1HAJA

A beta-hairpin structure in a 13-mer peptide that binds a-bungarotoxin with high affinity and neutralizes its toxicity
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
74
structure length
74
Chain Sequence
b'IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title A Beta-Hairpin Structure in a 13-mer Peptide that Binds Alpha-Bungarotoxin with High Affinity and Neutralizes its Toxicity
pubmed doi rcsb
molecule tags Toxin/peptide
total genus 8
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hajA00
1RGJA 1JE9A 1H0JA 2VLWA 2H64B 4FAOC 4IYEA 2LCRA 1LX5B 2H5FA 5EBXA 3KFDI 3VTSA 4ZQYA 1ERAA 2H62D 2L5SA 2CCXA 2GOOB 2BHIA 2JVEA 6EBXA 1L4WA 2QJ9C 2QJBC 1CTXA 1ABTA 1KFHA 1CHVS 3NDSA 2JQPA 3ERAA 5DZ5A 1JGKA 2PJYC 2J8BA 4BIKB 4UY2C 1CRFA 3LAQU 1CDQA 2MHYA 1UG4A 1MR6A 4EY8B 2CRTA 1BTEA 1TGXA 1F8UB 2MUPA 2CDXA 2H64C 3NEQA 1CDRA 1COEA 4RUDA 2CRSA 1KBAA 2CTXA 4DO8A 4LFTA 1LXHA 2GOOC 1KBTA 3BT1U 2H7ZA 1QKEA 3NH7A 2NBTA 2QC1A 4XJJA 1FFJA 1RL5A 3EBXA 1KL8A 1IK8A 3BT2U 3PLCA 2N99A 2ABXA 1XT3A 2OFSA 1CVOA 4P7UA 1LXGA 1G6MA 1PLOA 1IJCA 1VB0A 1HAJA 4HQPF 1IDHA 1HC9A 1CDTA 1LSIA 1QM7A 1CODA 3U74U 1KS6A 1KU6B 2MFAA 1NTNA 3FEVA 4QTIU 1CREA 2HLRA 3HH7A 1KTZB 2HLQA 1M9ZA 4AEAA 1FSSB 2MJYA 3KFDE 5IMYC 1HOYA 2MJ0A 1KC4A 1TXBA 1B41B 2X8BB 1IQ9A 4OM4A 1ERGA 1JBDA 2H7ZB 2K3GA 2QJAC 1ES7B 1NYUA 1REWC 1IDIA 3U73U 2MUOA 1FSCA 1F94A 1CDSA 2L03A 4FAOE 1V6PA 2FD6U 1QKDA 5DO6A 1IDGA 5IMTD 1W6BA 1NYSA 1YWHA 1IDLA 1CXNA 1TXAA 2LA1A 1NTXA 1HC9B 5DU1A 3EVSC 1I02A 2BTXA 1HAAA 1NXBA 1MAHF 2MJ4A 2I9BE 1TFSA 2ERAA 2H8UA 4BDTB 4OM5A 1NEAA 1LJZA 1KXIA 3QB4B 1FASA 2H62C 1S4YA 1FF4A 1CCQA 1FRAA 2UX2A 2PJYB 1ONJA 2UWRA 1IKCA 1CXOA 1BXPA 1KBSA 1NORA 1CB9A 1DRSA 1ZADA
chains in the Genus database with same CATH superfamily
