5FO7B 1CSPA 1C4QA 2XTIA 2EJFC 2AQ1B 2AUKA 3H6MA 4K8JA 2BDOA 2L11A 3JAMi 4DV5Q 1XMQQ 3PO2H 3TRZA 1ASYA 1FJGQ 1J9OA 2E2IH 4UP9A 1R9TH 4L5SA 1LO5D 2JK8A 1HTLD 1Q8KA 3HOXB 3A8IE 2Q2HA 4KJNA 1VQGA 3GTJB 1GUWA 1JB7A 3S2HH 2KEEA 1H9KA 5CV9A 4LF5Q 4JI0L 3GTGH 4FDBA 1EIYB 4X62L 1FD7D 2DJFC 3OMCA 3ERQA 2VB2X 1PRTD 3SHLA 4YY3L 5C0XJ 2MGSA 3U9SA 3UDXA 1B4OA 3M3YB 1VQ7A 1L1OC 3OHXC 1JJCB 1CQVA 1SYCA 2FMMA 2UUCQ 1E1TA 5E1FA 3ND8A 2VW9A 1E7ZA 4JCVE 2K5DA 1Q3LA 1UE5A 2ALYB 1ZKOA 5FKAC 2BCOA 3EN2A 2QEXA 5JVH3 4FF4A 3AB9A 3IL8A 1SMXA 1S5DD 2A5HA 5AJ3L 2K7VA 1XPOA 3IAYA 3HOZH 1I4QA 4MN3A 3RNUA 4LF6Q 2F4IA 4AYBG 3FDTA 1KIXA 3I55A 1MIUA 5IGGA 4DK6C 1QZGA 4LFAL 3R93A 1NUCA 3E3XA 2L0CA 4QJFA 4FF3A 5KYLA 2LXKA 5IYDG 4WJWA 3F2CA 3K7AH 1KNAA 4A3BB 4GKJL 2VQFL 1XNRL 2FHTA 5EPLA 5M3MB 4RH6A 2MQHA 4RHSA 2EY5A 1IW7C 4CDEC 1A2TA 4KY7A 1HR0L 1TIID 2NN6G 3LWUA 1BBUA 1K8GA 5C3XA 2RDFA 4K0KQ 3OTOL 3QJYA 2MPMA 1FGBD 4XYQA 4QQBX 2UUAQ 4X65L 2XWJB 4A3LG 2A6EC 4A3FH 3R3OA 1OXTA 4ZKCB 1U0LA 5C6AA 1HZCA 4P73A 3M4OB 2E8GA 4J6HA 3D8GA 4R8IA 5L37A 1D5MC 1JT8A 5EBDA 4XYOA 4B3TL 2KEDA 1EFWA 1EUJA 3IKJA 2H4OA 3TP6A 4OELB 2IX0A 2RKSA 1H9JA 1DZ1A 2E2HB 2AWOA 5IY0A 3I4MG 2X6GA 4AQYL 1PRTF 4IFDI 3A7LA 4X66Q 1WFQA 4NPSA 1QE6A 2TSSA 1F9PA 1STHA 3CMEA 2AWNA 2EYLA 1DONA 3D4DA 4C3JG 1JWMD 1OXVA 4DV6L 1G8ZD 2OCEA 4GN5A 2O2LD 3QG1A 1LTGD 3A8JE 3CRLC 3M7GA 4RCNA 4HJ7A 2JQOA 1A8VA 1ZYRC 3IRBA 1XYIA 4KHPQ 1BBXC 1JOQA 1QUQA 1DCZA 1SE4A 1U4RA 5ISRA 1VQDA 3H3VH 4PV1C 3RR5A 5J39A 4WJ3M 2DGYA 3AFQA 1K3RA 5CV5A 3I4OA 3RD4A 1QVGA 1IBKL 3S1QB 3CF5A 2J4XA 2F0WA 3VYTA 3WOEA 2NZHA 4UY8C 2NBFA 4B08A 1FGUA 4G7ZC 1IYVA 3CU7A 1JCKB 4R4QA 2OQKA 2K32A 1SYEA 1GHJA 4KY5A 1QWYA 4BS9A 2JEAI 3NQTA 3T16A 1Y69U 1K8AC 5CR3A 1JC7A 1TS2A 2CVRA 4KD4A 1ML0D 3RN5A 4FF2A 3MC0B 3H15A 2EDGA 3K5MA 1PH9A 1A15A 4DKAC 2YTVA 5EPJA 4V190 5ELBA 2LY7A 4MNOA 1LACA 1YJNA 2YTXA 1JB3A 2GVBA 4JYAQ 1Y8PB 3K7UC 1BCPD 4F88A 2IX3A 1FL0A 3TBIB 2A69D 5M5YB 2EQSA 1LT4D 2F0GA 3GP7A 4DR3Q 4ZUJA 1CHQD 3A56A 4JI8L 2K01A 2E75C 5JEAG 1UUPA 2B3GA 2OWOA 2ZTCA 4CJ0B 4XQNA 4YCVA 1A6XA 2EYJA 3PV0A 2KA7A 3J7A5 2QA4A 5I6WA 4MTKA 2IY5B 1PTOB 1VQIA 1AFPA 2RCNA 1KRSA 3L0OA 2K03A 1I5FA 3VR4A 3S2DB 2F0JA 3OW2A 1CM9A 3K0YA 5A2QE 2E2JH 2F1MA 4YIJA 4C3JB 1E2WA 5IWAL 1TWAH 4ZCKA 4WORA 3J81j 2X6LA 1WTWA 1V1QA 1G91A 1STYA 2J0TD 4Z9CB 2A68C 4DK1A 4X62Q 3FPUB 4QL5A 4LFBQ 1MGSA 2ZTDA 1RTNA 4YY3Q 2FINB 2Y0SG 1EOTA 2F0MA 3GTOB 3J7AF 2A73B 2JN4A 2RSOA 3CCQA 1D7QA 1G6PA 2PMZB 1SYGA 4DR1L 1R4QB 3W2DA 2F0KA 1PTOC 5IYBH 3OWEB 5M5XB 5AJ3Q 1X3PA 4XDXA 3W5OA 2O5IC 1KL9A 1Q8IA 3HOZG 3KBXA 1Y1VH 4DV4L 3NTIA 2QDLA 4K8IA 3OSOA 4FO2A 4DUYQ 3RLFA 3SK8A 3BYTB 2JYOA 3PIOA 1PYSB 1KQSA 3M4QA 4P72A 1BCPF 4JV5L 3MXUA 2A8VA 4A93H 4EQ5A 1PZKD 3TQYA 2PCFB 1LTLA 2WIIB 5M3MH 2ZJQA 3HOWB 1WCMH 4DAYA 3PIP3 4TSSA 1B7YB 4FXDA 4DXGA 3OTOQ 5CC4A 1U4MA 2K14A 3F2UA 3HKZE 4J1MA 3U58A 2D0OA 3J81E 3P75A 3G4SA 5GAGC 1TR5A 2XWBB 5I4DA 1M90C 1SNOA 1I6HH 4NXMQ 3S17H 2NTSA 2D62A 4A3FG 3J80c 4BBRH 1I4PA 3CP0A 1HFGA 2H5XA 1E3PA 1EZ6A 4DNIA 4DAVA 1V43A 3C1FA 3P7JA 3N6RA 4A75A 3GTLH 3CW2C 3HOVH 3OWFA 3LGJA 1QVFA 2R7ZH 3PO2B 2IHFA 2E2IB 5JJKA 4DV5L 4AQYQ 4N9PA 1C9OA 2DY7A 4UHVA 1LTID 2UXDQ 4DV2Q 4OHJA 3HKSA 2Q2TA 5IT9c 5G3LD 3HOUH 1EYAA 3QO2A 2K50A 3JC66 3S2HB 1T5XD 1JOOA 1MSGA 2KVMA 2XN9C 4FVMA 3V96A 1VMCA 4PZ8A 1WTHA 1I4GA 3CC7A 1H9SA 4LF5L 3J80L 1X56A 1FNWA 3OMGA 4A3IH 2AMCB 2RBMA 2Y0SB 4RCOA 1E2ZA 3NTHA 3I91A 5KNBA 1WTXA 4QUCA 1HQRD 2NVYH 1NR4A 2ZM6L 4QB4A 1RTOA 3H91A 2PQAB 2NTTA 4ABNA 4HIKA 2UUCL 5C5LA 3K5NA 4RGNA 1SXTA 4ZQ3A 1C8CA 3NBIA 1S5ED 4IOCA 3S1QH 1UEAB 2Z6KA 1S5FD 3HOZB 3ULLA 2PPBC 1CZGA 4G4KA 2MO1A 4LF6L 1B70B 5E4WC 4RGMA 4X3UA 3W1BA 5FO9B 3F2DA 3T51B 1YZ6A 2B2VA 2NWGA 1B3AA 1QUQB 4GZYC 1KDAA 1BBWA 3HP3A 3ONAB 1QJOA 1QB5D 4CDCC 1UE7A 5C4HA 3T53B 3F1ZA 4GOPC 2F3IA 3SEBA 3R8BA 1YEZA 2SOBA 5IODA 1YNND 1PRTB 2QDBA 4X64L 1YI2A 1EQRA 3NSWA 3HKZG 1GJXA 4NP5A 1WJJA 4O42A 5C3EH 2MJ8A 4DXFA 2OXPA 2F0SA 2HDMA 3DUZA 5M5YH 4A3FB 4FF1A 1MI2A 4NKLA 2IPKD 4H44C 2Z6BA 3KYHC 3KLWA 5G3LF 5KNCA 4N9TA 1OXXK 4K5WA 3PUVA 1Q82C 1WTOA 4JI6L 1X3GA 4F7XA 1H9MA 2SDFA 1SFOB 2L5TA 2KCTA 3HG9A 1HNXL 4O0AA 5D3DA 1CK1A 3QIAA 3E5SA 2EY2A 1B9NA 1PFMA 2TMPA 4R4CA 3K57A 3I70A 2JA6H 1PRTC 1UNSA 1U4PA 1Z6HA 2MNAA 3NTKA 3J7ZC 3ER0A 2I0QA 3D3RA 1VS0A 3BG3A 5HY6A 2WAQG 1EY7A 2XIWA 2AQ3B 3FMCA 4DN4M 2F4VL 4XIGS 4KHPL 2VUMH 1LLRD 4P2CB 3I3CA 3M4PA 2YV5A 5LL6S 4OWXB 5ELNA 3MHBA 5EAYA 1BOSA 3D6WA 4XQJA 1PV4A 2ZJRA 1NY4A 2LFNA 5JEAJ 5IYBG 5E3FA 4CHTB 4NXNQ 1ENCA 1GHKA 4JOIA 3A0JA 4X6AH 1DYQA 4GN4B 1Y1VG 5FJ8H 3F8TA 1QCBD 3KLSX 4L5TA 1AZQA 1Q1BA 2UU9L 4JV5Q 3DLLA 1XX8A 3MA2B 2KCCA 3GDEA 1HZBA 3U4VA 3CXCA 2PW5A 4YWLA 5IE8A 4DV3Q 2R93B 4CKEA 2NVQH 4S3SA 4A93G 1L0YB 1L0WA 3HKZB 5M3MG 3HOWH 1CSQA 2Q8IB 1GD7A 1WCMG 4HEDA 2VQEQ 1K73C 2LMCB 1EZ8A 5CGKA 3KDFA 1SYDA 1PH7A 2HQEA 2F3WA 2F52A 2JSOA 1N32Q 1MSHA 4B3RQ 2RHQB 1DOLA 2N3SA 4A3DH 1HR0W 2CQAA 2B2TA 4HIDA 3PF4A 3H94A 1K0SA 1LYLA 5LMNW 4DR3L 1I94Q 3BVZA 3CRKC 1TY0A 1J5EQ 2A74C 3VDYA 1SYBA 1K9MC 4DU9A 5H1SE 2E5LQ 3URYA 1L1OB 1SE2A 3PIPA 4BBRG 4DR7Q 1VQHA 4B3SL 3KBGA 3ICEA 4IQZA 4IPCA 4DAYB 3HOVG 1EY0A 5K36H 3IFTA 1EYGA 2PZWA 2R7ZG 1ESRA 3UE0A 3UI2A 4J8QA 1VQMA 1QOHA 5TSSA 4HCEA 1PH5A 2E2JB 3X3MA 3K5OA 3SE0A 2FXQA 1KAAA 2UUBL 1TWAB 3G7LA 4IOAA 3HOUG 1I3QH 2F0NA 5IGEA 1VMPA 2F0TA 3FRPB 1PYBA 4LF4L 2WAQB 5COYA 2PI2A 5C3WA 2HIXA 4GN3B 2BA0A 2K28A 3TP7A 4HJ5A 4LFBL 4A3IG 2R7DA 1BCPB 2K5NA 2HQLA 3KLRA 2ICIA 3NPPA 2NB0A 2ZM6Q 1W2BA 2B63H 1KTKA 1DGSA 1F77A 3E9IA 1GXDC 3AMUA 1EIGA 2KQ3A 1GUSA 4GLXA 4TKOB 3PIO3 4ODGA 3D6CA 1HZ9A 1VF5C 1V9PA 2HCCA 3DWAA 1HQMC 1B2TA 3HRZC 1C0AA 1VQOA 1G51A 1Y1VB 1A0IA 1H9SB 1SNCA 3EA6A 2O5JC 2NYZD 2CW0D 2WB1G 5CMDA 4A4IA 4DK3C 2N49A 4CDDC 3CCVA 3SR1A 4Q5VA 4DUYL 3PUXA 2QILA 2M9VA 3PQIA 2ASBA 1I50H 2PNRC 5EKIA 4LF9Q 3W1GA 2PI2E 1SR3A 3TEHB 2GN5A 4A93B 1LTBD 2VXWA 1X3EA 4POFA 1AEXA 1U9RA 1I6VC 1BCPC 4LUOA 2KHSA 1WCMB 3STBD 5LHY1 2A69C 1SJED 3EROA 4OWTB 4QUFA 4X64Q 3UDGA 2Z0SA 1KABA 1S4ZA 2R61A 1YHQA 2N55A 3GTPB 3S15B 5IT9E 1B1ZA 4ME3A 1GO3E 2OF1A 1CT1D 1MD2D 5DEHA 3K0XA 3M85A 4ULLA 4IALA 2N88A 3RZDH 5C3EG 1D1IA 1ILQA 3SK4A 4EX5A 4KHZA 1YHBA 4RMFA 3ULPA 3HZXA 4ZLTF 1I6HB 5EJWA 3S17B 1SLJA 3MFGA 4JI1Q 1MHWC 2Z4HA 4BBRB 4NXML 4OL7A 3K58A 1CKNA 5C0XH 4BWGB 1UAPA 1JQYD 4LUZA 5F2DA 3NBHA 3GTLB 4JI6Q 3MXGA 4GOPA 3V05A 3HOVB 3GO5A 1G291 1GUNA 4IPHA 2AQ2B 3RLNA 4PMBA 3M4YA 4O2DA 4BY1H 1BXTA 2R7ZB 2NN6I 5IOCA 1HNXQ 3CC2A 3EBEA 4HSPA 4ALPA 3DM1A 1SFOH 1DD2A 5JJLA 4DR4Q 1F2ZA 4M8AA 2PO4A 2UXDL 5CBAE 3TS2A 2EY6A 3HOUB 3CPWA 1MJCA 4DV2L 3RLOA 2Z6KC 2JA6G 2ZXOA 3DM3A 1F2LA 2KCNA 2KHIA 5LMUQ 5KGUA 3GTKH 3K80C 3FP9A 1XWEA 4A3IB 4DGZA 1SEBD 3EIVA 1B44D 1JJ2A 1XPRA 1RD9D 2F4VQ 2B2VC 2NVYB 1YHAA 3I90A 1TWCB 1Y8OB 2D2CC 1KNEA 1I4HA 2XSCA 2IHEA 2VUMG 2K5QA 3DWPA 4LUVA 4RWSC 1NCVA 5JOBA 1ENAA 4PZ7A 2K5HA 3NQIA 3AEVA 5I2XA 4YHHQ 1DOMA 4A3KH 2WP8J 4QIWE 3BDOA 3WDNA 1STEA 2WB1B 2VZAA 1EYDA 1HPCA 4GS3A 5KRUA 3M9BA 1BF4A 3CPFA 1D5XC 2QGQA 3C46A 5FJ8G 2UU9Q 2QCPX 5D65A 3A5ZB 1IL2A 3U4ZA 1D2BA 1KDBA 2L12A 5C4JH 5FLXE 4AH6A 5ELCA 3C3LA 4UPAA 4QGUA 2R93H 1UE6A 5CV4A 3B6YA 4GNXA 1O80A 2JXMB 4Y7NH 3UDIA 3AQQA 3HOWG 4KKUA 1B53A 3S1NH 2A6HC 1STGA 5C3EB 3I4NH 4H13C 1Q86C 3SK5A 3HS0C 3KLSA 3ULJA 3MVVA 4A3DG 2ID0A 3UE1A 2EJGC 3SGIA 2EIFA 3I8ZA 4JI4Q 3KUPA 1W6KA 5HURA 4KTAA 4JI2Q 3PSIA 4B3SQ 1VQEA 3E0JA 3KF8A 2JA5H 1PDQA 3JAME 1TWHH 4CKBA 3KFUA 1B3QA 3OIPA 1GUOA 1EOVA 1VQ5A 2JE6I 5K36G 2PYKA 3L7ZC 4JBJA 1D6EC 4FNFA 3KDFB 5I9PA 1F2YA 3CCSA 3L2PA 3PO2G 1Y14B 1N9WA 4DPGA 4E6IA 4OO1H 1RKNA 4HAEA 2G5DA 2JA6B 2UUBQ 1B8AA 2D0PA 2HT1A 2WACA 1IYJB 1YNJD 2WKCA 4LF4Q 4UDUC 4JOIC 4K6LA 1VQBA 1X9NA 1QILA 4I7AA 4PNYA 4JI7Q 4N8FA 1SNQA 2B2WA 4ZAIA 4LNQA 3OOCA 1JOKA 3PMFA 2VUMB 4GKKQ 1WI5A 2B63G 3PO3B 4KHVA 1BKBA 2CFMA 1KD1C 2EVBA 3RZOH 1IYUA 3KJOA 2K5WA 2EJMA 3EVQA 4A3MB 4IUUA 4WFN3 3H0GH 1EY5A 1IBMQ 4DAPA 4LFCQ 1IBLL 3BDCA 4N8X1 4DUZL 3K81C 3W3AA 1EU4A 2KHJA 4K2KA 