1HCTB

Nmr structure of the human src sh2 domain complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
107
structure length
107
Chain Sequence
MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the human pp60c-src SH2 domain complexed with a phosphorylated tyrosine pentapeptide.
pubmed doi rcsb
molecule keywords ACETYL-PYEEIE-OH
molecule tags Complex (signal transduction/peptide)
source organism Homo sapiens
total genus 14
structure length 107
sequence length 107
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1hctB00
3BUXB 1O4LA 3CXLA 1XA6A 2DLYA 2CRHA 1JU5A 2RSYA 3VS4A 5EHRA 5D0JA 3VS7A 2HMHA 1AOUF 1YVLA 3MXCA 2DVJA 2HDVA 3VRQA 5DC9A 4LUEA 4LUDA 3IMDA 5BO4A 1O4AA 5I6VA 1D4TA 1O4QA 1AYBA 1O4KA 3PLFB 1H9OA 1LKKA 3GXWA 4FL3A 2CR4A 1KC2A 4JEGA 1IS0A 1I3ZA 5HKWA 2H8HA 2L4KA 2ECDA 4GPLB 3EAZA 2C9WA 3PSKA 1O44A 4H34A 2ETZA 2LQNA 4JGHA 3VS5A 1HCSB 1BG1A 4K45A 1ZFPE 2XP1A 1TZEE 3VROA 3HCKA 2OQ1A 4A4CA 3QWXX 3VRNA 5IBMA 4JE4A 1AD5A 1O4BA 1LUIA 1JYRA 5GJHA 1O4PA 1BFJA 3IN7A 3N7YA 1A1EA 2EYVA 1TCEA 1IJRA 4XZ1A 5J3XA 2H5KA 1O4FA 2JYQA 3HIZB 4NWGA 1BF5A 1SHAA 3HHMB 4GL9E 2GE9A 5CDWA 1Z3KA 3PS5A 1F2FA 3OP0A 1BLKA 2RMXA 5DC4A 1BKMA 2KNOA 1O4GA 2EOBA 1BHHB 1CSZA 3BUOB 3CWGA 2DLZA 1BMBA 1O45A 2IZVA 2C0IA 2L3TA 3UF4A 1FU5A 1AB2A 1FMKA 2LQWA 3ZNIA 2MRKA 1O46A 1R1QA 3VS6A 3KFJA 2MC1A 1F1WA 1BHHA 2L6KA 4OHDA 4P9ZA 3GXXA 3OB1B 2EU0A 1AYCA 2LCTA 1O48A 4DGXA 3TKZA 1BKLA 1LKLA 2EO3A 1A1BA 4P9VA 2B3OA 2ABLA 2OZOA 1R1PA 3PQZA 1LUMA 1RJAA 2KK6A 2VIFA 3EACA 3VRPA 1QCFA 4F59A 3NHNA 3VS2A 3IMJA 1R1SA 2C0OA 1UUSA 1O47A 2K79B 4EY0A 3T04A 2PLEA 1SHDA 1Y57A 1A07A 1OO3A 4L1BB 1MW4A 2Y1NA 1A08A 1JWOA 1M61A 5KAZA 5EG3B 2EYYA 4OHLA 4XZ0A 1O4EA 3S8LA 1BM2A 1OPKA 1YVHA 1WQUA 1SKJA 2IUGA 5HKZA 3CD3A 1D1ZA 2H46E 1A1CA 4F5AA 4K44A 2HDXA 3N8MA 3BUMB 1O43A 3GQIB 5AULA 2CS0A 2MRJA 1QG1E 2Y3AB 2HUWA 1CSYA 3BUWB 3VGOA 1SPSA 1O4CA 2QMSA 2CBLA 2BBUA 3VS1A 2RORA 1BLJA 2EO6A 3WA4A 2AOBA 5GJIA 2AOAA 1G83A 2EKXA 3MAZA 3US4A 2LNWA 4WWQA 1NZVA 2K7AB 3BUNB 2PLDA 5DF6A 1A1AA 1KSWA 2PTKA 1PICA 2PNBA 3VRZA 1CWDL 1SHBA 1O4DA 3PJPA 1KA6A 1RQQC 1CWEA 2DCRA 4EIHA 1O4MA 4DGPA 4NWFA 1X27A 1O42A 1O41A 1O49A 