1RGJA 1JE9A 1H0JA 2VLWA 2H64B 4FAOC 4IYEA 2LCRA 1LX5B 2H5FA 5EBXA 3KFDI 3VTSA 4ZQYA 1ERAA 2H62D 2L5SA 2CCXA 2GOOB 2BHIA 2JVEA 6EBXA 1L4WA 2QJ9C 2QJBC 4KSNA 1CTXA 1ABTA 1KFHA 1CHVS 3NDSA 2JQPA 3ERAA 5DZ5A 1JGKA 2PJYC 2J8BA 4BIKB 4UY2C 1CRFA 3LAQU 1CDQA 2MHYA 1UG4A 1MR6A 4EY8B 2CRTA 1BTEA 1TGXA 1F8UB 2MUPA 2CDXA 2H64C 3NEQA 1CDRA 1COEA 4RUDA 2CRSA 1KBAA 2CTXA 4DO8A 4LFTA 1LXHA 2GOOC 1KBTA 3BT1U 2H7ZA 1QKEA 3NH7A 2NBTA 2QC1A 4XJJA 1FFJA 1RL5A 3EBXA 1KL8A 1IK8A 3BT2U 3PLCA 2N99A 2ABXA 1XT3A 2OFSA 1CVOA 4P7UA 1LXGA 1G6MA 1PLOA 1IJCA 1VB0A 1HAJA 4HQPF 1IDHA 1HC9A 1CDTA 1LSIA 1QM7A 1CODA 3U74U 1KS6A 1KU6B 2MFAA 1NTNA 3FEVA 4QTIU 1CREA 2HLRA 3HH7A 1KTZB 2HLQA 1M9ZA 4AEAA 1FSSB 2MJYA 3KFDE 5IMYC 1HOYA 2MJ0A 1KC4A 1TXBA 1B41B 2X8BB 1IQ9A 4OM4A 1ERGA 1JBDA 2H7ZB 2K3GA 2QJAC 1ES7B 1NYUA 1REWC 1IDIA 3U73U 2MUOA 1FSCA 1F94A 1CDSA 2L03A 4FAOE 1V6PA 2FD6U 1QKDA 5DO6A 1IDGA 5IMTD 1W6BA 1NYSA 1YWHA 1IDLA 1CXNA 1TXAA 2LA1A 1NTXA 1HC9B 5DU1A 3EVSC 1I02A 2BTXA 1HAAA 1NXBA 1MAHF 2MJ4A 2I9BE 1TFSA 2ERAA 2H8UA 4BDTB 4OM5A 1NEAA 1LJZA 1KXIA 3QB4B 1FASA 2H62C 1S4YA 1FF4A 1CCQA 1FRAA 2UX2A 2PJYB 1ONJA 2UWRA 1IKCA 1CXOA 1BXPA 1KBSA 1NORA 1CB9A 1DRSA 1ZADA
chains in the Genus database with same CATH topology
1RGJA 1JE9A 1H0JA 2VLWA 2H64B 4FAOC 4IYEA 2LCRA 1LX5B 2H5FA 5EBXA 3KFDI 3VTSA 4ZQYA 1ERAA 2H62D 2L5SA 2CCXA 2GOOB 2BHIA 2JVEA 6EBXA 1L4WA 2QJ9C 2QJBC 4KSNA 1CTXA 1ABTA 1KFHA 1CHVS 3NDSA 2JQPA 3ERAA 5DZ5A 1JGKA 2PJYC 2J8BA 4BIKB 4UY2C 1CRFA 3LAQU 1CDQA 2MHYA 1UG4A 1MR6A 4EY8B 2CRTA 1BTEA 1TGXA 1F8UB 2MUPA 2CDXA 2H64C 3NEQA 1CDRA 1COEA 4RUDA 2CRSA 1KBAA 2CTXA 4DO8A 4LFTA 1LXHA 2GOOC 1KBTA 3BT1U 2H7ZA 1QKEA 3NH7A 2NBTA 2QC1A 4XJJA 1FFJA 1RL5A 3EBXA 1KL8A 1IK8A 3BT2U 3PLCA 2N99A 2ABXA 1XT3A 2OFSA 1CVOA 4P7UA 1LXGA 1G6MA 1PLOA 1IJCA 1VB0A 1HAJA 4HQPF 1IDHA 1HC9A 1CDTA 1LSIA 1QM7A 1CODA 3U74U 1KS6A 1KU6B 2MFAA 1NTNA 3FEVA 4QTIU 1CREA 2HLRA 3HH7A 1KTZB 2HLQA 1M9ZA 4AEAA 1FSSB 2MJYA 3KFDE 5IMYC 1HOYA 2MJ0A 1KC4A 1TXBA 1B41B 2X8BB 1IQ9A 4OM4A 1ERGA 1JBDA 2H7ZB 2K3GA 2QJAC 1ES7B 1NYUA 1REWC 1IDIA 3U73U 2MUOA 1FSCA 1F94A 1CDSA 2L03A 4FAOE 1V6PA 2FD6U 