4NXNL 1Z9FA 2UXBQ 2YU9H 4WJ4A 2LSSA 4KI0A 5DM63 3P20A 2RDGA 4P75A 2SEBD 2B2TC 1EIFA 1YNNC 2L4NA 1V1OA 2DJGC 1F2MA 1QNKA 1XTDA 2IT1A 3H09A 4R4OA 1VQPA 4KLKA 3L3OC 3X3NA 4K14A 2NVQB 5D14A 1V1PA 2DNCA 4DV3L 2UXCQ 3A8KE 3HGBA 1CHPD 2L1BA 1EY6A 3DEPA 2JA7B 4GLAC 1NBWA 2E74C 4CJ1B 2D9UA 2WFWA 5ELEA 1PH6A 2VQEL 3GTPH 3S15H 5EKKA 3CCLA 2VY3A 1FYCA 2KBNA 2QW7A 4K5XA 4A3DB 1N32L 4ME5A 4B3RL 4K2LA 5LL6X 4C56C 1A63A 3G71A 5IGDA 3F2BA 4JI5Q 1I94L 2R6GA 4IJHA 1J5EL 2A6HD 1CZWA 5BN3A 2E5LL 2JA8B 5IGBA 1VQCA 5C0XG 4DR7L 5LMNQ 2HHHQ 2CWAA 3RMHA 4EVOA 3MEHA 2Q8RE 1MJEA 4BY1G 3BU2A 2ZT9C 2DNEA 1LTAD 4B9WA 2KJXA 5T1GA 5C44H 3TMEA 2ZTEA 4KY6A 1XXGA 1YITA 2E2DC 1WD0A 2F0EA 4RGOS 5NUCA 5KNDA 2NUCA 2ZXRA 1S40A 2BE5D 3ITPA 3R2IA 4HMJA 1I3QB 1LT6D 2K5VA 1YBYA 4X3SA 3CC4A 2LXJA 5E4XA 2KOLA 3SVMA 1CKNB 2XGTA 3QB3A 3NBHB 2QEJC 4GOPB 3S14H 2GVAA 4ZUIA 2CWPA 4R4TA 4JPBW 1STNA 2EYOA 2B63B 2XNAC 4HR7B 4UAIA 3TDQA 1A62A 1CA6A 1TWCH 4EQOA 2VNUD 3OYYA 2Z1CA 1BUVT 3J7YW 4JG2A 3HFZB 3KF6A 1HRJA 2F0OA 4QIWB 5ELOA 2CQOA 3K5LA 4F8MA 1JORA 4CGYB 1PMRA 2R92H 4RGTA 2HUGA 3G6JB 3ZJYC 1PH4A 3GV3A 3O13A 2PZUA 4A3KG 4DR2Q 2H1EA 1LV9A 1QZHA 3I72A 1VDZA 4HJ9A 3DEOA 2QF7A 1K0RA 3VR5A 3J80i 1I50B 1Z7TA 1JR0D 1HZAA 1RL2A 1S5CD 2F0UA 3CCUA 4LF9L 1K83H 3CQZH 2EXDA 1STBA 4EGVA 1T9HA 4G7OC 3H3VI 4DR5Q 1A2UA 4NW2A 3C2PA 2R93G 4HCSA 4ID6A 1UE1A 1O7LA 1R4PB 2WKDA 1CQFA 1PH3A 1TVXA 4LAAA 5IGCA 3T1HL 5T1IA 3S1MH 1TWFH 3NHHA 3RZDB 4JI3Q 4OONA 3I4NG 1JMCA 1M8AA 1A3TA 4KN7C 1BR9A 1VQFA 1Q46A 4JVZA 1Z47A 1WOCA 2K1BA 2NVXB 3T56B 4JI1L 1PFSA 2F0QA 4MHEA 5DNFA 1J8IA 3GTQH 2EYFA 4IFDH 1PHJA 4BY1B 5C4XB 4GNXB 5JJZA 1A3UA 4NDXA 1K28A 2RSNA 2F03A 4X3TA 4ZK9B 3E9HA 4DR4L 3P1HA 2K6AA 1OTCA 1ET6A 3VA7A 2V1CC 4EQPA 4OO1G 1VQKA 4XTCS 1SJHD 3MXPA 2AHOB 2JP1A 4RKLA 4C2MH 2HCIA 4DR6L 4C3IH 2BA1A 3GD7A 5IGFA 3DMUA 3J7AV 2BDNA 2OT2A 5LMUL 3GTKB 2F0VA 5EQ0A 1XJVA 3KF8B 2ATWA 4LMQD 3CHBD 3HOYB 3ERSX 5C5MA 1HA6A 1HCZA 1TS3A 2L9HA 3WOFA 4LK1C 1U5KA 2FMCA 2MP1A 5GAEC 1LTSD 1SSOA 4BA1I 1JWUD 2CHBD 3PO3H 2CW0C 2WV6D 1HA5A 2EE1A 1CUKA 4A3MH 4GNXC 4XT3B 3H0GG 1PFNA 2G9DA 1IBLQ 1PZJD 4I7ZC 4A3KB 4DUZQ 3D4RA 4YHHL 4RFBA 3FKIB 3QWNA 4HSVA 2RF4A 4TQUS 2V4DA 5IIFA 1WTPA 4XXEA 4BBSH 4OX9Q 2HD3A 1U4LA 3STBC 2XVSA 1WYDA 1D1KA 1II3A 1GKHA 2P5ZX 5C4JB 5CV6A 1STAA 4RAUC 5DLQE 3PF5A 2IWHA 3I73A 2J7ZA 4DV7Q 1N34Q 4Y7NB 2JA7H 4BA2I 4C1NK 3S1NB 4HIMA 2D5DA 1X65A 4KN4C 3I4NB 1E2VA 4AYBE 3VR2A 4LF8Q 2MFIA 2ENBA 3BS1A 5A35A 4HN7A 1TQOA 2EPBA 4M1UB 4HMIA 3NP8A 2F0HA 1Q12A 5IYCH 2F0PA 4JI4L 3T4AC 5BR8Q 1PXUA 2KCMA 4KKTA 4JI2L 1SYFA 1HXYD 1EQQA 2JA5B 2JA8H 2DN8A 1V1PB 1JJGA 1TWHB 2B2WC 1QVCA 5A2QL 4R4IA 4LWCA 2RVLA 4IURA 4A3GH 1XMOQ 3MTSA 2ES2A 3VYRA 4B3MQ 5C44G 3Q24A 1SRUA 4FYDA 5JPMC 2MUYA 2RHSB 1VF7A 1X3FA 3GTMB 2OEOA 1ESFA 3CD6A 3D31A 1SNPA 1IKLA 4K6DA 4L6TB 1SROA 4IZ8A 4FXGC 4EQNA 4LF7Q 3V2TA 1TT2A 1Y1WH 4JI7L 1EFID 2NVTB 1LT5D 2KECA 3AU7A 2I5LX 4GKKL 4C3HB 1SN8A 4DFAA 1W6JA 3RZOB 3FEWX 2B39A 3J81c 1CKMA 3H0GB 2MHVA 1G2TA 1KC8C 3VYUA 4G7HC 4JBKA 2LKVA 1FNUA 2R92G 1IBML 4RG1A 4LFCL 2IW3A 1GUTA 4U673 4ZKBB 3I56A 3NE5B 4R9WA 3U9OA 1KLGD 4A3EB 4OXPA 5IP9H 3S16H 4RKBA 2YU9B 3A55A 3T13A 2B29A 3J80E 2UXBL 1PH2A 5EBCA 4XT1B 1ICFB 4YWMA 1DM0B 1KDCA 1Q1EA 1HHVA 3CKIB 4CBVA 3S24A 1F9RA 5I9OA 3ND9A 4HJ8A 1X55A 2AUJD 3KF6B 1N33Q 3MEFA 2PMZE 3BYYB 3SDZA 3Q0AA 2UXCL 3J81L 1VQ4A 1O78A 2A1AA 4DAMA 2PZTA 1X32A 2GA4B 1O7YA 3T1HQ 4A3JH 1MKHA 3MXNA 4F87A 2F0DA 5DAUA 4J15A 1K3BC 2B2UA 1MBYA 1EWHA 1TXYA 1CFMA 5CYUA 2NVXH 1A3VA 3BZKA 3CCMA 3EQLC 4JI5L 1EY8A 1D5ZC 4DV1Q 1OXUA 3RN2A 1VQJA 5LMNL 3TN2A 3BVGA 3NEMA 2VS1A 2HHHL 3DHQA 1CTMA 4IFDG 3PUWA 5C4XH 1RF2D 2R7FA 3BZDB 1RHPA 1YNJC 5C44B 1PA6A 1W3SA 3J81i 1PVOA 3MZ5A 1YJ9A 4CKCA 1SNDA 1F9QA 1UWVA 1HNZQ 1WTRA 3N52A 4R1JA 5FLMH 3KOJA 4DR6Q 2Z8LA 4DK0A 2C5CA 4P71A 1N8RC 3EFXD 4LJZC 4C3IG 1GUGA 2CCZA 1DXMA 2PW7A 1NSNS 4KJOA 3A74A 2JEBI 2NZOA 3C1EA 3S14B 1UEBA 1ASZA 4DNRB 4GLVB 2IL8A 3HOYH 2PQAA 4JK1C 5M5WH 2Q8TA 1F9SA 4NB3A 4ZRZA 4HJAA 2SNMA 2NZ1D 3Q6SA 1PYWD 4IPDA 5EGTA 3GQBA 4UP7A 3U50C 1ET9A 3DWQA 1QNUA 3BDLA 3OPOA 2R3ZA 1BO0A 4RA8A 3PO3G 3PUZA 4L5RC 2R92B 2F3VA 1DOKA 4A3MG 1HJPA 2K75A 4MIUA 2OTJA 3DXJC 2Q2IA 4DNTB 2I46A 2RQXA 4OWWB 3S1RB 3SXHA 1HNWQ 1AZPA 4DR2L 2WINB 3FKIH 1NJIC 1EU3A 4Y52H 4YWKA 1B9MA 2SNSA 1HUMA 2CH4W 2Y0SE 4OEMB 3K59A 3Q8DA 4BBSG 1NR2A 1KRTA 2E76C 4A3CH 1J6QA 3NENA 3TSSA 4R8NA 1K83B 3CQZB 2K33A 1EY4A 2JJQA 5ELDA 4JC0A 4YCWA 4JW0A 5M3FH 4DR5L 4AYBB 3TS0A 2Q2UA 3LWEA 3HEJA 1NNXA 5GAHC 2JA7G 1EQVA 3S1MB 1N36Q 3NUCA 1TWFB 4TRDA 4KV6A 1PZID 2I07B 1LTRD 4JI3L 3TZUA 4L5QA 2LS01 2K4KA 3UDFA 3VA5A 1P16A 1XTCD 2BH2A 1SNMA 5IYCG 5ELFA 3LNNA 1PH8A 3QOJA 4ILWA 3GTQB 1SDFA 1EY9A 1E0BA 2JA8G 4IUTA 3E6ZX 1L2FA 5AFWA 3CAMA 2BE5C 4BXXH 1PH1A 5M9OA 4K5VA 4DA2A 3T1YQ 1IW7D 1EYCA 4U68A 5FOBB 4A3GG 4IUPA 2PNHA 1TWGH 2JA9A 1X6OA 1JE4A 5JVG3 4DV0Q 4C2MB 1KLUD 1KXLA 4BY7H 4PMCA 5D3IB 4C3IB 3GTMH 1EEID 3A54A 4IO9A 3WWVA 1SE8A 2RCFA 1VQ9A 1VQLA 4OIKA 2A6ED 2B2YC 2X69A 3I4MB 5J3BA 5HGTA 5CV8A 1JICA 3LX0A 1HTPA 5FK9C 3ZYYX 5KIXA 1Y1WG 4PG3A 3CCJA 1SBBB 2FJ2A 2NVTH 3I2ZA 3QR8A 3HOXH 3E0EA 1DJRD 4V0BA 4PZ6A 4TVAB 5IP7H 1IXRA 3S9WA 3GTJH 4C3HH 3R2TA 1VQ6A 5EKLA 4JI0Q 1YIJA 1CI3M 4H7BA 1RDPD 2N78A 1ZXTA 1WD1A 1Y8NB 1XNQL 1GVPA 3I7FA 4X3KA 1EWCA 3K8AA 4QF4A 4RHRA 1NAPA 2K05A 4A3EH 4BBSB 1EWIA 2M00A 5IP9G 3M3YH 4OX9L 1EEFD 2F0FA 4FXKC 5KEEA 1RIPA 1WVLA 1H95A 4L63B 1ZYRD 1TS5A 5FO8B 4KMUC 1SAPA 2C9OA 1AE2A 2F0IA 3I4LA 1SMYC 1ICWA 2EYPA 4DV7L 1N34L 4IPGA 1BQQT 4YCUA 4LFAQ 1Q81C 2ZJPA 2I5HA 3NXWA 4OGQC 3VR3A 1JE5A 3PUYA 4A3JG 3GV6A 4LF8L 1L1OA 4GKJQ 2VQFQ 2C35B 1XNRQ 2OTLA 4A3BH 5CV7A 1FR3A 5GROA 2IX1A 4MTNA 1HR0Q 4CDFC 5BR8L 5GADC 2EY1A 4APVA 1VQAA 2XRQD 1LT3D 1X54A 1G6ZA 1NE3A 2RDHA 4A3GB 4X65Q 1PLFA 1WTVA 5C4XG 1XMOL 3MXNB 1ILPA 4IN3A 4B3ML 4JBMA 2ZXPA 3D4WA 4PMWA 2YYZA 3M4OH 5FLMG 4HIOA 1HUNA 4B3TQ 5J1ZA 1VQ8A 1RCVD 5C0XI 1AW7A 2IJ0A 1XMQL 1Y1WB 1R9TB 2E2HH 4LF7L 1FJGL 4AIMA 3HOYG 1GOZA 1NTGA 2MO0A 4KKSA 5HGQA 2QKIC 1AH9A 3Q22A 1LUZA 1TS4A 1V8QA 4HTHA 4DV6Q 1E22A 1QG7A 2L55A 4L8JA 2ICEC 1I4XA 3GTGB 1OXSC 2HDLA 4O1NA 3S1RH 3S16B 2WAQE 1VCIA 2EOTA 2EXZA 2B2UC 2EZVA 3FKIG 3PCOB 3TP5A 4IFDJ 1S72A 2F0LA 4ZYSA 2A68D 2G9HD 1KHIA 1IBKQ 4A3CG 1L0XB 1O7ZA 4I65A 5IT9L 2O4XA 1N33L 2KENA 3OIQA 5M3FG 4IJLA 1T5EA 4P74A 1OO9B 1LABA 5I6YA 5I2YA 3VYSA 1PTOD 4A3JB 3BVMA 3A7AB 2B8FA 2DY8A 4H0LC 2DUDA 5IYDH 5JPNC 3VR6A 3K7AB 4IUNA 1IHZA 1CKOA 3TREA 1SMYD 2EYHA 4KD3A 1BNZA 4C1NI 1KAWA 3NWSA 3OW7A 2FFKB 2VL6A 1D8LA 2NN6H 3BJUA 5CORA
chains in the Genus database with same CATH topology
3IFDA 3QOLA 1Q90A 3FVQA 1EQTA 1RODA 1K8OA 1TKWB 5DM73 1CA5A 1FNVA 3RUZA 1K8MA 5EPKA 1BDOA 1EL0A 2XRSD 4DF7A 2VB3X 4B9XA 5BN4A 1SE3A 1I4RA 3MWYW 1PTOH 1WTQA 5M5WB 5C4ZA 4WRDA 4XQQA 1RJTA 1H9RA 4OO1I 4C3HG 5K5PA 1HFNA 1IKMA 4QCLA 3L9AX 4Q0FA 2B2YA 4IUQA 2BOSA 4G57A 2B8GA 4QMGA 1PTOF 5FLXL 1EIHA 4KK7A 4OIJA 5BN5A 2K04A 3Q23A 2KUMA 1S5BD 1AN8A 5J22A 5M3FB 2PQEA 1M4VA 4IUVA 3M7NA 1IL8A 1C48A 3KK7A 3NWTA 3TP8A 4NMZA 2RA4A 1B50A 4CJ2C 1AP0A 3MAQA 3JAML 1ZEQX 1PFBA 1JWSD 3NK9A 1X3QA 1G2SA 3H3VC 1LTTD 2M2LA 5KYIA 4JBWA 3SK6A 3MFYA 5JAVA 3K6OA 4PQXA 1TWGB 5JEAH 1TY2A 4BY7B 4FP5D 3FPPA 3TZDA 1ONLA 1ENFA 5CBEE 1TU2B 2EYMA 3EJIA 2Z4IA 5FO7B 1C4QA 2EJFC 2AQ1B 2AUKA 3H6MA 4K8JA 2BDOA 2L11A 1J9OA 1LO5D 1HTLD 3HOXB 3A8IE 4KJNA 3GTJB 1GUWA 2KEEA 1H9KA 5CV9A 1FD7D 3OMCA 3ERQA 2VB2X 1PRTD 3SHLA 5C0XJ 2MGSA 3U9SA 1B4OA 3M3YB 3OHXC 1CQVA 1SYCA 2FMMA 5E1FA 3ND8A 2K5DA 1Q3LA 1ZKOA 5FKAC 2BCOA 4FF4A 5JVH3 3AB9A 3IL8A 2A5HA 1S5DD 2K7VA 3IAYA 1I4QA 4MN3A 2F4IA 3FDTA 5IGGA 3R93A 1NUCA 2L0CA 4FF3A 5KYLA 4WJWA 1KNAA 4A3BB 2FHTA 5EPLA 5M3MB 4RH6A 4RHSA 2EY5A 1IW7C 1A2TA 4KY7A 1TIID 2NN6G 3LWUA 5C3XA 2RDFA 3QJYA 2MPMA 1FGBD 4XYQA 2XWJB 2A6EC 3R3OA 1OXTA 4ZKCB 5C6AA 3M4OB 4J6HA 3D8GA 4R8IA 1D5MC 5EBDA 4XYOA 2KEDA 3IKJA 2H4OA 3TP6A 2IX0A 2RKSA 1H9JA 1DZ1A 2E2HB 2AWOA 2X6GA 1PRTF 4IFDI 3A7LA 1QE6A 2TSSA 1F9PA 1STHA 2AWNA 2EYLA 1DONA 