4H1OA 3CBLA 1HCTB 1FBZA 1AYDA 1QADA 2MK2A 1P13A 3BKBA 4K11A 5IBSA 3S8OA 4K2RA 3MXYA 1UURA 3UYOA 1AYAA 2DX0A 4F5BA 1X6CA 3TL0A 1MILA 5AXIA 3S9KA 1GRIA 2EYZA 4E93A 2FCIA 1A81A 1A09A 1O4JA 3S8NA 1FU6A 3IN8A 4OHEA 1O4OA 2CIAA 2DM0A 4E68A 1M27A 2YU7A 1JYUA 1B47A 1NRVA 2SRCA 4OHHA 1O4NA 3OV1A 3PSJA 1JYQA 2LNXA 2HCKA 1OPLA 3QWYA 2YSXA 1O4HA 1OO4A 3OVEA 1AOTF 1O4RA 3VRYA 1LUKA 1BHFA 2C0TA 3C7IA 2CI9A 4FL2A 2Y1MA 4U1PA 3PFVA 2IUHA 3VRRA 2PNAA 4D8KA 3OB2B 1LUNA 1GHUA 4GWFA 4QSYA 4TZIA 1X0NA 2CI8A 1FBVA 4M4ZA 3M7FA 5HKYA 2GSBA 5EHPA 1LCKA 3K2MA 2AUGA 3N84A 1D4WA 2EL8A 1O4IA 1SPRA 2RVFA 1NZLA 4FBNA 2FO0A 2IUIA 1BFIA 4X6SA 1FHSA 4A4BA 3VS3A 5DC0B 1K9AA 2SHPA 2MQIA 4OHIA 1CJ1A 1FYRA 4ROJA 4U17A 5EELA 5EEQA 1LCJA 1Y1UA 3VS0A 1KA7A 1RPYA
chains in the Genus database with same CATH superfamily
3BUXB 1O4LA 3CXLA 1XA6A 2DLYA 2CRHA 1JU5A 2RSYA 3VS4A 5EHRA 5D0JA 3VS7A 2HMHA 1AOUF 1YVLA 3MXCA 2DVJA 2HDVA 3VRQA 5DC9A 4LUEA 4LUDA 3IMDA 5BO4A 1O4AA 5I6VA 1D4TA 1O4QA 1AYBA 1O4KA 3PLFB 1H9OA 1LKKA 3GXWA 4FL3A 2CR4A 1KC2A 4JEGA 1IS0A 1I3ZA 5HKWA 2H8HA 2L4KA 2ECDA 4GPLB 3EAZA 2C9WA 3PSKA 1O44A 4H34A 2ETZA 2KGYA 2LQNA 4JGHA 3VS5A 1HCSB 1BG1A 4K45A 1ZFPE 2XP1A 1TZEE 3VROA 3HCKA 2OQ1A 4A4CA 3QWXX 3VRNA 5IBMA 4JE4A 1AD5A 1O4BA 1LUIA 1JYRA 5GJHA 1O4PA 1BFJA 3IN7A 3N7YA 1A1EA 2EYVA 1TCEA 1IJRA 4XZ1A 5J3XA 2H5KA 1O4FA 2JYQA 3HIZB 4NWGA 1BF5A 1SHAA 3HHMB 4GL9E 2GE9A 5CDWA 1Z3KA 3PS5A 1F2FA 3OP0A 1BLKA 2RMXA 5DC4A 1BKMA 2KNOA 1O4GA 2EOBA 1BHHB 1CSZA 3BUOB 3CWGA 2DLZA 1BMBA 1O45A 2IZVA 2C0IA 2L3TA 3UF4A 1FU5A 1AB2A 1FMKA 2LQWA 3ZNIA 2MRKA 1O46A 1R1QA 3VS6A 3KFJA 2MC1A 1F1WA 1BHHA 2L6KA 4OHDA 4P9ZA 3GXXA 3OB1B 2EU0A 1AYCA 2LCTA 1O48A 4DGXA 3TKZA 1BKLA 1LKLA 2EO3A 1A1BA 4P9VA 2B3OA 2ABLA 2OZOA 1R1PA 3PQZA 1LUMA 1RJAA 2KK6A 2VIFA 3EACA 3VRPA 1QCFA 4F59A 3NHNA 3VS2A 3IMJA 1R1SA 2C0OA 1UUSA 1O47A 2K79B 4EY0A 3T04A 2PLEA 1SHDA 1Y57A 1A07A 1OO3A 4L1BB 1MW4A 2Y1NA 1A08A 1JWOA 1M61A 5KAZA 5EG3B 2EYYA 4OHLA 4XZ0A 1O4EA 3S8LA 1BM2A 1OPKA 1YVHA 3LYVA 1WQUA 1SKJA 2IUGA 5HKZA 3CD3A 1D1ZA 2H46E 1A1CA 4F5AA 4K44A 2HDXA 3N8MA 3BUMB 1O43A 3GQIB 5AULA 2CS0A 2MRJA 1QG1E 2Y3AB 2HUWA 1CSYA 3BUWB 3VGOA 1SPSA 1O4CA 