1QKDA 5DO6A 1IDGA 5IMTD 1W6BA 1NYSA 1YWHA 1IDLA 1CXNA 1TXAA 2LA1A 1NTXA 1HC9B 5DU1A 3EVSC 1I02A 2BTXA 1HAAA 1NXBA 1MAHF 2MJ4A 2I9BE 1TFSA 2ERAA 2H8UA 4BDTB 4OM5A 1NEAA 1LJZA 1KXIA 3QB4B 1FASA 2H62C 1S4YA 1FF4A 1CCQA 1FRAA 2UX2A 2PJYB 1ONJA 2UWRA 1IKCA 1CXOA 1BXPA 1KBSA 1NORA 1CB9A 1DRSA 1ZADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGJ A;  1JE9 A;  1H0J A;  2VLW A;  2H64 B;  4FAO C;  4IYE A;  2LCR A;  1LX5 B;  2H5F A;  5EBX A;  3KFD I;  3VTS A;  4ZQY A;  1ERA A;  2H62 D;  2L5S A;  2CCX A;  2GOO B;  2BHI A;  2JVE A;  6EBX A;  1L4W A;  2QJ9 C;  2QJB C;  1CTX A;  1ABT A;  1KFH A;  1CHV S;  3NDS A;  2JQP A;  3ERA A;  5DZ5 A;  1JGK A;  2PJY C;  2J8B A;  4BIK B;  4UY2 C;  1CRF A;  3LAQ U;  1CDQ A;  2MHY A;  1UG4 A;  1MR6 A;  4EY8 B;  2CRT A;  1BTE A;  1TGX A;  1F8U B;  2MUP A;  2CDX A;  2H64 C;  3NEQ A;  1CDR A;  1COE A;  4RUD A;  2CRS A;  1KBA A;  2CTX A;  4DO8 A;  4LFT A;  1LXH A;  2GOO C;  1KBT A;  3BT1 U;  2H7Z A;  1QKE A;  3NH7 A;  2NBT A;  2QC1 A;  4XJJ A;  1FFJ A;  1RL5 A;  3EBX A;  1KL8 A;  1IK8 A;  3BT2 U;  3PLC A;  2N99 A;  2ABX A;  1XT3 A;  2OFS A;  1CVO A;  4P7U A;  1LXG A;  1G6M A;  1PLO A;  1IJC A;  1VB0 A;  1HAJ A;  4HQP F;  1IDH A;  1HC9 A;  1CDT A;  1LSI A;  1QM7 A;  1COD A;  3U74 U;  1KS6 A;  1KU6 B;  2MFA A;  1NTN A;  3FEV A;  4QTI U;  1CRE A;  2HLR A;  3HH7 A;  1KTZ B;  2HLQ A;  1M9Z A;  4AEA A;  1FSS B;  2MJY A;  3KFD E;  5IMY C;  1HOY A;  2MJ0 A;  1KC4 A;  1TXB A;  1B41 B;  2X8B B;  1IQ9 A;  4OM4 A;  1ERG A;  1JBD A;  2H7Z B;  2K3G A;  2QJA C;  1ES7 B;  1NYU A;  1REW C;  1IDI A;  3U73 U;  2MUO A;  1FSC A;  1F94 A;  1CDS A;  2L03 A;  4FAO E;  1V6P A;  2FD6 U;  1QKD A;  5DO6 A;  1IDG A;  5IMT D;  1W6B A;  1NYS A;  1YWH A;  1IDL A;  1CXN A;  1TXA A;  2LA1 A;  1NTX A;  1HC9 B;  5DU1 A;  3EVS C;  1I02 A;  2BTX A;  1HAA A;  1NXB A;  1MAH F;  2MJ4 A;  2I9B E;  1TFS A;  2ERA A;  2H8U A;  4BDT B;  4OM5 A;  1NEA A;  1LJZ A;  1KXI A;  3QB4 B;  1FAS A;  2H62 C;  1S4Y A;  1FF4 A;  1CCQ A;  1FRA A;  2UX2 A;  2PJY B;  1ONJ A;  2UWR A;  1IKC A;  1CXO A;  1BXP A;  1KBS A;  1NOR A;  1CB9 A;  1DRS A;  1ZAD A; 