3D4DA 4C3JG 1JWMD 1OXVA 1G8ZD 2O2LD 3QG1A 1LTGD 3A8JE 3CRLC 3M7GA 4RCNA 1ZYRC 1XYIA 1JOQA 1BBXC 1DCZA 1SE4A 1U4RA 5ISRA 4PV1C 5J39A 5CV5A 3RD4A 3S1QB 2J4XA 2F0WA 3VYTA 3WOEA 2NBFA 4B08A 4G7ZC 1IYVA 3CU7A 1JCKB 2K32A 1SYEA 1GHJA 4KY5A 1QWYA 4BS9A 2JEAI 3NQTA 3T16A 1Y69U 5CR3A 1JC7A 1TS2A 2CVRA 4KD4A 1ML0D 4FF2A 3MC0B 2EDGA 3K5MA 1A15A 5EPJA 4V190 5ELBA 2LY7A 1LACA 1JB3A 1Y8PB 1BCPD 4F88A 2IX3A 3TBIB 2A69D 5M5YB 1LT4D 2F0GA 3GP7A 4ZUJA 1CHQD 3A56A 2K01A 2E75C 5JEAG 1UUPA 4CJ0B 4XQNA 1A6XA 2EYJA 3PV0A 2KA7A 5I6WA 1PTOB 1AFPA 2K03A 3VR4A 3S2DB 2F0JA 1CM9A 3K0YA 5A2QE 2F1MA 4YIJA 4C3JB 1E2WA 4WORA 2X6LA 1WTWA 1G91A 1STYA 4Z9CB 2J0TD 2A68C 4DK1A 3FPUB 1MGSA 1RTNA 2FINB 1EOTA 2F0MA 3GTOB 3J7AF 2A73B 2RSOA 2PMZB 1SYGA 1R4QB 3W2DA 2F0KA 1PTOC 3OWEB 5M5XB 1X3PA 4XDXA 2O5IC 1Q8IA 3KBXA 4K8IA 3NTIA 3OSOA 4FO2A 3RLFA 3SK8A 3BYTB 2JYOA 1BCPF 3MXUA 1PZKD 2PCFB 2WIIB 3HOWB 4DAYA 3PIP3 4TSSA 4FXDA 4DXGA 5CC4A 1U4MA 3F2UA 4J1MA 3J81E 3P75A 1TR5A 2XWBB 5I4DA 1SNOA 2NTSA 2D62A 1I4PA 1HFGA 4DAVA 1EZ6A 1V43A 3C1FA 3P7JA 3N6RA 3OWFA 3PO2B 2E2IB 4N9PA 2DY7A 1LTID 4OHJA 5G3LD 1EYAA 3QO2A 3S2HB 1T5XD 1JOOA 1MSGA 2KVMA 2XN9C 4FVMA 3V96A 1VMCA 1I4GA 1H9SA 3J80L 1FNWA 3OMGA 2RBMA 2Y0SB 4RCOA 1E2ZA 3NTHA 3I91A 5KNBA 1WTXA 4QUCA 1HQRD 1NR4A 4QB4A 1RTOA 3H91A 2NTTA 4ABNA 5C5LA 3K5NA 4RGNA 1SXTA 4ZQ3A 1C8CA 3NBIA 1S5ED 1UEAB 1S5FD 3HOZB 2PPBC 1CZGA 4G4KA 5E4WC 4RGMA 4X3UA 5FO9B 3T51B 2B2VA 2NWGA 1B3AA 4GZYC 1KDAA 3HP3A 3ONAB 1QJOA 1QB5D 5C4HA 3T53B 3SEBA 3R8BA 2SOBA 5IODA 1YNND 1PRTB 2QDBA 3NSWA 1GJXA 4NP5A 4O42A 2MJ8A 4DXFA 2OXPA 2F0SA 2HDMA 3DUZA 4A3FB 4FF1A 1MI2A 4NKLA 2IPKD 4H44C 5G3LF 5KNCA 4N9TA 1OXXK 4K5WA 3PUVA 1WTOA 4F7XA 1H9MA 2SDFA 1SFOB 2L5TA 3HG9A 5D3DA 1CK1A 3QIAA 3E5SA 2EY2A 1B9NA 1PFMA 2TMPA 3K57A 3I70A 1PRTC 1UNSA 1U4PA 1Z6HA 3NTKA 3D3RA 3BG3A 1EY7A 2XIWA 2AQ3B 3FMCA 4DN4M 4XIGS 1LLRD 4P2CB 3I3CA 5LL6S 3MHBA 1BOSA 3D6WA 4XQJA 2LFNA 5JEAJ 5E3FA 4CHTB 1ENCA 1GHKA 1DYQA 1QCBD 3KLSX 1AZQA 1Q1BA 1XX8A 3MA2B 2KCCA 2PW5A 2R93B 4CKEA 4S3SA 1L0YB 3HKZB 2Q8IB 4HEDA 2LMCB 1EZ8A 5CGKA 1SYDA 2HQEA 2F3WA 2JSOA 1MSHA 1DOLA 2CQAA 2B2TA 3H94A 3BVZA 3CRKC 1TY0A 2A74C 1SYBA 4DU9A 3URYA 1SE2A 3KBGA 4IQZA 1EY0A 5K36H 3IFTA 2PZWA 1ESRA 3UI2A 4J8QA 1QOHA 5TSSA 4HCEA 2E2JB 3X3MA 3K5OA 3SE0A 1KAAA 1TWAB 3G7LA 2F0NA 5IGEA 1VMPA 2F0TA 3FRPB 2WAQB 5COYA 5C3WA 2BA0A 2K28A 3TP7A 1BCPB 3KLRA 2ICIA 3NPPA 2NB0A 1KTKA 1F77A 1GXDC 3AMUA 1EIGA 2KQ3A 1GUSA 4TKOB 3PIO3 4ODGA 3D6CA 1VF5C 2HCCA 3DWAA 1HQMC 1B2TA 3HRZC 1Y1VB 1H9SB 1SNCA 3EA6A 2O5JC 2NYZD 2CW0D 5CMDA 3SR1A 4Q5VA 3PUXA 2QILA 2M9VA 2PNRC 5EKIA 4A93B 1LTBD 2VXWA 1AEXA 1U9RA 1I6VC 1BCPC 2KHSA 1WCMB 5LHY1 2A69C 1SJED 3EROA 4QUFA 1KABA 1S4ZA 2R61A 2N55A 3GTPB 3S15B 5IT9E 1B1ZA 2OF1A 1CT1D 1MD2D 5DEHA 3M85A 4ULLA 4IALA 2N88A 1D1IA 1ILQA 3SK4A 4KHZA 3HZXA 4ZLTF 1I6HB 5EJWA 3S17B 3MFGA 2Z4HA 4BBRB 4OL7A 3K58A 5C0XH 4BWGB 1UAPA 1JQYD 5F2DA 3NBHA 3GTLB 3MXGA 3V05A 3HOVB 3GO5A 1G291 1GUNA 2AQ2B 4PMBA 3M4YA 1BXTA 2R7ZB 2NN6I 5IOCA 4HSPA 3DM1A 1DD2A 1F2ZA 4M8AA 2PO4A 5CBAE 2EY6A 3HOUB 2ZXOA 1F2LA 2KCNA 5KGUA 1XWEA 4A3IB 4DGZA 1SEBD 1B44D 1RD9D 2B2VC 2NVYB 1TWCB 2XSCA 1Y8OB 2D2CC 1KNEA 1I4HA 3I90A 2K5QA 3DWPA 4RWSC 1NCVA 5JOBA 1ENAA 3NQIA 5I2XA 1DOMA 2WP8J 3BDOA 3WDNA 1STEA 2WB1B 1EYDA 1HPCA 5KRUA 1BF4A 1D5XC 3C46A 2QCPX 5D65A 1D2BA 1KDBA 2L12A 5FLXE 5ELCA 3C3LA 5CV4A 1O80A 2JXMB 4KKUA 1B53A 2A6HC 1STGA 5C3EB 4H13C 3SK5A 3HS0C 3KLSA 3MVVA 2ID0A 2EJGC 3I8ZA 3KUPA 1W6KA 5HURA 4KTAA 3E0JA 3KF8A 1PDQA 3JAME 4CKBA 3OIPA 1GUOA 2JE6I 5K36G 2PYKA 3L7ZC 5I9PA 1D6EC 4FNFA 1F2YA 4E6IA 4OO1H 1RKNA 4HAEA 2JA6B 2WACA 1YNJD 2WKCA 4UDUC 4K6LA 1QILA 4PNYA 1SNQA 2B2WA 4ZAIA 3OOCA 1JOKA 3PMFA 2VUMB 3PO3B 4KHVA 2EVBA 1IYUA 2K5WA 2EJMA 3EVQA 4A3MB 4IUUA 4WFN3 1EY5A 4DAPA 3BDCA 3W3AA 1EU4A 4K2KA 4KI0A 5DM63 3P20A 2RDGA 2SEBD 2B2TC 1YNNC 2L4NA 1V1OA 1F2MA 1QNKA 3H09A 2IT1A 3L3OC 3X3NA 4K14A 2NVQB 5D14A 1V1PA 2DNCA 3A8KE 3HGBA 1CHPD 2L1BA 1EY6A 3DEPA 2JA7B 2E74C 4CJ1B 2D9UA 5ELEA 5EKKA 1FYCA 4K5XA 4A3DB 4ME5A 4K2LA 5LL6X 4C56C 5IGDA 2R6GA 2A6HD 1CZWA 5BN3A 2JA8B 5IGBA 5C0XG 3RMHA 4EVOA 3MEHA 2Q8RE 2ZT9C 2DNEA 1LTAD 4B9WA 2KJXA 5T1GA 3TMEA 4KY6A 1XXGA 2E2DC 1WD0A 2F0EA 4RGOS 5NUCA 5KNDA 2NUCA 2ZXRA 2BE5D 3ITPA 3R2IA 4HMJA 1I3QB 1LT6D 4X3SA 5E4XA 2KOLA 3SVMA 3QB3A 2QEJC 4ZUIA 1STNA 2EYOA 2B63B 2XNAC 4HR7B 4UAIA 3TDQA 1CA6A 4EQOA 2VNUD 2Z1CA 1BUVT 3J7YW 1HRJA 2F0OA 4QIWB 3K5LA 4F8MA 1JORA 4CGYB 1PMRA 4RGTA 2HUGA 3G6JB 3GV3A 3O13A 2PZUA 2H1EA 1LV9A 3I72A 1VDZA 3DEOA 2QF7A 3VR5A 1I50B 1Z7TA 1JR0D 1S5CD 2F0UA 1STBA 4EGVA 4G7OC 1A2UA 4NW2A 3C2PA 4HCSA 4ID6A 1O7LA 1R4PB 2WKDA 1CQFA 1TVXA 4LAAA 5IGCA 5T1IA 3NHHA 3RZDB 1M8AA 1A3TA 4KN7C 1BR9A 1Z47A 2K1BA 2NVXB 3T56B 2F0QA 4MHEA 5DNFA 1J8IA 2EYFA 4IFDH 4BY1B 5C4XB 5JJZA 1A3UA 4NDXA 2RSNA 2F03A 4X3TA 4ZK9B 3P1HA 2K6AA 1ET6A 3VA7A 4EQPA 4OO1G 4XTCS 1SJHD 3MXPA 4RKLA 2JP1A 2HCIA 2BA1A 3GD7A 5IGFA 3DMUA 3J7AV 2BDNA 2OT2A 3GTKB 2F0VA 5EQ0A 4LMQD 3CHBD 3HOYB 5C5MA 1HA6A 1HCZA 1TS3A 2L9HA 3WOFA 4LK1C 2FMCA 2MP1A 1LTSD 1SSOA 4BA1I 1JWUD 2CHBD 2CW0C 2WV6D 1HA5A 2EE1A 4XT3B 1PFNA 2G9DA 1PZJD 4I7ZC 4A3KB 3D4RA 4RFBA 3FKIB 3QWNA 4HSVA 4TQUS 2V4DA 5IIFA 1WTPA 4XXEA 1U4LA 2XVSA 1D1KA 1II3A 5C4JB 5CV6A 1STAA 4RAUC 2IWHA 3I73A 2J7ZA 4Y7NB 4BA2I 4C1NK 3S1NB 2D5DA 4KN4C 3I4NB 1E2VA 3VR2A 2ENBA 3BS1A 5A35A 4HN7A 1TQOA 2EPBA 4M1UB 4HMIA 3NP8A 2F0HA 1Q12A 2F0PA 3T4AC 1PXUA 4KKTA 1SYFA 1HXYD 2JA5B 2DN8A 1V1PB 1TWHB 2B2WC 5A2QL 2RVLA 4IURA 3MTSA 3VYRA 3Q24A 4FYDA 5JPMC 2MUYA 1VF7A 3GTMB 2OEOA 1ESFA 3D31A 1SNPA 1IKLA 4K6DA 4L6TB 4IZ8A 4FXGC 4EQNA 3V2TA 1TT2A 1EFID 2NVTB 1LT5D 2KECA 3AU7A 4C3HB 4DFAA 1W6JA 3RZOB 3FEWX 2B39A 3H0GB 2MHVA 1G2TA 3VYUA 4G7HC 2LKVA 1FNUA 2IW3A 1GUTA 4U673 4ZKBB 3NE5B 4R9WA 3U9OA 1KLGD 4A3EB 4RKBA 2YU9B 3A55A 3T13A 3J80E 5EBCA 4XT1B 1DM0B 1KDCA 1Q1EA 1HHVA 3CKIB 4CBVA 1F9RA 5I9OA 3ND9A 2AUJD 3BYYB 3SDZA 3Q0AA 3J81L 1O78A 2PZTA 1X32A 2GA4B 1O7YA 3MXNA 4F87A 2F0DA 5DAUA 2B2UA 1MBYA 1EWHA 1CFMA 5CYUA 1A3VA 3EQLC 1EY8A 1D5ZC 1OXUA 3TN2A 3BVGA 3DHQA 1CTMA 4IFDG 3PUWA 1RF2D 3BZDB 1RHPA 1YNJC 5C44B 3MZ5A 4CKCA 1SNDA 1F9QA 1WTRA 3N52A 2Z8LA 4DK0A 2C5CA 3EFXD 4LJZC 4C3IG 1GUGA 1DXMA 2PW7A 1NSNS 4KJOA 2JEBI 3C1EA 3S14B 4DNRB 2IL8A 4JK1C 2Q8TA 1F9SA 4ZRZA 2SNMA 2NZ1D 3Q6SA 1PYWD 5EGTA 3GQBA 1ET9A 3DWQA 1QNUA 3BDLA 3OPOA 2R3ZA 1BO0A 4RA8A 3PUZA 2R92B 2F3VA 1DOKA 4MIUA 3DXJC 4DNTB 2I46A 2RQXA 3S1RB 3SXHA 1AZPA 2WINB 1EU3A 1B9MA 2SNSA 1HUMA 3K59A 1NR2A 2E76C 3TSSA 4R8NA 1K83B 3CQZB 2K33A 1EY4A 5ELDA 4AYBB 3LWEA 3HEJA 1EQVA 3S1MB 3NUCA 1TWFB 4TRDA 4KV6A 1PZID 2I07B 1LTRD 3TZUA 2LS01 3VA5A 1XTCD 1SNMA 5ELFA 3LNNA 3QOJA 4ILWA 3GTQB 1SDFA 1EY9A 1E0BA 4IUTA 3E6ZX 5AFWA 2BE5C 5M9OA 4K5VA 4DA2A 1IW7D 1EYCA 4U68A 5FOBB 4IUPA 1JE4A 5JVG3 4C2MB 1KLUD 4PMCA 5D3IB 4C3IB 1EEID 3A54A 4OIKA 2A6ED 2B2YC 2X69A 3I4MB 5HGTA 5CV8A 1JICA 3LX0A 1HTPA 5FK9C 3ZYYX 5KIXA 1SBBB 2FJ2A 1DJRD 4V0BA 3S9WA 3R2TA 5EKLA 1CI3M 4H7BA 1RDPD 1ZXTA 1WD1A 1Y8NB 4X3KA 1EWCA 4QF4A 4RHRA 1NAPA 2K05A 4BBSB 2M00A 1EEFD 2F0FA 4FXKC 5KEEA 1WVLA 4L63B 1ZYRD 1TS5A 5FO8B 4KMUC 1SAPA 2C9OA 2F0IA 3I4LA 1SMYC 1ICWA 2EYPA 1BQQT 3NXWA 4OGQC 3VR3A 3PUYA 3GV6A 5CV7A 1FR3A 2IX1A 2EY1A 2XRQD 1LT3D 1G6ZA 2RDHA 4A3GB 1PLFA 1WTVA 1ILPA 4IN3A 2ZXPA 3D4WA 4PMWA 2YYZA 1HUNA 5J1ZA 1RCVD 5C0XI 1AW7A 2IJ0A 1Y1WB 1R9TB 1GOZA 4KKSA 2QKIC 3Q22A 1TS4A 1V8QA 4HTHA 1QG7A 2L55A 4L8JA 2ICEC 1I4XA 3GTGB 1OXSC 2HDLA 4O1NA 3S16B 1VCIA 2EOTA 2EXZA 2B2UC 2EZVA 3TP5A 4IFDJ 2F0LA 4ZYSA 2A68D 2G9HD 1L0XB 1O7ZA 4I65A 5IT9L 2O4XA 3OIQA 1T5EA 1OO9B 1LABA 5I6YA 5I2YA 3VYSA 1PTOD 4A3JB 3BVMA 3A7AB 2B8FA 2DY8A 4H0LC 5JPNC 3VR6A 3K7AB 4IUNA 1IHZA 1SMYD 2EYHA 4KD3A 1BNZA 4C1NI 3NWSA 3OW7A 2FFKB 2NN6H 5CORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2W A;  1PFB A;  4ZAI A;  1KNA A;  3IFD A;  2BDN A;  4U68 A;  1G6Z A;  4RWS C;  1F9Q A;  1X3Q A;  1EQT A;  1PLF A;  1ROD A;  2FHT A;  4IUP A;  1G2S A;  5E4W C;  5EPL A;  5EQ0 A;  3N52 A;  1NCV A;  