2QMSA 2CBLA 2BBUA 3VS1A 2RORA 1BLJA 2EO6A 3WA4A 2AOBA 5GJIA 2AOAA 1G83A 2EKXA 3MAZA 3US4A 2LNWA 4WWQA 1NZVA 2K7AB 3BUNB 2PLDA 5DF6A 1A1AA 1KSWA 2PTKA 1PICA 2PNBA 3VRZA 1CWDL 1SHBA 1O4DA 3PJPA 1KA6A 1RQQC 1CWEA 2DCRA 4EIHA 1O4MA 4DGPA 4NWFA 1X27A 1O42A 1O41A 1O49A 4H1OA 3CBLA 1HCTB 1FBZA 1AYDA 1QADA 2MK2A 1P13A 3BKBA 4K11A 5IBSA 3S8OA 4K2RA 3K2TA 3MXYA 1UURA 3UYOA 1AYAA 2DX0A 4F5BA 1X6CA 3TL0A 1MILA 5AXIA 3S9KA 1GRIA 2EYZA 4E93A 2FCIA 1A81A 1A09A 1O4JA 3S8NA 1FU6A 3IN8A 4OHEA 1O4OA 2LRAA 2CIAA 2DM0A 4E68A 1M27A 2YU7A 1JYUA 1B47A 1NRVA 2SRCA 4OHHA 1O4NA 3OV1A 3PSJA 1JYQA 2LNXA 2HCKA 1OPLA 3QWYA 2YSXA 1O4HA 1OO4A 3OVEA 1AOTF 1O4RA 3VRYA 1LUKA 1BHFA 2C0TA 3C7IA 2CI9A 4FL2A 2Y1MA 4U1PA 3PFVA 2IUHA 3VRRA 2PNAA 4D8KA 3OB2B 1LUNA 1GHUA 4GWFA 4QSYA 4TZIA 1X0NA 2CI8A 1FBVA 4M4ZA 3M7FA 5HKYA 2GSBA 5EHPA 1LCKA 3K2MA 2AUGA 3N84A 1D4WA 2EL8A 1O4IA 1SPRA 2RVFA 1NZLA 4FBNA 2FO0A 2IUIA 1BFIA 4X6SA 1FHSA 4A4BA 3VS3A 5DC0B 1K9AA 2SHPA 2MQIA 4OHIA 1CJ1A 1FYRA 4ROJA 4U17A 5EELA 5EEQA 1LCJA 1Y1UA 3VS0A 1KA7A 1RPYA
chains in the Genus database with same CATH topology
3BUXB 1O4LA 3CXLA 1XA6A 2DLYA 2CRHA 1JU5A 2RSYA 3VS4A 5EHRA 5D0JA 3VS7A 2HMHA 1AOUF 1YVLA 3MXCA 2DVJA 2HDVA 3VRQA 5DC9A 4LUEA 4LUDA 3IMDA 5BO4A 1O4AA 5I6VA 1D4TA 1O4QA 1AYBA 1O4KA 3PLFB 1H9OA 1LKKA 3GXWA 4FL3A 2CR4A 1KC2A 4JEGA 1IS0A 1I3ZA 5HKWA 2H8HA 2L4KA 2ECDA 4GPLB 3EAZA 2C9WA 3PSKA 1O44A 4H34A 2ETZA 2LQNA 4JGHA 3VS5A 1HCSB 1BG1A 4K45A 1ZFPE 2XP1A 1TZEE 3VROA 3HCKA 2OQ1A 4A4CA 3QWXX 3VRNA 5IBMA 4JE4A 1AD5A 1O4BA 1LUIA 1JYRA 5GJHA 1O4PA 1BFJA 3IN7A 3N7YA 1A1EA 2EYVA 1TCEA 1IJRA 4XZ1A 5J3XA 2H5KA 1O4FA 2JYQA 3HIZB 4NWGA 1BF5A 1SHAA 3HHMB 4GL9E 2GE9A 5CDWA 1Z3KA 3PS5A 1F2FA 3OP0A 1BLKA 2RMXA 5DC4A 1BKMA 2KNOA 1O4GA 2EOBA 1BHHB 1CSZA 3BUOB 3CWGA 2DLZA 1BMBA 1O45A 2IZVA 2C0IA 2L3TA 3UF4A 1FU5A 1AB2A 1FMKA 2LQWA 3ZNIA 2MRKA 1O46A 1R1QA 3VS6A 3KFJA 2MC1A 1F1WA 1BHHA 2L6KA 4OHDA 4P9ZA 3GXXA 3OB1B 2EU0A 1AYCA 2LCTA 1O48A 4DGXA 3TKZA 1BKLA 1LKLA 2EO3A 1A1BA 4P9VA 2B3OA 2ABLA 2OZOA 1R1PA 3PQZA 1LUMA 1RJAA 2KK6A 2VIFA 3EACA 3VRPA 1QCFA 4F59A 3NHNA 3VS2A 3IMJA 1R1SA 2C0OA 1UUSA 1O47A 2K79B 4EY0A 3T04A 2PLEA 1SHDA 1Y57A 