#chains in the Genus database with same CATH topology
 1RGJ A;  1JE9 A;  1H0J A;  2VLW A;  2H64 B;  4FAO C;  4IYE A;  2LCR A;  1LX5 B;  2H5F A;  5EBX A;  3KFD I;  3VTS A;  4ZQY A;  1ERA A;  2H62 D;  2L5S A;  2CCX A;  2GOO B;  2BHI A;  2JVE A;  6EBX A;  1L4W A;  2QJ9 C;  2QJB C;  4KSN A;  1CTX A;  1ABT A;  1KFH A;  1CHV S;  3NDS A;  2JQP A;  3ERA A;  5DZ5 A;  1JGK A;  2PJY C;  2J8B A;  4BIK B;  4UY2 C;  1CRF A;  3LAQ U;  1CDQ A;  2MHY A;  1UG4 A;  1MR6 A;  4EY8 B;  2CRT A;  1BTE A;  1TGX A;  1F8U B;  2MUP A;  2CDX A;  2H64 C;  3NEQ A;  1CDR A;  1COE A;  4RUD A;  2CRS A;  1KBA A;  2CTX A;  4DO8 A;  4LFT A;  1LXH A;  2GOO C;  1KBT A;  3BT1 U;  2H7Z A;  1QKE A;  3NH7 A;  2NBT A;  2QC1 A;  4XJJ A;  1FFJ A;  1RL5 A;  3EBX A;  1KL8 A;  1IK8 A;  3BT2 U;  3PLC A;  2N99 A;  2ABX A;  1XT3 A;  2OFS A;  1CVO A;  4P7U A;  1LXG A;  1G6M A;  1PLO A;  1IJC A;  1VB0 A;  1HAJ A;  4HQP F;  1IDH A;  1HC9 A;  1CDT A;  1LSI A;  1QM7 A;  1COD A;  3U74 U;  1KS6 A;  1KU6 B;  2MFA A;  1NTN A;  3FEV A;  4QTI U;  1CRE A;  2HLR A;  3HH7 A;  1KTZ B;  2HLQ A;  1M9Z A;  4AEA A;  1FSS B;  2MJY A;  3KFD E;  5IMY C;  1HOY A;  2MJ0 A;  1KC4 A;  1TXB A;  1B41 B;  2X8B B;  1IQ9 A;  4OM4 A;  1ERG A;  1JBD A;  2H7Z B;  2K3G A;  2QJA C;  1ES7 B;  1NYU A;  1REW C;  1IDI A;  3U73 U;  2MUO A;  1FSC A;  1F94 A;  1CDS A;  2L03 A;  4FAO E;  1V6P A;  2FD6 U;  1QKD A;  5DO6 A;  1IDG A;  5IMT D;  1W6B A;  1NYS A;  1YWH A;  1IDL A;  1CXN A;  1TXA A;  2LA1 A;  1NTX A;  1HC9 B;  5DU1 A;  3EVS C;  1I02 A;  2BTX A;  1HAA A;  1NXB A;  1MAH F;  2MJ4 A;  2I9B E;  1TFS A;  2ERA A;  2H8U A;  4BDT B;  4OM5 A;  1NEA A;  1LJZ A;  1KXI A;  3QB4 B;  1FAS A;  2H62 C;  1S4Y A;  1FF4 A;  1CCQ A;  1FRA A;  2UX2 A;  2PJY B;  1ONJ A;  2UWR A;  1IKC A;  1CXO A;  1BXP A;  1KBS A;  1NOR A;  1CB9 A;  1DRS A;  1ZAD A; 