1IKL A;  2HCC A;  2JYO A;  1WTV A;  1WTR A;  4LMQ D;  4X3U A;  2CVR A;  1JE4 A;  4UAI A;  1CA6 A;  1ML0 D;  2B2V A;  1B2T A;  2NWG A;  1ILP A;  1HA6 A;  1B3A A;  2M2L A;  2L9H A;  1CA5 A;  3HP3 A;  3ONA B;  1DOM A;  4IUU A;  1A15 A;  1HRJ A;  1AZQ A;  5EPJ A;  2NYZ D;  5CMD A;  2MPM A;  2MP1 A;  2KEC A;  4OIK A;  5EPK A;  1HUN A;  2B2Y C;  1SSO A;  2IL8 A;  1XX8 A;  2X69 A;  1EL0 A;  1BF4 A;  1JIC A;  2HUG A;  3GV3 A;  2Q8T A;  5EKI A;  1F9S A;  2EE1 A;  1U4M A;  2NZ1 D;  4XT3 B;  1PFN A;  3F2U A;  3Q6S A;  2VXW A;  4ZKC B;  2FJ2 A;  3TZD A;  5D65 A;  2B2T C;  3MWY W;  2H1E A;  1G2T A;  2L4N A;  1LV9 A;  5CBE E;  2R3Z A;  4HED A;  4R8I A;  1BO0 A;  4O42 A;  2K01 A;  2L12 A;  1WTQ A;  4HSV A;  1QNK A;  2MJ8 A;  4RA8 A;  3DEO A;  4QUF A;  4ZKB B;  1WTP A;  1DOK A;  2KED A;  4CJ0 B;  1S4Z A;  2L11 A;  4R9W A;  2N55 A;  1U4L A;  2HDM A;  1J9O A;  5D14 A;  1O80 A;  1MI2 A;  1MSH A;  1DOL A;  1HFG A;  1RJT A;  1ZXT A;  1WD1 A;  1DZ1 A;  1AZP A;  3P7J A;  1QG7 A;  2L1B A;  1B53 A;  3DEP A;  2B2T A;  2X6G A;  2N88 A;  4XT1 B;  1HUM A;  4NW2 A;  4X3K A;  4CJ1 B;  1HHV A;  2HDL A;  1ILQ A;  2D9U A;  4RAU C;  4HCS A;  1GUW A;  2K03 A;  4ZLT F;  1WTO A;  1NAP A;  1F9R A;  1NR2 A;  2K05 A;  5EJW A;  1QE6 A;  1F9P A;  1HFN A;  2KEE A;  1IKM A;  2EOT A;  1CM9 A;  2J7Z A;  1DON A;  1TVX A;  2B2U C;  2SDF A;  2DY7 A;  3I8Z A;  5T1I A;  3KUP A;  2B2Y A;  1WVL A;  4IUQ A;  1M8A A;  1X32 A;  2X6L A;  3QO2 A;  2MGS A;  1WTW A;  1ESR A;  3UI2 A;  1O7Y A;  1PFM A;  3LWE A;  1SAP A;  1PDQ A;  1B4O A;  4OIJ A;  1EIH A;  1O7Z A;  1G91 A;  1MSG A;  2KVM A;  2K1B A;  1XYI A;  1VMC A;  1B50 A;  2EPB A;  3FPU B;  3DM1 A;  1MGS A;  1BBX C;  2K04 A;  2FMM A;  1ICW A;  2B2U A;  1U4P A;  1RTN A;  4MHE A;  2FIN B;  2KUM A;  1EOT A;  1U4R A;  3G7L A;  5DNF A;  1J8I A;  5CBA E;  2Q8R E;  1Q3L A;  2RSO A;  3I91 A;  4IUV A;  1VMP A;  4HAE A;  1WTX A;  1IL8 A;  4QUC A;  3GV6 A;  5T1G A;  5JJZ A;  1NR4 A;  1F2L A;  3IL8 A;  2XIW A;  5COY A;  4DN4 M;  2B2W C;  2DY8 A;  2RSN A;  1WD0 A;  2K28 A;  1RTO A;  3H91 A;  4MN3 A;  4X3T A;  4ZK9 B;  3TN2 A;  2RVL A;  4IUR A;  3FDT A;  3MTS A;  1SDF A;  3I3C A;  1E0B A;  2RA4 A;  1C8C A;  4IUT A;  1X3P A;  5AFW A;  3R93 A;  2JP1 A;  2B2V C;  4XDX A;  4CJ2 C;  1RHP A;  4X3S A;  1BNZ A;  1AP0 A;  2HCI A;  2FFK B;  5E4X A;  2KOL A;  3I90 A;  3SVM A;  3D6W A;  1KNE A;  1EIG A;  3KBX A;  5COR A; 
#chains in the Genus database with same CATH topology
 3IFD A;  3QOL A;  1Q90 A;  4DV1 L;  3FVQ A;  1EQT A;  3CCR A;  1ROD A;  2JA5 G;  3AYH B;  4K0K L;  3AFP A;  3G48 A;  1K8O A;  1YNX A;  1TKW B;  4BXX G;  1AE3 A;  5DM7 3;  4A3L H;  2UUA L;  4POG A;  1CA5 A;  1FNV A;  1XPU A;  3RUZ A;  2YTY A;  4JI8 Q;  1IZ6 A;  1C7Y A;  5E7N A;  3KJP A;  1K8M A;  5EPK A;  1BDO A;  1EL0 A;  2AKW B;  1HNZ L;  1S3O A;  2XRS D;  4BY7 G;  4DF7 A;  2VB3 X;  4B9X A;  5BN4 A;  1SE3 A;  1I4R A;  1VQN A;  3MWY W;  1PTO H;  3I4M H;  5FLX c;  2N8N A;  1WTQ A;  5M5W B;  3D0F A;  5C4Z A;  2L15 A;  4WRD A;  4XQQ A;  4X66 L;  3S2D H;  2HIV A;  1Q7Y C;  1RJT A;  5IWA Q;  3HOX G;  2CH4 A;  4C3J H;  1H9R A;  5IP7 G;  4OO1 I;  4C3H G;  5K5P A;  3G6E A;  2BH8 A;  1XNQ Q;  1HFN A;  1IKM A;  1E24 A;  1LM0 A;  4UP8 A;  4QCL A;  3L9A X;  1BVS A;  4Q0F A;  1HNW L;  3GTO H;  2B2Y A;  3BZC A;  4IUQ A;  4A76 A;  2BOS A;  4H02 A;  4G57 A;  2B8G A;  1E1O A;  4QMG A;  1PTO F;  4A3E G;  5FLX L;  1YVC A;  3JAM c;  1EIH A;  4KK7 A;  4OIJ A;  5BN5 A;  4DR1 Q;  2K04 A;  1YJW A;  3Q23 A;  2Z9H A;  2A19 A;  4QY7 A;  1O7I A;  2KUM A;  3FHW A;  1S5B D;  5M5X H;  1AN8 A;  5J22 A;  5M3F B;  2PQE A;  1M4V A;  4IUV A;  5GQO A;  2I5M X;  3M7N A;  1IL8 A;  2CKZ B;  1C48 A;  3KK7 A;  4DV4 Q;  3NWT A;  1HH2 P;  1P8L A;  3CMA A;  5JJI A;  3TP8 A;  1N36 L;  2WB1 E;  4NMZ A;  2OQ0 A;  2RA4 A;  1B50 A;  4CJ2 C;  1AP0 A;  1NMF A;  1GM5 A;  1NMG A;  3MAQ A;  3NEL A;  4LW1 A;  1FVI A;  3JAM L;  4A3B G;  1ZEQ X;  1PFB A;  1JWS D;  3NK9 A;  1X3Q A;  1G2S A;  3H3V C;  1LTT D;  3A5U A;  3CCE A;  2M2L A;  5KYI A;  4JBW A;  3SK6 A;  4JYA L;  3MFY A;  5JAV A;  3PGZ A;  3T1Y L;  3K6O A;  4PQX A;  1TWG B;  4MZ9 A;  5JEA H;  1TY2 A;  4DV0 L;  4BY7 B;  1M1K C;  4FP5 D;  2K52 A;  3FPP A;  3TZD A;  1ONL A;  1ENF A;  5CBE E;  1TU2 B;  2EYM A;  3EJI A;  2Z4I A;  5FO7 B;  1CSP A;  1C4Q A;  2XTI A;  2EJF C;  2AQ1 B;  2AUK A;  3H6M A;  4K8J A;  2BDO A;  2L11 A;  3JAM i;  4DV5 Q;  1XMQ Q;  3PO2 H;  3TRZ A;  1ASY A;  1FJG Q;  1J9O A;  2E2I H;  4UP9 A;  1R9T H;  4L5S A;  1LO5 D;  2JK8 A;  1HTL D;  1Q8K A;  3HOX B;  3A8I E;  2Q2H A;  4KJN A;  1VQG A;  3GTJ B;  1GUW A;  1JB7 A;  3S2H H;  2KEE A;  1H9K A;  5CV9 A;  4LF5 Q;  4JI0 L;  3GTG H;  4FDB A;  1EIY B;  4X62 L;  1FD7 D;  2DJF C;  3OMC A;  3ERQ A;  2VB2 X;  1PRT D;  3SHL A;  4YY3 L;  5C0X J;  2MGS A;  3U9S A;  3UDX A;  1B4O A;  3M3Y B;  1VQ7 A;  1L1O C;  3OHX C;  1JJC B;  1CQV A;  1SYC A;  2FMM A;  2UUC Q;  1E1T A;  5E1F A;  3ND8 A;  2VW9 A;  1E7Z A;  4JCV E;  2K5D A;  1Q3L A;  1UE5 A;  2ALY B;  1ZKO A;  5FKA C;  2BCO A;  3EN2 A;  2QEX A;  5JVH 3;  4FF4 A;  3AB9 A;  3IL8 A;  1SMX A;  1S5D D;  2A5H A;  5AJ3 L;  2K7V A;  1XPO A;  3IAY A;  3HOZ H;  1I4Q A;  4MN3 A;  3RNU A;  4LF6 Q;  2F4I A;  4AYB G;  3FDT A;  1KIX A;  3I55 A;  1MIU A;  5IGG A;  4DK6 C;  1QZG A;  4LFA L;  3R93 A;  1NUC A;  3E3X A;  2L0C A;  4QJF A;  4FF3 A;  5KYL A;  2LXK A;  5IYD G;  4WJW A;  3F2C A;  3K7A H;  1KNA A;  4A3B B;  4GKJ L;  2VQF L;  1XNR L;  2FHT A;  5EPL A;  5M3M B;  4RH6 A;  2MQH A;  4RHS A;  2EY5 A;  1IW7 C;  4CDE C;  1A2T A;  4KY7 A;  1HR0 L;  1TII D;  2NN6 G;  3LWU A;  1BBU A;  1K8G A;  5C3X A;  2RDF A;  4K0K Q;  3OTO L;  3QJY A;  2MPM A;  1FGB D;  4XYQ A;  4QQB X;  2UUA Q;  4X65 L;  2XWJ B;  4A3L G;  2A6E C;  4A3F H;  3R3O A;  1OXT A;  4ZKC B;  1U0L A;  5C6A A;  1HZC A;  4P73 A;  3M4O B;  2E8G A;  4J6H A;  3D8G A;  4R8I A;  5L37 A;  1D5M C;  1JT8 A;  5EBD A;  4XYO A;  4B3T L;  2KED A;  1EFW A;  1EUJ A;  3IKJ A;  2H4O A;  3TP6 A;  4OEL B;  2IX0 A;  2RKS A;  1H9J A;  1DZ1 A;  2E2H B;  2AWO A;  5IY0 A;  3I4M G;  2X6G A;  4AQY L;  1PRT F;  4IFD I;  3A7L A;  4X66 Q;  1WFQ A;  4NPS A;  1QE6 A;  2TSS A;  1F9P A;  1STH A;  3CME A;  2AWN A;  2EYL A;  1DON A;  3D4D A;  4C3J G;  1JWM D;  1OXV A;  4DV6 L;  1G8Z D;  2OCE A;  4GN5 A;  2O2L D;  3QG1 A;  1LTG D;  3A8J E;  3CRL C;  3M7G A;  4RCN A;  4HJ7 A;  2JQO A;  1A8V A;  1ZYR C;  3IRB A;  1XYI A;  4KHP Q;  1BBX C;  1JOQ A;  1QUQ A;  1DCZ A;  1SE4 A;  1U4R A;  5ISR A;  1VQD A;  3H3V H;  4PV1 C;  3RR5 A;  5J39 A;  4WJ3 M;  2DGY A;  3AFQ A;  1K3R A;  5CV5 A;  3I4O A;  3RD4 A;  1QVG A;  1IBK L;  3S1Q B;  3CF5 A;  2J4X A;  2F0W A;  3VYT A;  3WOE A;  2NZH A;  4UY8 C;  2NBF A;  4B08 A;  1FGU A;  4G7Z C;  1IYV A;  3CU7 A;  1JCK B;  4R4Q A;  2OQK A;  2K32 A;  1SYE A;  1GHJ A;  4KY5 A;  1QWY A;  4BS9 A;  2JEA I;  3NQT A;  3T16 A;  1Y69 U;  1K8A C;  5CR3 A;  1JC7 A;  1TS2 A;  2CVR A;  4KD4 A;  1ML0 D;  3RN5 A;  4FF2 A;  3MC0 B;  3H15 A;  2EDG A;  3K5M A;  1PH9 A;  1A15 A;  4DKA C;  2YTV A;  5EPJ A;  4V19 0;  5ELB A;  2LY7 A;  4MNO A;  1LAC A;  1YJN A;  2YTX A;  1JB3 A;  2GVB A;  4JYA Q;  1Y8P B;  3K7U C;  1BCP D;  4F88 A;  2IX3 A;  1FL0 A;  3TBI B;  2A69 D;  5M5Y B;  2EQS A;  1LT4 D;  2F0G A;  3GP7 A;  4DR3 Q;  4ZUJ A;  1CHQ D;  3A56 A;  4JI8 L;  2K01 A;  2E75 C;  5JEA G;  1UUP A;  2B3G A;  2OWO A;  2ZTC A;  4CJ0 B;  4XQN A;  4YCV A;  1A6X A;  2EYJ A;  3PV0 A;  2KA7 A;  3J7A 5;  2QA4 A;  5I6W A;  4MTK A;  2IY5 B;  1PTO B;  1VQI A;  1AFP A;  2RCN A;  1KRS A;  3L0O A;  2K03 A;  1I5F A;  3VR4 A;  3S2D B;  2F0J A;  3OW2 A;  1CM9 A;  3K0Y A;  5A2Q E;  2E2J H;  2F1M A;  4YIJ A;  4C3J B;  1E2W A;  5IWA L;  1TWA H;  4ZCK A;  4WOR A;  3J81 j;  2X6L A;  1WTW A;  1V1Q A;  1G91 A;  1STY A;  2J0T D;  4Z9C B;  2A68 C;  4DK1 A;  4X62 Q;  3FPU B;  4QL5 A;  4LFB Q;  1MGS A;  2ZTD A;  1RTN A;  4YY3 Q;  2FIN B;  2Y0S G;  1EOT A;  2F0M A;  3GTO B;  3J7A F;  2A73 B;  2JN4 A;  2RSO A;  3CCQ A;  1D7Q A;  1G6P A;  2PMZ B;  1SYG A;  4DR1 L;  1R4Q B;  3W2D A;  2F0K A;  1PTO C;  5IYB H;  3OWE B;  5M5X B;  5AJ3 Q;  1X3P A;  4XDX A;  3W5O A;  2O5I C;  1KL9 A;  1Q8I A;  3HOZ G;  3KBX A;  1Y1V H;  4DV4 L;  3NTI A;  2QDL A;  4K8I A;  3OSO A;  4FO2 A;  4DUY Q;  3RLF A;  3SK8 A;  3BYT B;  2JYO A;  3PIO A;  1PYS B;  1KQS A;  3M4Q A;  4P72 A;  1BCP F;  4JV5 L;  3MXU A;  2A8V A;  4A93 H;  4EQ5 A;  1PZK D;  3TQY A;  2PCF B;  1LTL A;  2WII B;  5M3M H;  2ZJQ A;  3HOW B;  1WCM H;  4DAY A;  3PIP 3;  4TSS A;  1B7Y B;  4FXD A;  4DXG A;  3OTO Q;  5CC4 A;  1U4M A;  2K14 A;  3F2U A;  3HKZ E;  4J1M A;  3U58 A;  2D0O A;  3J81 E;  3P75 A;  3G4S A;  5GAG C;  1TR5 A;  2XWB B;  5I4D A;  1M90 C;  1SNO A;  1I6H H;  4NXM Q;  3S17 H;  2NTS A;  2D62 A;  4A3F G;  3J80 c;  4BBR H;  1I4P A;  3CP0 A;  1HFG A;  2H5X A;  1E3P A;  1EZ6 A;  4DNI A;  4DAV A;  1V43 A;  3C1F A;  3P7J A;  3N6R A;  4A75 A;  3GTL H;  3CW2 C;  3HOV H;  3OWF A;  3LGJ A;  1QVF A;  2R7Z H;  3PO2 B;  2IHF A;  2E2I B;  5JJK A;  4DV5 L;  4AQY Q;  4N9P A;  1C9O A;  2DY7 A;  4UHV A;  1LTI D;  2UXD Q;  4DV2 Q;  4OHJ A;  3HKS A;  2Q2T A;  5IT9 c;  5G3L D;  3HOU H;  1EYA A;  3QO2 A;  2K50 A;  3JC6 6;  3S2H B;  1T5X D;  1JOO A;  1MSG A;  2KVM A;  2XN9 C;  4FVM A;  3V96 A;  1VMC A;  4PZ8 A;  1WTH A;  1I4G A;  3CC7 A;  1H9S A;  4LF5 L;  3J80 L;  1X56 A;  1FNW A;  3OMG A;  4A3I H;  2AMC B;  2RBM A;  2Y0S B;  4RCO A;  1E2Z A;  3NTH A;  3I91 A;  5KNB A;  1WTX A;  4QUC A;  1HQR D;  2NVY H;  1NR4 A;  2ZM6 L;  4QB4 A;  1RTO A;  3H91 A;  2PQA B;  2NTT A;  4ABN A;  4HIK A;  2UUC L;  5C5L A;  3K5N A;  4RGN A;  1SXT A;  4ZQ3 A;  1C8C A;  3NBI A;  1S5E D;  4IOC A;  3S1Q H;  1UEA B;  2Z6K A;  1S5F D;  3HOZ B;  3ULL A;  2PPB C;  1CZG A;  4G4K A;  2MO1 A;  4LF6 L;  1B70 B;  5E4W C;  4RGM A;  4X3U A;  3W1B A;  5FO9 B;  3F2D A;  3T51 B;  1YZ6 A;  2B2V A;  2NWG A;  1B3A A;  1QUQ B;  4GZY C;  1KDA A;  1BBW A;  3HP3 A;  3ONA B;  1QJO A;  1QB5 D;  4CDC C;  1UE7 A;  5C4H A;  3T53 B;  3F1Z A;  4GOP C;  2F3I A;  3SEB A;  3R8B A;  1YEZ A;  2SOB A;  5IOD A;  1YNN D;  1PRT B;  2QDB A;  4X64 L;  1YI2 A;  1EQR A;  3NSW A;  3HKZ G;  1GJX A;  4NP5 A;  1WJJ A;  4O42 A;  5C3E H;  2MJ8 A;  4DXF A;  2OXP A;  2F0S A;  2HDM A;  3DUZ A;  5M5Y H;  4A3F B;  4FF1 A;  1MI2 A;  4NKL A;  2IPK D;  4H44 C;  2Z6B A;  3KYH C;  3KLW A;  5G3L F;  5KNC A;  4N9T A;  1OXX K;  4K5W A;  3PUV A;  1Q82 C;  1WTO A;  4JI6 L;  1X3G A;  4F7X A;  1H9M A;  2SDF A;  1SFO B;  2L5T A;  2KCT A;  3HG9 A;  1HNX L;  4O0A A;  5D3D A;  1CK1 A;  3QIA A;  3E5S A;  2EY2 A;  1B9N A;  1PFM A;  2TMP A;  4R4C A;  3K57 A;  3I70 A;  2JA6 H;  1PRT C;  1UNS A;  1U4P A;  1Z6H A;  2MNA A;  3NTK A;  3J7Z C;  3ER0 A;  2I0Q A;  3D3R A;  1VS0 A;  3BG3 A;  5HY6 A;  2WAQ G;  1EY7 A;  2XIW A;  2AQ3 B;  3FMC A;  4DN4 M;  2F4V L;  4XIG S;  4KHP L;  2VUM H;  1LLR D;  4P2C B;  3I3C A;  3M4P A;  2YV5 A;  5LL6 S;  4OWX B;  5ELN A;  3MHB A;  5EAY A;  1BOS A;  3D6W A;  4XQJ A;  1PV4 A;  2ZJR A;  1NY4 A;  2LFN A;  5JEA J;  5IYB G;  5E3F A;  4CHT B;  4NXN Q;  1ENC A;  1GHK A;  4JOI A;  3A0J A;  4X6A H;  1DYQ A;  4GN4 B;  1Y1V G;  5FJ8 H;  3F8T A;  1QCB D;  3KLS X;  4L5T A;  1AZQ A;  1Q1B A;  2UU9 L;  4JV5 Q;  3DLL A;  1XX8 A;  3MA2 B;  2KCC A;  3GDE A;  1HZB A;  3U4V A;  3CXC A;  2PW5 A;  4YWL A;  5IE8 A;  4DV3 Q;  2R93 B;  4CKE A;  2NVQ H;  4S3S A;  4A93 G;  1L0Y B;  1L0W A;  3HKZ B;  5M3M G;  3HOW H;  1CSQ A;  2Q8I B;  1GD7 A;  1WCM G;  4HED A;  2VQE Q;  1K73 C;  2LMC B;  1EZ8 A;  5CGK A;  3KDF A;  1SYD A;  1PH7 A;  2HQE A;  2F3W A;  2F52 A;  2JSO A;  1N32 Q;  1MSH A;  4B3R Q;  2RHQ B;  1DOL A;  2N3S A;  4A3D H;  1HR0 W;  2CQA A;  2B2T A;  4HID A;  3PF4 A;  3H94 A;  1K0S A;  1LYL A;  5LMN W;  4DR3 L;  1I94 Q;  3BVZ A;  3CRK C;  1TY0 A;  1J5E Q;  2A74 C;  3VDY A;  1SYB A;  1K9M C;  4DU9 A;  5H1S E;  2E5L Q;  3URY A;  1L1O B;  1SE2 A;  3PIP A;  4BBR G;  4DR7 Q;  1VQH A;  4B3S L;  3KBG A;  3ICE A;  4IQZ A;  4IPC A;  4DAY B;  3HOV G;  1EY0 A;  5K36 H;  3IFT A;  1EYG A;  2PZW A;  2R7Z G;  1ESR A;  3UE0 A;  3UI2 A;  4J8Q A;  1VQM A;  1QOH A;  5TSS A;  4HCE A;  1PH5 A;  2E2J B;  3X3M A;  3K5O A;  3SE0 A;  2FXQ A;  1KAA A;  2UUB L;  1TWA B;  3G7L A;  4IOA A;  3HOU G;  1I3Q H;  2F0N A;  5IGE A;  1VMP A;  2F0T A;  3FRP B;  1PYB A;  4LF4 L;  2WAQ B;  5COY A;  2PI2 A;  5C3W A;  2HIX A;  4GN3 B;  2BA0 A;  2K28 A;  3TP7 A;  4HJ5 A;  4LFB L;  4A3I G;  2R7D A;  1BCP B;  2K5N A;  2HQL A;  3KLR A;  2ICI A;  3NPP A;  2NB0 A;  2ZM6 Q;  1W2B A;  2B63 H;  1KTK A;  1DGS A;  1F77 A;  3E9I A;  1GXD C;  3AMU A;  1EIG A;  2KQ3 A;  1GUS A;  4GLX A;  4TKO B;  3PIO 3;  4ODG A;  3D6C A;  1HZ9 A;  1VF5 C;  1V9P A;  2HCC A;  3DWA A;  1HQM C;  1B2T A;  3HRZ C;  1C0A A;  1VQO A;  1G51 A;  1Y1V B;  1A0I A;  1H9S B;  1SNC A;  3EA6 A;  2O5J C;  2NYZ D;  2CW0 D;  2WB1 G;  5CMD A;  4A4I A;  4DK3 C;  2N49 A;  4CDD C;  3CCV A;  3SR1 A;  4Q5V A;  4DUY L;  3PUX A;  2QIL A;  2M9V A;  3PQI A;  2ASB A;  1I50 H;  2PNR C;  5EKI A;  4LF9 Q;  3W1G A;  2PI2 E;  1SR3 A;  3TEH B;  2GN5 A;  4A93 B;  1LTB D;  2VXW A;  1X3E A;  4POF A;  1AEX A;  1U9R A;  1I6V C;  1BCP C;  4LUO A;  2KHS A;  1WCM B;  3STB D;  5LHY 1;  2A69 C;  1SJE D;  3ERO A;  4OWT B;  4QUF A;  4X64 Q;  3UDG A;  2Z0S A;  1KAB A;  1S4Z A;  2R61 A;  1YHQ A;  2N55 A;  3GTP B;  3S15 B;  5IT9 E;  1B1Z A;  4ME3 A;  1GO3 E;  2OF1 A;  1CT1 D;  1MD2 D;  5DEH A;  3K0X A;  3M85 A;  4ULL A;  4IAL A;  2N88 A;  3RZD H;  5C3E G;  1D1I A;  1ILQ A;  3SK4 A;  4EX5 A;  4KHZ A;  1YHB A;  4RMF A;  3ULP A;  3HZX A;  4ZLT F;  1I6H B;  5EJW A;  3S17 B;  1SLJ A;  3MFG A;  4JI1 Q;  1MHW C;  2Z4H A;  4BBR B;  4NXM L;  4OL7 A;  3K58 A;  1CKN A;  5C0X H;  4BWG B;  1UAP A;  1JQY D;  4LUZ A;  5F2D A;  3NBH A;  3GTL B;  4JI6 Q;  3MXG A;  4GOP A;  3V05 A;  3HOV B;  3GO5 A;  1G29 1;  1GUN A;  4IPH A;  2AQ2 B;  3RLN A;  4PMB A;  3M4Y A;  4O2D A;  4BY1 H;  1BXT A;  2R7Z B;  2NN6 I;  5IOC A;  1HNX Q;  3CC2 A;  3EBE A;  4HSP A;  4ALP A;  3DM1 A;  1SFO H;  1DD2 A;  5JJL A;  4DR4 Q;  1F2Z A;  4M8A A;  2PO4 A;  2UXD L;  5CBA E;  3TS2 A;  2EY6 A;  3HOU B;  3CPW A;  1MJC A;  4DV2 L;  3RLO A;  2Z6K C;  2JA6 G;  2ZXO A;  3DM3 A;  1F2L A;  2KCN A;  2KHI A;  5LMU Q;  5KGU A;  3GTK H;  3K80 C;  3FP9 A;  1XWE A;  4A3I B;  4DGZ A;  1SEB D;  3EIV A;  1B44 D;  1JJ2 A;  1XPR A;  1RD9 D;  2F4V Q;  2B2V C;  2NVY B;  1YHA A;  3I90 A;  1TWC B;  1Y8O B;  2D2C C;  1KNE A;  1I4H A;  2XSC A;  2IHE A;  2VUM G;  2K5Q A;  3DWP A;  4LUV A;  4RWS C;  1NCV A;  5JOB A;  1ENA A;  4PZ7 A;  2K5H A;  3NQI A;  3AEV A;  5I2X A;  4YHH Q;  1DOM A;  4A3K H;  2WP8 J;  4QIW E;  3BDO A;  3WDN A;  1STE A;  2WB1 B;  2VZA A;  1EYD A;  1HPC A;  4GS3 A;  5KRU A;  3M9B A;  1BF4 A;  3CPF A;  1D5X C;  2QGQ A;  3C46 A;  5FJ8 G;  2UU9 Q;  2QCP X;  5D65 A;  3A5Z B;  1IL2 A;  3U4Z A;  1D2B A;  1KDB A;  2L12 A;  5C4J H;  5FLX E;  4AH6 A;  5ELC A;  3C3L A;  4UPA A;  4QGU A;  2R93 H;  1UE6 A;  5CV4 A;  3B6Y A;  4GNX A;  1O80 A;  2JXM B;  4Y7N H;  3UDI A;  3AQQ A;  3HOW G;  4KKU A;  1B53 A;  3S1N H;  2A6H C;  1STG A;  5C3E B;  3I4N H;  4H13 C;  1Q86 C;  3SK5 A;  3HS0 C;  3KLS A;  3ULJ A;  3MVV A;  4A3D G;  2ID0 A;  3UE1 A;  2EJG C;  3SGI A;  2EIF A;  3I8Z A;  4JI4 Q;  3KUP A;  1W6K A;  5HUR A;  4KTA A;  4JI2 Q;  3PSI A;  4B3S Q;  1VQE A;  3E0J A;  3KF8 A;  2JA5 H;  1PDQ A;  3JAM E;  1TWH H;  4CKB A;  3KFU A;  1B3Q A;  3OIP A;  1GUO A;  1EOV A;  1VQ5 A;  2JE6 I;  5K36 G;  2PYK A;  3L7Z C;  4JBJ A;  1D6E C;  4FNF A;  3KDF B;  5I9P A;  1F2Y A;  3CCS A;  3L2P A;  3PO2 G;  1Y14 B;  1N9W A;  4DPG A;  4E6I A;  4OO1 H;  1RKN A;  4HAE A;  2G5D A;  2JA6 B;  2UUB Q;  1B8A A;  2D0P A;  2HT1 A;  2WAC A;  1IYJ B;  1YNJ D;  2WKC A;  4LF4 Q;  4UDU C;  4JOI C;  4K6L A;  1VQB A;  1X9N A;  1QIL A;  4I7A A;  4PNY A;  4JI7 Q;  4N8F A;  1SNQ A;  2B2W A;  4ZAI