#chains in the Genus database with same CATH homology
 1RGJ A;  1JE9 A;  1H0J A;  2VLW A;  2H64 B;  4FAO C;  4IYE A;  2LCR A;  1LX5 B;  2H5F A;  5EBX A;  3KFD I;  3VTS A;  4ZQY A;  1ERA A;  2H62 D;  2L5S A;  2CCX A;  2GOO B;  2BHI A;  2JVE A;  6EBX A;  1L4W A;  2QJ9 C;  2QJB C;  4KSN A;  1CTX A;  1ABT A;  1KFH A;  1CHV S;  3NDS A;  2JQP A;  3ERA A;  5DZ5 A;  1JGK A;  2PJY C;  2J8B A;  4BIK B;  4UY2 C;  1CRF A;  3LAQ U;  1CDQ A;  2MHY A;  1UG4 A;  1MR6 A;  4EY8 B;  2CRT A;  1BTE A;  1TGX A;  1F8U B;  2MUP A;  2CDX A;  2H64 C;  3NEQ A;  1CDR A;  1COE A;  4RUD A;  2CRS A;  1KBA A;  2CTX A;  4DO8 A;  4LFT A;  1LXH A;  2GOO C;  1KBT A;  3BT1 U;  2H7Z A;  1QKE A;  3NH7 A;  2NBT A;  2QC1 A;  4XJJ A;  1FFJ A;  1RL5 A;  3EBX A;  1KL8 A;  1IK8 A;  3BT2 U;  3PLC A;  2N99 A;  2ABX A;  1XT3 A;  2OFS A;  1CVO A;  4P7U A;  1LXG A;  1G6M A;  1PLO A;  1IJC A;  1VB0 A;  1HAJ A;  4HQP F;  1IDH A;  1HC9 A;  1CDT A;  1LSI A;  1QM7 A;  1COD A;  3U74 U;  1KS6 A;  1KU6 B;  2MFA A;  1NTN A;  3FEV A;  4QTI U;  1CRE A;  2HLR A;  3HH7 A;  1KTZ B;  2HLQ A;  1M9Z A;  4AEA A;  1FSS B;  2MJY A;  3KFD E;  5IMY C;  1HOY A;  2MJ0 A;  1KC4 A;  1TXB A;  1B41 B;  2X8B B;  1IQ9 A;  4OM4 A;  1ERG A;  1JBD A;  2H7Z B;  2K3G A;  2QJA C;  1ES7 B;  1NYU A;  1REW C;  1IDI A;  3U73 U;  2MUO A;  1FSC A;  1F94 A;  1CDS A;  2L03 A;  4FAO E;  1V6P A;  2FD6 U;  1QKD A;  5DO6 A;  1IDG A;  5IMT D;  1W6B A;  1NYS A;  1YWH A;  1IDL A;  1CXN A;  1TXA A;  2LA1 A;  1NTX A;  1HC9 B;  5DU1 A;  3EVS C;  1I02 A;  2BTX A;  1HAA A;  1NXB A;  1MAH F;  2MJ4 A;  2I9B E;  1TFS A;  2ERA A;  2H8U A;  4BDT B;  4OM5 A;  1NEA A;  1LJZ A;  1KXI A;  3QB4 B;  1FAS A;  2H62 C;  1S4Y A;  1FF4 A;  1CCQ A;  1FRA A;  2UX2 A;  2PJY B;  1ONJ A;  2UWR A;  1IKC A;  1CXO A;  1BXP A;  1KBS A;  1NOR A;  1CB9 A;  1DRS A;  1ZAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...