A;  4LNQ A;  3OOC A;  1JOK A;  3PMF A;  2VUM B;  4GKK Q;  1WI5 A;  2B63 G;  3PO3 B;  4KHV A;  1BKB A;  2CFM A;  1KD1 C;  2EVB A;  3RZO H;  1IYU A;  3KJO A;  2K5W A;  2EJM A;  3EVQ A;  4A3M B;  4IUU A;  4WFN 3;  3H0G H;  1EY5 A;  1IBM Q;  4DAP A;  4LFC Q;  1IBL L;  3BDC A;  4N8X 1;  4DUZ L;  3K81 C;  3W3A A;  1EU4 A;  2KHJ A;  4K2K A;  4NXN L;  1Z9F A;  2UXB Q;  2YU9 H;  4WJ4 A;  2LSS A;  4KI0 A;  5DM6 3;  3P20 A;  2RDG A;  4P75 A;  2SEB D;  2B2T C;  1EIF A;  1YNN C;  2L4N A;  1V1O A;  2DJG C;  1F2M A;  1QNK A;  1XTD A;  2IT1 A;  3H09 A;  4R4O A;  1VQP A;  4KLK A;  3L3O C;  3X3N A;  4K14 A;  2NVQ B;  5D14 A;  1V1P A;  2DNC A;  4DV3 L;  2UXC Q;  3A8K E;  3HGB A;  1CHP D;  2L1B A;  1EY6 A;  3DEP A;  2JA7 B;  4GLA C;  1NBW A;  2E74 C;  4CJ1 B;  2D9U A;  2WFW A;  5ELE A;  1PH6 A;  2VQE L;  3GTP H;  3S15 H;  5EKK A;  3CCL A;  2VY3 A;  1FYC A;  2KBN A;  2QW7 A;  4K5X A;  4A3D B;  1N32 L;  4ME5 A;  4B3R L;  4K2L A;  5LL6 X;  4C56 C;  1A63 A;  3G71 A;  5IGD A;  3F2B A;  4JI5 Q;  1I94 L;  2R6G A;  4IJH A;  1J5E L;  2A6H D;  1CZW A;  5BN3 A;  2E5L L;  2JA8 B;  5IGB A;  1VQC A;  5C0X G;  4DR7 L;  5LMN Q;  2HHH Q;  2CWA A;  3RMH A;  4EVO A;  3MEH A;  2Q8R E;  1MJE A;  4BY1 G;  3BU2 A;  2ZT9 C;  2DNE A;  1LTA D;  4B9W A;  2KJX A;  5T1G A;  5C44 H;  3TME A;  2ZTE A;  4KY6 A;  1XXG A;  1YIT A;  2E2D C;  1WD0 A;  2F0E A;  4RGO S;  5NUC A;  5KND A;  2NUC A;  2ZXR A;  1S40 A;  2BE5 D;  3ITP A;  3R2I A;  4HMJ A;  1I3Q B;  1LT6 D;  2K5V A;  1YBY A;  4X3S A;  3CC4 A;  2LXJ A;  5E4X A;  2KOL A;  3SVM A;  1CKN B;  2XGT A;  3QB3 A;  3NBH B;  2QEJ C;  4GOP B;  3S14 H;  2GVA A;  4ZUI A;  2CWP A;  4R4T A;  4JPB W;  1STN A;  2EYO A;  2B63 B;  2XNA C;  4HR7 B;  4UAI A;  3TDQ A;  1A62 A;  1CA6 A;  1TWC H;  4EQO A;  2VNU D;  3OYY A;  2Z1C A;  1BUV T;  3J7Y W;  4JG2 A;  3HFZ B;  3KF6 A;  1HRJ A;  2F0O A;  4QIW B;  5ELO A;  2CQO A;  3K5L A;  4F8M A;  1JOR A;  4CGY B;  1PMR A;  2R92 H;  4RGT A;  2HUG A;  3G6J B;  3ZJY C;  1PH4 A;  3GV3 A;  3O13 A;  2PZU A;  4A3K G;  4DR2 Q;  2H1E A;  1LV9 A;  1QZH A;  3I72 A;  1VDZ A;  4HJ9 A;  3DEO A;  2QF7 A;  1K0R A;  3VR5 A;  3J80 i;  1I50 B;  1Z7T A;  1JR0 D;  1HZA A;  1RL2 A;  1S5C D;  2F0U A;  3CCU A;  4LF9 L;  1K83 H;  3CQZ H;  2EXD A;  1STB A;  4EGV A;  1T9H A;  4G7O C;  3H3V I;  4DR5 Q;  1A2U A;  4NW2 A;  3C2P A;  2R93 G;  4HCS A;  4ID6 A;  1UE1 A;  1O7L A;  1R4P B;  2WKD A;  1CQF A;  1PH3 A;  1TVX A;  4LAA A;  5IGC A;  3T1H L;  5T1I A;  3S1M H;  1TWF H;  3NHH A;  3RZD B;  4JI3 Q;  4OON A;  3I4N G;  1JMC A;  1M8A A;  1A3T A;  4KN7 C;  1BR9 A;  1VQF A;  1Q46 A;  4JVZ A;  1Z47 A;  1WOC A;  2K1B A;  2NVX B;  3T56 B;  4JI1 L;  1PFS A;  2F0Q A;  4MHE A;  5DNF A;  1J8I A;  3GTQ H;  2EYF A;  4IFD H;  1PHJ A;  4BY1 B;  5C4X B;  4GNX B;  5JJZ A;  1A3U A;  4NDX A;  1K28 A;  2RSN A;  2F03 A;  4X3T A;  4ZK9 B;  3E9H A;  4DR4 L;  3P1H A;  2K6A A;  1OTC A;  1ET6 A;  3VA7 A;  2V1C C;  4EQP A;  4OO1 G;  1VQK A;  4XTC S;  1SJH D;  3MXP A;  2AHO B;  2JP1 A;  4RKL A;  4C2M H;  2HCI A;  4DR6 L;  4C3I H;  2BA1 A;  3GD7 A;  5IGF A;  3DMU A;  3J7A V;  2BDN A;  2OT2 A;  5LMU L;  3GTK B;  2F0V A;  5EQ0 A;  1XJV A;  3KF8 B;  2ATW A;  4LMQ D;  3CHB D;  3HOY B;  3ERS X;  5C5M A;  1HA6 A;  1HCZ A;  1TS3 A;  2L9H A;  3WOF A;  4LK1 C;  1U5K A;  2FMC A;  2MP1 A;  5GAE C;  1LTS D;  1SSO A;  4BA1 I;  1JWU D;  2CHB D;  3PO3 H;  2CW0 C;  2WV6 D;  1HA5 A;  2EE1 A;  1CUK A;  4A3M H;  4GNX C;  4XT3 B;  3H0G G;  1PFN A;  2G9D A;  1IBL Q;  1PZJ D;  4I7Z C;  4A3K B;  4DUZ Q;  3D4R A;  4YHH L;  4RFB A;  3FKI B;  3QWN A;  4HSV A;  2RF4 A;  4TQU S;  2V4D A;  5IIF A;  1WTP A;  4XXE A;  4BBS H;  4OX9 Q;  2HD3 A;  1U4L A;  3STB C;  2XVS A;  1WYD A;  1D1K A;  1II3 A;  1GKH A;  2P5Z X;  5C4J B;  5CV6 A;  1STA A;  4RAU C;  5DLQ E;  3PF5 A;  2IWH A;  3I73 A;  2J7Z A;  4DV7 Q;  1N34 Q;  4Y7N B;  2JA7 H;  4BA2 I;  4C1N K;  3S1N B;  4HIM A;  2D5D A;  1X65 A;  4KN4 C;  3I4N B;  1E2V A;  4AYB E;  3VR2 A;  4LF8 Q;  2MFI A;  2ENB A;  3BS1 A;  5A35 A;  4HN7 A;  1TQO A;  2EPB A;  4M1U B;  4HMI A;  3NP8 A;  2F0H A;  1Q12 A;  5IYC H;  2F0P A;  4JI4 L;  3T4A C;  5BR8 Q;  1PXU A;  2KCM A;  4KKT A;  4JI2 L;  1SYF A;  1HXY D;  1EQQ A;  2JA5 B;  2JA8 H;  2DN8 A;  1V1P B;  1JJG A;  1TWH B;  2B2W C;  1QVC A;  5A2Q L;  4R4I A;  4LWC A;  2RVL A;  4IUR A;  4A3G H;  1XMO Q;  3MTS A;  2ES2 A;  3VYR A;  4B3M Q;  5C44 G;  3Q24 A;  1SRU A;  4FYD A;  5JPM C;  2MUY A;  2RHS B;  1VF7 A;  1X3F A;  3GTM B;  2OEO A;  1ESF A;  3CD6 A;  3D31 A;  1SNP A;  1IKL A;  4K6D A;  4L6T B;  1SRO A;  4IZ8 A;  4FXG C;  4EQN A;  4LF7 Q;  3V2T A;  1TT2 A;  1Y1W H;  4JI7 L;  1EFI D;  2NVT B;  1LT5 D;  2KEC A;  3AU7 A;  2I5L X;  4GKK L;  4C3H B;  1SN8 A;  4DFA A;  1W6J A;  3RZO B;  3FEW X;  2B39 A;  3J81 c;  1CKM A;  3H0G B;  2MHV A;  1G2T A;  1KC8 C;  3VYU A;  4G7H C;  4JBK A;  2LKV A;  1FNU A;  2R92 G;  1IBM L;  4RG1 A;  4LFC L;  2IW3 A;  1GUT A;  4U67 3;  4ZKB B;  3I56 A;  3NE5 B;  4R9W A;  3U9O A;  1KLG D;  4A3E B;  4OXP A;  5IP9 H;  3S16 H;  4RKB A;  2YU9 B;  3A55 A;  3T13 A;  2B29 A;  3J80 E;  2UXB L;  1PH2 A;  5EBC A;  4XT1 B;  1ICF B;  4YWM A;  1DM0 B;  1KDC A;  1Q1E A;  1HHV A;  3CKI B;  4CBV A;  3S24 A;  1F9R A;  5I9O A;  3ND9 A;  4HJ8 A;  1X55 A;  2AUJ D;  3KF6 B;  1N33 Q;  3MEF A;  2PMZ E;  3BYY B;  3SDZ A;  3Q0A A;  2UXC L;  3J81 L;  1VQ4 A;  1O78 A;  2A1A A;  4DAM A;  2PZT A;  1X32 A;  2GA4 B;  1O7Y A;  3T1H Q;  4A3J H;  1MKH A;  3MXN A;  4F87 A;  2F0D A;  5DAU A;  4J15 A;  1K3B C;  2B2U A;  1MBY A;  1EWH A;  1TXY A;  1CFM A;  5CYU A;  2NVX H;  1A3V A;  3BZK A;  3CCM A;  3EQL C;  4JI5 L;  1EY8 A;  1D5Z C;  4DV1 Q;  1OXU A;  3RN2 A;  1VQJ A;  5LMN L;  3TN2 A;  3BVG A;  3NEM A;  2VS1 A;  2HHH L;  3DHQ A;  1CTM A;  4IFD G;  3PUW A;  5C4X H;  1RF2 D;  2R7F A;  3BZD B;  1RHP A;  1YNJ C;  5C44 B;  1PA6 A;  1W3S A;  3J81 i;  1PVO A;  3MZ5 A;  1YJ9 A;  4CKC A;  1SND A;  1F9Q A;  1UWV A;  1HNZ Q;  1WTR A;  3N52 A;  4R1J A;  5FLM H;  3KOJ A;  4DR6 Q;  2Z8L A;  4DK0 A;  2C5C A;  4P71 A;  1N8R C;  3EFX D;  4LJZ C;  4C3I G;  1GUG A;  2CCZ A;  1DXM A;  2PW7 A;  1NSN S;  4KJO A;  3A74 A;  2JEB I;  2NZO A;  3C1E A;  3S14 B;  1UEB A;  1ASZ A;  4DNR B;  4GLV B;  2IL8 A;  3HOY H;  2PQA A;  4JK1 C;  5M5W H;  2Q8T A;  1F9S A;  4NB3 A;  4ZRZ A;  4HJA A;  2SNM A;  2NZ1 D;  3Q6S A;  1PYW D;  4IPD A;  5EGT A;  3GQB A;  4UP7 A;  3U50 C;  1ET9 A;  3DWQ A;  1QNU A;  3BDL A;  3OPO A;  2R3Z A;  1BO0 A;  4RA8 A;  3PO3 G;  3PUZ A;  4L5R C;  2R92 B;  2F3V A;  1DOK A;  4A3M G;  1HJP A;  2K75 A;  4MIU A;  2OTJ A;  3DXJ C;  2Q2I A;  4DNT B;  2I46 A;  2RQX A;  4OWW B;  3S1R B;  3SXH A;  1HNW Q;  1AZP A;  4DR2 L;  2WIN B;  3FKI H;  1NJI C;  1EU3 A;  4Y52 H;  4YWK A;  1B9M A;  2SNS A;  1HUM A;  2CH4 W;  2Y0S E;  4OEM B;  3K59 A;  3Q8D A;  4BBS G;  1NR2 A;  1KRT A;  2E76 C;  4A3C H;  1J6Q A;  3NEN A;  3TSS A;  4R8N A;  1K83 B;  3CQZ B;  2K33 A;  1EY4 A;  2JJQ A;  5ELD A;  4JC0 A;  4YCW A;  4JW0 A;  5M3F H;  4DR5 L;  4AYB B;  3TS0 A;  2Q2U A;  3LWE A;  3HEJ A;  1NNX A;  5GAH C;  2JA7 G;  1EQV A;  3S1M B;  1N36 Q;  3NUC A;  1TWF B;  4TRD A;  4KV6 A;  1PZI D;  2I07 B;  1LTR D;  4JI3 L;  3TZU A;  4L5Q A;  2LS0 1;  2K4K A;  3UDF A;  3VA5 A;  1P16 A;  1XTC D;  2BH2 A;  1SNM A;  5IYC G;  5ELF A;  3LNN A;  1PH8 A;  3QOJ A;  4ILW A;  3GTQ B;  1SDF A;  1EY9 A;  1E0B A;  2JA8 G;  4IUT A;  3E6Z X;  1L2F A;  5AFW A;  3CAM A;  2BE5 C;  4BXX H;  1PH1 A;  5M9O A;  4K5V A;  4DA2 A;  3T1Y Q;  1IW7 D;  1EYC A;  4U68 A;  5FOB B;  4A3G G;  4IUP A;  2PNH A;  1TWG H;  2JA9 A;  1X6O A;  1JE4 A;  5JVG 3;  4DV0 Q;  4C2M B;  1KLU D;  1KXL A;  4BY7 H;  4PMC A;  5D3I B;  4C3I B;  3GTM H;  1EEI D;  3A54 A;  4IO9 A;  3WWV A;  1SE8 A;  2RCF A;  1VQ9 A;  1VQL A;  4OIK A;  2A6E D;  2B2Y C;  2X69 A;  3I4M B;  5J3B A;  5HGT A;  5CV8 A;  1JIC A;  3LX0 A;  1HTP A;  5FK9 C;  3ZYY X;  5KIX A;  1Y1W G;  4PG3 A;  3CCJ A;  1SBB B;  2FJ2 A;  2NVT H;  3I2Z A;  3QR8 A;  3HOX H;  3E0E A;  1DJR D;  4V0B A;  4PZ6 A;  4TVA B;  5IP7 H;  1IXR A;  3S9W A;  3GTJ H;  4C3H H;  3R2T A;  1VQ6 A;  5EKL A;  4JI0 Q;  1YIJ A;  1CI3 M;  4H7B A;  1RDP D;  2N78 A;  1ZXT A;  1WD1 A;  1Y8N B;  1XNQ L;  1GVP A;  3I7F A;  4X3K A;  1EWC A;  3K8A A;  4QF4 A;  4RHR A;  1NAP A;  2K05 A;  4A3E H;  4BBS B;  1EWI A;  2M00 A;  5IP9 G;  3M3Y H;  4OX9 L;  1EEF D;  2F0F A;  4FXK C;  5KEE A;  1RIP A;  1WVL A;  1H95 A;  4L63 B;  1ZYR D;  1TS5 A;  5FO8 B;  4KMU C;  1SAP A;  2C9O A;  1AE2 A;  2F0I A;  3I4L A;  1SMY C;  1ICW A;  2EYP A;  4DV7 L;  1N34 L;  4IPG A;  1BQQ T;  4YCU A;  4LFA Q;  1Q81 C;  2ZJP A;  2I5H A;  3NXW A;  4OGQ C;  3VR3 A;  1JE5 A;  3PUY A;  4A3J G;  3GV6 A;  4LF8 L;  1L1O A;  4GKJ Q;  2VQF Q;  2C35 B;  1XNR Q;  2OTL A;  4A3B H;  5CV7 A;  1FR3 A;  5GRO A;  2IX1 A;  4MTN A;  1HR0 Q;  4CDF C;  5BR8 L;  5GAD C;  2EY1 A;  4APV A;  1VQA A;  2XRQ D;  1LT3 D;  1X54 A;  1G6Z A;  1NE3 A;  2RDH A;  4A3G B;  4X65 Q;  1PLF A;  1WTV A;  5C4X G;  1XMO L;  3MXN B;  1ILP A;  4IN3 A;  4B3M L;  4JBM A;  2ZXP A;  3D4W A;  4PMW A;  2YYZ A;  3M4O H;  5FLM G;  4HIO A;  1HUN A;  4B3T Q;  5J1Z A;  1VQ8 A;  1RCV D;  5C0X I;  1AW7 A;  2IJ0 A;  1XMQ L;  1Y1W B;  1R9T B;  2E2H H;  4LF7 L;  1FJG L;  4AIM A;  3HOY G;  1GOZ A;  1NTG A;  2MO0 A;  4KKS A;  5HGQ A;  2QKI C;  1AH9 A;  3Q22 A;  1LUZ A;  1TS4 A;  1V8Q A;  4HTH A;  4DV6 Q;  1E22 A;  1QG7 A;  2L55 A;  4L8J A;  2ICE C;  1I4X A;  3GTG B;  1OXS C;  2HDL A;  4O1N A;  3S1R H;  3S16 B;  2WAQ E;  1VCI A;  2EOT A;  2EXZ A;  2B2U C;  2EZV A;  3FKI G;  3PCO B;  3TP5 A;  4IFD J;  1S72 A;  2F0L A;  4ZYS A;  2A68 D;  2G9H D;  1KHI A;  1IBK Q;  4A3C G;  1L0X B;  1O7Z A;  4I65 A;  5IT9 L;  2O4X A;  1N33 L;  2KEN A;  3OIQ A;  5M3F G;  4IJL A;  1T5E A;  4P74 A;  1OO9 B;  1LAB A;  5I6Y A;  5I2Y A;  3VYS A;  1PTO D;  4A3J B;  3BVM A;  3A7A B;  2B8F A;  2DY8 A;  4H0L C;  2DUD A;  5IYD H;  5JPN C;  3VR6 A;  3K7A B;  4IUN A;  1IHZ A;  1CKO A;  3TRE A;  1SMY D;  2EYH A;  4KD3 A;  1BNZ A;  4C1N I;  1KAW A;  3NWS A;  3OW7 A;  2FFK B;  2VL6 A;  1D8L A;  2NN6 H;  3BJU A;  5COR A; 
#chains in the Genus database with same CATH homology
 3IFD A;  3QOL A;  1Q90 A;  3FVQ A;  1EQT A;  1ROD A;  1K8O A;  1TKW B;  5DM7 3;  1CA5 A;  1FNV A;  3RUZ A;  1K8M A;  5EPK A;  1BDO A;  1EL0 A;  2XRS D;  4DF7 A;  2VB3 X;  4B9X A;  5BN4 A;  1SE3 A;  1I4R A;  3MWY W;  1PTO H;  1WTQ A;  5M5W B;  5C4Z A;  4WRD A;  4XQQ A;  1RJT A;  1H9R A;  4OO1 I;  4C3H G;  5K5P A;  1HFN A;  1IKM A;  4QCL A;  3L9A X;  4Q0F A;  2B2Y A;  4IUQ A;  2BOS A;  4G57 A;  2B8G A;  4QMG A;  1PTO F;  5FLX L;  1EIH A;  4KK7 A;  4OIJ A;  5BN5 A;  2K04 A;  3Q23 A;  2KUM A;  1S5B D;  1AN8 A;  5J22 A;  5M3F B;  2PQE A;  1M4V A;  4IUV A;  3M7N A;  1IL8 A;  1C48 A;  3KK7 A;  3NWT A;  3TP8 A;  4NMZ A;  2RA4 A;  1B50 A;  4CJ2 C;  1AP0 A;  3MAQ A;  3JAM L;  1ZEQ X;  1PFB A;  1JWS D;  3NK9 A;  1X3Q A;  1G2S A;  3H3V C;  1LTT D;  2M2L A;  5KYI A;  4JBW A;  3SK6 A;  3MFY A;  5JAV A;  3K6O A;  4PQX A;  1TWG B;  5JEA H;  1TY2 A;  4BY7 B;  4FP5 D;  3FPP A;  3TZD A;  1ONL A;  1ENF A;  5CBE E;  1TU2 B;  2EYM A;  3EJI A;  2Z4I A;  5FO7 B;  1C4Q A;  2EJF C;  2AQ1 B;  2AUK A;  3H6M A;  4K8J A;  2BDO A;  2L11 A;  1J9O A;  1LO5 D;  1HTL D;  3HOX B;  3A8I E;  4KJN A;  3GTJ B;  1GUW A;  2KEE A;  1H9K A;  5CV9 A;  1FD7 D;  3OMC A;  3ERQ A;  2VB2 X;  1PRT D;  3SHL A;  5C0X J;  2MGS A;  3U9S A;  1B4O A;  3M3Y B;  3OHX C;  1CQV A;  1SYC A;  2FMM A;  5E1F A;  3ND8 A;  2K5D A;  1Q3L A;  1ZKO A;  5FKA C;  2BCO A;  4FF4 A;  5JVH 3;  3AB9 A;  3IL8 A;  2A5H A;  1S5D D;  2K7V A;  3IAY A;  1I4Q A;  4MN3 A;  2F4I A;  3FDT A;  5IGG A;  3R93 A;  1NUC A;  2L0C A;  4FF3 A;  5KYL A;  4WJW A;  1KNA A;  4A3B B;  2FHT A;  5EPL A;  5M3M B;  4RH6 A;  4RHS A;  2EY5 A;  1IW7 C;  1A2T A;  4KY7 A;  1TII D;  2NN6 G;  3LWU A;  5C3X A;  2RDF A;  3QJY A;  2MPM A;  1FGB D;  4XYQ A;  2XWJ B;  2A6E C;  3R3O A;  1OXT A;  4ZKC B;  5C6A A;  3M4O B;  4J6H A;  3D8G A;  4R8I A;  1D5M C;  5EBD A;  4XYO A;  2KED A;  3IKJ A;  2H4O A;  3TP6 A;  2IX0 A;  2RKS A;  1H9J A;  1DZ1 A;  2E2H B;  2AWO A;  2X6G A;  1PRT F;  4IFD I;  3A7L A;  1QE6 A;  2TSS A;  1F9P A;  1STH A;  2AWN A;  2EYL A;  1DON A;  3D4D A;  4C3J G;  1JWM D;  1OXV A;  1G8Z D;  2O2L D;  3QG1 A;  1LTG D;  3A8J E;  3CRL C;  3M7G A;  4RCN A;  1ZYR C;  1XYI A;  1JOQ A;  1BBX C;  1DCZ A;  1SE4 A;  1U4R A;  5ISR A;  4PV1 C;  5J39 A;  5CV5 A;  3RD4 A;  3S1Q B;  2J4X A;  2F0W A;  3VYT A;  3WOE A;  2NBF A;  4B08 A;  4G7Z C;  1IYV A;  3CU7 A;  1JCK B;  2K32 A;  1SYE A;  1GHJ A;  4KY5 A;  1QWY A;  4BS9 A;  2JEA I;  3NQT A;  3T16 A;  1Y69 U;  5CR3 A;  1JC7 A;  1TS2 A;  2CVR A;  4KD4 A;  1ML0 D;  4FF2 A;  3MC0 B;  2EDG A;  3K5M A;  1A15 A;  5EPJ A;  4V19 0;  5ELB A;  2LY7 A;  1LAC A;  1JB3 A;  1Y8P B;  1BCP D;  4F88 A;  2IX3 A;  3TBI B;  2A69 D;  5M5Y B;  1LT4 D;  2F0G A;  3GP7 A;  4ZUJ A;  1CHQ D;  3A56 A;  2K01 A;  2E75 C;  5JEA G;  1UUP A;  4CJ0 B;  4XQN A;  1A6X A;  2EYJ A;  3PV0 A;  2KA7 A;  5I6W A;  1PTO B;  1AFP A;  2K03 A;  3VR4 A;  3S2D B;  2F0J A;  1CM9 A;  3K0Y A;  5A2Q E;  2F1M A;  4YIJ A;  4C3J B;  1E2W A;  4WOR A;  2X6L A;  1WTW A;  1G91 A;  1STY A;  4Z9C B;  2J0T D;  2A68 C;  4DK1 A;  3FPU B;  1MGS A;  1RTN A;  2FIN B;  1EOT A;  2F0M A;  3GTO B;  3J7A F;  2A73 B;  2RSO A;  2PMZ B;  1SYG A;  1R4Q B;  3W2D A;  2F0K A;  1PTO C;  3OWE B;  5M5X B;  1X3P A;  4XDX A;  2O5I C;  1Q8I A;  3KBX A;  4K8I A;  3NTI A;  3OSO A;  4FO2 A;  3RLF A;  3SK8 A;  3BYT B;  2JYO A;  1BCP F;  3MXU A;  1PZK D;  2PCF B;  2WII B;  3HOW B;  4DAY A;  3PIP 3;  4TSS A;  4FXD A;  4DXG A;  5CC4 A;  1U4M A;  3F2U A;  4J1M A;  3J81 E;  3P75 A;  1TR5 A;  2XWB B;  5I4D A;  1SNO A;  2NTS A;  2D62 A;  1I4P A;  1HFG A;  4DAV A;  1EZ6 A;  1V43 A;  3C1F A;  3P7J A;  3N6R A;  3OWF A;  3PO2 B;  2E2I B;  4N9P A;  2DY7 A;  1LTI D;  4OHJ A;  5G3L D;  1EYA A;  3QO2 A;  3S2H B;  1T5X D;  1JOO A;  1MSG A;  2KVM A;  2XN9 C;  4FVM A;  3V96 A;  1VMC A;  1I4G A;  1H9S A;  3J80 L;  1FNW A;  3OMG A;  2RBM A;  2Y0S B;  4RCO A;  1E2Z A;  3NTH A;  3I91 A;  5KNB A;  1WTX A;  4QUC A;  1HQR D;  1NR4 A;  4QB4 A;  1RTO A;  3H91 A;  2NTT A;  4ABN A;  5C5L A;  3K5N A;  4RGN A;  1SXT A;  4ZQ3 A;  1C8C A;  3NBI A;  1S5E D;  1UEA B;  1S5F D;  3HOZ B;  2PPB C;  1CZG A;  4G4K A;  5E4W C;  4RGM A;  4X3U A;  5FO9 B;  3T51 B;  2B2V A;  2NWG A;  1B3A A;  4GZY C;  1KDA A;  3HP3 A;  3ONA B;  1QJO A;  1QB5 D;  5C4H A;  3T53 B;  3SEB A;  3R8B A;  2SOB A;  5IOD A;  1YNN D;  1PRT B;  2QDB A;  3NSW A;  1GJX A;  4NP5 A;  4O42 A;  2MJ8 A;  4DXF A;  2OXP A;  2F0S A;  2HDM A;  3DUZ A;  4A3F B;  4FF1 A;  1MI2 A;  4NKL A;  2IPK D;  4H44 C;  5G3L F;  5KNC A;  4N9T A;  1OXX K;  4K5W A;  3PUV A;  1WTO A;  4F7X A;  1H9M A;  2SDF A;  1SFO B;  2L5T A;  3HG9 A;  5D3D A;  1CK1 A;  3QIA A;  3E5S A;  2EY2 A;  1B9N A;  1PFM A;  2TMP A;  3K57 A;  3I70 A;  1PRT C;  1UNS A;  1U4P A;  1Z6H A;  3NTK A;  3D3R A;  3BG3 A;  1EY7 A;  2XIW A;  2AQ3 B;  3FMC A;  4DN4 M;  4XIG S;  1LLR D;  4P2C B;  3I3C A;  5LL6 S;  3MHB A;  1BOS A;  3D6W A;  4XQJ A;  2LFN A;  5JEA J;  5E3F A;  4CHT B;  1ENC A;  1GHK A;  1DYQ A;  1QCB D;  3KLS X;  1AZQ A;  1Q1B A;  1XX8 A;  3MA2 B;  2KCC A;  2PW5 A;  2R93 B;  4CKE A;  4S3S A;  1L0Y B;  3HKZ B;  2Q8I B;  4HED A;  2LMC B;  1EZ8 A;  5CGK A;  1SYD A;  2HQE A;  2F3W A;  2JSO A;  1MSH A;  1DOL A;  2CQA A;  2B2T A;  3H94 A;  3BVZ A;  3CRK C;  1TY0 A;  2A74 C;  1SYB A;  4DU9 A;  3URY A;  1SE2 A;  3KBG A;  4IQZ A;  1EY0 A;  5K36 H;  3IFT A;  2PZW A;  1ESR A;  3UI2 A;  4J8Q A;  1QOH A;  5TSS A;  4HCE A;  2E2J B;  3X3M A;  3K5O A;  3SE0 A;  1KAA A;  1TWA B;  3G7L A;  2F0N A;  5IGE A;  1VMP A;  2F0T A;  3FRP B;  2WAQ B;  5COY A;  5C3W A;  2BA0 A;  2K28 A;  3TP7 A;  1BCP B;  3KLR A;  2ICI A;  3NPP A;  2NB0 A;  1KTK A;  1F77 A;  1GXD C;  3AMU A;  1EIG A;  2KQ3 A;  1GUS A;  4TKO B;  3PIO 3;  4ODG A;  3D6C A;  1VF5 C;  2HCC A;  3DWA A;  1HQM C;  1B2T A;  3HRZ C;  1Y1V B;  1H9S B;  1SNC A;  3EA6 A;  2O5J C;  2NYZ D;  2CW0 D;  5CMD A;  3SR1 A;  4Q5V A;  3PUX A;  2QIL A;  2M9V A;  2PNR C;  5EKI A;  4A93 B;  1LTB D;  2VXW A;  1AEX A;  1U9R A;  1I6V C;  1BCP C;  2KHS A;  1WCM B;  5LHY 1;  2A69 C;  1SJE D;  3ERO A;  4QUF A;  1KAB A;  1S4Z A;  2R61 A;  2N55 A;  3GTP B;  3S15 B;  5IT9 E;  1B1Z A;  2OF1 A;  1CT1 D;  1MD2 D;  5DEH A;  3M85 A;  4ULL A;  4IAL A;  2N88 A;  1D1I A;  1ILQ A;  3SK4 A;  4KHZ A;  3HZX A;  4ZLT F;  1I6H B;  5EJW A;  3S17 B;  3MFG A;  2Z4H A;  4BBR B;  4OL7 A;  3K58 A;  5C0X H;  4BWG B;  1UAP A;  1JQY D;  5F2D A;  3NBH A;  3GTL B;  3MXG A;  3V05 A;  3HOV B;  3GO5 A;  1G29 1;  1GUN A;  2AQ2 B;  4PMB A;  3M4Y A;  1BXT A;  2R7Z B;  2NN6 I;  5IOC A;  4HSP A;  3DM1 A;  1DD2 A;  1F2Z A;  4M8A A;  2PO4 A;  5CBA E;  2EY6 A;  3HOU B;  2ZXO A;  1F2L A;  2KCN A;  5KGU A;  1XWE A;  4A3I B;  4DGZ A;  1SEB D;  1B44 D;  1RD9 D;  2B2V C;  2NVY B;  1TWC B;  2XSC A;  1Y8O B;  2D2C C;  1KNE A;  1I4H A;  3I90 A;  2K5Q A;  3DWP A;  4RWS C;  1NCV A;  5JOB A;  1ENA A;  3NQI A;  5I2X A;  1DOM A;  2WP8 J;  3BDO A;  3WDN A;  1STE A;  2WB1 B;  1EYD A;  1HPC A;  5KRU A;  1BF4 A;  1D5X C;  3C46 A;  2QCP X;  5D65 A;  1D2B A;  1KDB A;  2L12 A;  5FLX E;  5ELC A;  3C3L A;  5CV4 A;  1O80 A;  2JXM B;  4KKU A;  1B53 A;  2A6H C;  1STG A;  5C3E B;  4H13 C;  3SK5 A;  3HS0 C;  3KLS A;  3MVV A;  2ID0 A;  2EJG C;  3I8Z A;  3KUP A;  1W6K A;  5HUR A;  4KTA A;  3E0J A;  3KF8 A;  1PDQ A;  3JAM E;  4CKB A;  3OIP A;  1GUO A;  2JE6 I;  5K36 G;  2PYK A;  3L7Z C;  5I9P A;  1D6E C;  4FNF A;  1F2Y A;  4E6I A;  4OO1 H;  1RKN A;  4HAE A;  2JA6 B;  2WAC A;  1YNJ D;  2WKC A;  4UDU C;  4K6L A;  1QIL A;  4PNY A;  1SNQ A;  2B2W A;  4ZAI A;  3OOC A;  1JOK A;  3PMF A;  2VUM B;  3PO3 B;  4KHV A;  2EVB A;  1IYU A;  2K5W A;  2EJM A;  3EVQ A;  4A3M B;  4IUU A;  4WFN 3;  1EY5 A;  4DAP A;  3BDC A;  3W3A A;  1EU4 A;  4K2K A;  4KI0 A;  5DM6 3;  3P20 A;  2RDG A;  2SEB D;  2B2T C;  1YNN C;  2L4N A;  1V1O A;  1F2M A;  1QNK A;  3H09 A;  2IT1 A;  3L3O C;  3X3N A;  4K14 A;  2NVQ B;  5D14 A;  1V1P A;  2DNC A;  3A8K E;  3HGB A;  1CHP D;  2L1B A;  1EY6 A;  3DEP A;  2JA7 B;  2E74 C;  4CJ1 B;  2D9U A;  5ELE A;  5EKK A;  1FYC A;  4K5X A;  4A3D B;  4ME5 A;  4K2L A;  5LL6 X;  4C56 C;  5IGD A;  2R6G A;  2A6H D;  1CZW A;  5BN3 A;  2JA8 B;  5IGB A;  5C0X G;  3RMH A;  4EVO A;  3MEH A;  2Q8R E;  2ZT9 C;  2DNE A;  1LTA D;  4B9W A;  2KJX A;  5T1G A;  3TME A;  4KY6 A;  1XXG A;  2E2D C;  1WD0 A;  2F0E A;  4RGO S;  5NUC A;  5KND A;  2NUC A;  2ZXR A;  2BE5 D;  3ITP A;  3R2I A;  4HMJ A;  1I3Q B;  1LT6 D;  4X3S A;  5E4X A;  2KOL A;  3SVM A;  3QB3 A;  2QEJ C;  4ZUI A;  1STN A;  2EYO A;  2B63 B;  2XNA C;  4HR7 B;  4UAI A;  3TDQ A;  1CA6 A;  4EQO A;  2VNU D;  2Z1C A;  1BUV T;  3J7Y W;  1HRJ A;  2F0O A;  4QIW B;  3K5L A;  4F8M A;  1JOR A;  4CGY B;  1PMR A;  4RGT A;  2HUG A;  3G6J B;  3GV3 A;  3O13 A;  2PZU A;  2H1E A;  1LV9 A;  3I72 A;  1VDZ A;  3DEO A;  2QF7 A;  3VR5 A;  1I50 B;  1Z7T A;  1JR0 D;  1S5C D;  2F0U A;  1STB A;  4EGV A;  4G7O C;  1A2U A;  4NW2 A;  3C2P A;  4HCS A;  4ID6 A;  1O7L A;  1R4P B;  2WKD A;  1CQF A;  1TVX A;  4LAA A;  5IGC A;  5T1I A;  3NHH A;  3RZD B;  1M8A A;  1A3T A;  4KN7 C;  1BR9 A;  1Z47 A;  2K1B A;  2NVX B;  3T56 B;  2F0Q A;  4MHE A;  5DNF A;  1J8I A;  2EYF A;  4IFD H;  4BY1 B;  5C4X B;  5JJZ A;  1A3U A;  4NDX A;  2RSN A;  2F03 A;  4X3T A;  4ZK9 B;  3P1H A;  2K6A A;  1ET6 A;  3VA7 A;  4EQP A;  4OO1 G;  4XTC S;  1SJH D;  3MXP A;  4RKL A;  2JP1 A;  2HCI A;  2BA1 A;  3GD7 A;  5IGF A;  3DMU A;  3J7A V;  2BDN A;  2OT2 A;  3GTK B;  2F0V A;  5EQ0 A;  4LMQ D;  3CHB D;  3HOY B;  5C5M A;  1HA6 A;  1HCZ A;  1TS3 A;  2L9H A;  3WOF A;  4LK1 C;  2FMC A;  2MP1 A;  1LTS D;  1SSO A;  4BA1 I;  1JWU D;  2CHB D;  2CW0 C;  2WV6 D;  1HA5 A;  2EE1 A;  4XT3 B;  1PFN A;  2G9D A;  1PZJ D;  4I7Z C;  4A3K B;  3D4R A;  4RFB A;  3FKI B;  3QWN A;  4HSV A;  4TQU S;  2V4D A;  5IIF A;  1WTP A;  4XXE A;  1U4L A;  2XVS A;  1D1K A;  1II3 A;  5C4J B;  5CV6 A;  1STA A;  4RAU C;  2IWH A;  3I73 A;  2J7Z A;  4Y7N B;  4BA2 I;  4C1N K;  3S1N B;  2D5D A;  4KN4 C;  3I4N B;  1E2V A;  3VR2 A;  2ENB A;  3BS1 A;  5A35 A;  4HN7 A;  1TQO A;  2EPB A;  4M1U B;  4HMI A;  3NP8 A;  2F0H A;  1Q12 A;  2F0P A;  3T4A C;  1PXU A;  4KKT A;  1SYF A;  1HXY D;  2JA5 B;  2DN8 A;  1V1P B;  1TWH B;  2B2W C;  5A2Q L;  2RVL A;  4IUR A;  3MTS A;  3VYR A;  3Q24 A;  4FYD A;  5JPM C;  2MUY A;  1VF7 A;  3GTM B;  2OEO A;  1ESF A;  3D31 A;  1SNP A;  1IKL A;  4K6D A;  4L6T B;  4IZ8 A;  4FXG C;  4EQN A;  3V2T A;  1TT2 A;  1EFI D;  2NVT B;  1LT5 D;  2KEC A;  3AU7 A;  4C3H B;  4DFA A;  1W6J A;  3RZO B;  3FEW X;  2B39 A;  3H0G B;  2MHV A;  1G2T A;  3VYU A;  4G7H C;  2LKV A;  1FNU A;  2IW3 A;  1GUT A;  4U67 3;  4ZKB B;  3NE5 B;  4R9W A;  3U9O A;  1KLG D;  4A3E B;  4RKB A;  2YU9 B;  3A55 A;  3T13 A;  3J80 E;  5EBC A;  4XT1 B;  1DM0 B;  1KDC A;  1Q1E A;  1HHV A;  3CKI B;  4CBV A;  1F9R A;  5I9O A;  3ND9 A;  2AUJ D;  3BYY B;  3SDZ A;  3Q0A A;  3J81 L;  1O78 A;  2PZT A;  1X32 A;  2GA4 B;  1O7Y A;  3MXN A;  4F87 A;  2F0D A;  5DAU A;  2B2U A;  1MBY A;  1EWH A;  1CFM A;  5CYU A;  1A3V A;  3EQL C;  1EY8 A;  1D5Z C;  1OXU A;  3TN2 A;  3BVG A;  3DHQ A;  1CTM A;  4IFD G;  3PUW A;  1RF2 D;  3BZD B;  1RHP A;  1YNJ C;  5C44 B;  3MZ5 A;  4CKC A;  1SND A;  1F9Q A;  1WTR A;  3N52 A;  2Z8L A;  4DK0 A;  2C5C A;  3EFX D;  4LJZ C;  4C3I G;  1GUG A;  1DXM A;  2PW7 A;  1NSN S;  4KJO A;  2JEB I;  3C1E A;  3S14 B;  4DNR B;  2IL8 A;  4JK1 C;  2Q8T A;  1F9S A;  4ZRZ A;  2SNM A;  2NZ1 D;  3Q6S A;  1PYW D;  5EGT A;  3GQB A;  1ET9 A;  3DWQ A;  1QNU A;  3BDL A;  3OPO A;  2R3Z A;  1BO0 A;  4RA8 A;  3PUZ A;  2R92 B;  2F3V A;  1DOK A;  4MIU A;  3DXJ C;  4DNT B;  2I46 A;  2RQX A;  3S1R B;  3SXH A;  1AZP A;  2WIN B;  1EU3 A;  1B9M A;  2SNS A;  1HUM A;  3K59 A;  1NR2 A;  2E76 C;  3TSS A;  4R8N A;  1K83 B;  3CQZ B;  2K33 A;  1EY4 A;  5ELD A;  4AYB B;  3LWE A;  3HEJ A;  1EQV A;  3S1M B;  3NUC A;  1TWF B;  4TRD A;  4KV6 A;  1PZI D;  2I07 B;  1LTR D;  3TZU A;  2LS0 1;  3VA5 A;  1XTC D;  1SNM A;  5ELF A;  3LNN A;  3QOJ A;  4ILW A;  3GTQ B;  1SDF A;  1EY9 A;  1E0B A;  4IUT A;  3E6Z X;  5AFW A;  2BE5 C;  5M9O A;  4K5V A;  4DA2 A;  1IW7 D;  1EYC A;  4U68 A;  5FOB B;  4IUP A;  1JE4 A;  5JVG 3;  4C2M B;  1KLU D;  4PMC A;  5D3I B;  4C3I B;  1EEI D;  3A54 A;  4OIK A;  2A6E D;  2B2Y C;  2X69 A;  3I4M B;  5HGT A;  5CV8 A;  1JIC A;  3LX0 A;  1HTP A;  5FK9 C;  3ZYY X;  5KIX A;  1SBB B;  2FJ2 A;  1DJR D;  4V0B A;  3S9W A;  3R2T A;  5EKL A;  1CI3 M;  4H7B A;  1RDP D;  1ZXT A;  1WD1 A;  1Y8N B;  4X3K A;  1EWC A;  4QF4 A;  4RHR A;  1NAP A;  2K05 A;  4BBS B;  2M00 A;  1EEF D;  2F0F A;  4FXK C;  5KEE A;  1WVL A;  4L63 B;  1ZYR D;  1TS5 A;  5FO8 B;  4KMU C;  1SAP A;  2C9O A;  2F0I A;  3I4L A;  1SMY C;  1ICW A;  2EYP A;  1BQQ T;  3NXW A;  4OGQ C;  3VR3 A;  3PUY A;  3GV6 A;  5CV7 A;  1FR3 A;  2IX1 A;  2EY1 A;  2XRQ D;  1LT3 D;  1G6Z A;  2RDH A;  4A3G B;  1PLF A;  1WTV A;  1ILP A;  4IN3 A;  2ZXP A;  3D4W A;  4PMW A;  2YYZ A;  1HUN A;  5J1Z A;  1RCV D;  5C0X I;  1AW7 A;  2IJ0 A;  1Y1W B;  1R9T B;  1GOZ A;  4KKS A;  2QKI C;  3Q22 A;  1TS4 A;  1V8Q A;  4HTH A;  1QG7 A;  2L55 A;  4L8J A;  2ICE C;  1I4X A;  3GTG B;  1OXS C;  2HDL A;  4O1N A;  3S16 B;  1VCI A;  2EOT A;  2EXZ A;  2B2U C;  2EZV A;  3TP5 A;  4IFD J;  2F0L A;  4ZYS A;  2A68 D;  2G9H D;  1L0X B;  1O7Z A;  4I65 A;  5IT9 L;  2O4X A;  3OIQ A;  1T5E A;  1OO9 B;  1LAB A;  5I6Y A;  5I2Y A;  3VYS A;  1PTO D;  4A3J B;  3BVM A;  3A7A B;  2B8F A;  2DY8 A;  4H0L C;  5JPN C;  3VR6 A;  3K7A B;  4IUN A;  1IHZ A;  1SMY D;  2EYH A;  4KD3 A;  1BNZ A;  4C1N I;  3NWS A;  3OW7 A;  2FFK B;  2NN6 H;  5COR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...