1A07A 1OO3A 4L1BB 1MW4A 2Y1NA 1A08A 1JWOA 1M61A 5KAZA 5EG3B 2EYYA 4OHLA 4XZ0A 1O4EA 3S8LA 1BM2A 1OPKA 1YVHA 1WQUA 1SKJA 2IUGA 5HKZA 3CD3A 1D1ZA 2H46E 1A1CA 4F5AA 4K44A 2HDXA 3N8MA 3BUMB 1O43A 3GQIB 5AULA 2CS0A 2MRJA 1QG1E 2Y3AB 2HUWA 1CSYA 3BUWB 3VGOA 1SPSA 1O4CA 2QMSA 2CBLA 2BBUA 3VS1A 2RORA 1BLJA 2EO6A 3WA4A 2AOBA 5GJIA 2AOAA 1G83A 2EKXA 3MAZA 3US4A 2LNWA 4WWQA 1NZVA 2K7AB 3BUNB 2PLDA 5DF6A 1A1AA 1KSWA 2PTKA 1PICA 2PNBA 3VRZA 1CWDL 1SHBA 1O4DA 3PJPA 1KA6A 1RQQC 1CWEA 2DCRA 4EIHA 1O4MA 4DGPA 4NWFA 1X27A 1O42A 1O41A 1O49A 4H1OA 3CBLA 1HCTB 1FBZA 1AYDA 1QADA 2MK2A 1P13A 3BKBA 4K11A 5IBSA 3S8OA 4K2RA 3MXYA 1UURA 3UYOA 1AYAA 2DX0A 4F5BA 1X6CA 3TL0A 1MILA 5AXIA 3S9KA 1GRIA 2EYZA 4E93A 2FCIA 1A81A 1A09A 1O4JA 3S8NA 1FU6A 3IN8A 4OHEA 1O4OA 2CIAA 2DM0A 4E68A 1M27A 2YU7A 1JYUA 1B47A 1NRVA 2SRCA 4OHHA 1O4NA 3OV1A 3PSJA 1JYQA 2LNXA 2HCKA 1OPLA 3QWYA 2YSXA 1O4HA 1OO4A 3OVEA 1AOTF 1O4RA 3VRYA 1LUKA 1BHFA 2C0TA 3C7IA 2CI9A 4FL2A 2Y1MA 4U1PA 3PFVA 2IUHA 3VRRA 2PNAA 4D8KA 3OB2B 1LUNA 1GHUA 4GWFA 4QSYA 4TZIA 1X0NA 2CI8A 1FBVA 4M4ZA 3M7FA 5HKYA 2GSBA 5EHPA 1LCKA 3K2MA 2AUGA 3N84A 1D4WA 2EL8A 1O4IA 1SPRA 2RVFA 1NZLA 4FBNA 2FO0A 2IUIA 1BFIA 4X6SA 1FHSA 4A4BA 3VS3A 5DC0B 1K9AA 2SHPA 2MQIA 4OHIA 1CJ1A 1FYRA 4ROJA 4U17A 5EELA 5EEQA 1LCJA 1Y1UA 3VS0A 1KA7A 1RPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUX B;  1O4L A;  3CXL A;  1XA6 A;  2DLY A;  2CRH A;  1JU5 A;  2RSY A;  3VS4 A;  5EHR A;  5D0J A;  3VS7 A;  2HMH A;  1AOU F;  1YVL A;  3MXC A;  2DVJ A;  2HDV A;  3VRQ A;  5DC9 A;  4LUE A;  4LUD A;  3IMD A;  5BO4 A;  1O4A A;  5I6V A;  1D4T A;  1O4Q A;  1AYB A;  1O4K A;  3PLF B;  1H9O A;  1LKK A;  3GXW A;  4FL3 A;  2CR4 A;  1KC2 A;  4JEG A;  1IS0 A;  1I3Z A;  5HKW A;  2H8H A;  2L4K A;  2ECD A;  4GPL B;  3EAZ A;  2C9W A;  3PSK A;  1O44 A;  4H34 A;  2ETZ A;  2LQN A;  4JGH A;  3VS5 A;  1HCS B;  1BG1 A;  4K45 A;  1ZFP E;  2XP1 A;  1TZE E;  3VRO A;  3HCK A;  2OQ1 A;  4A4C A;  3QWX X;  3VRN A;  5IBM A;  4JE4 A;  1AD5 A;  1O4B A;  1LUI A;  1JYR A;  5GJH A;  1O4P A;  1BFJ A;  3IN7 A;  3N7Y A;  1A1E A;  2EYV A;  1TCE A;  1IJR A;  4XZ1 A;  5J3X A;  2H5K A;  1O4F A;  2JYQ A;  3HIZ B;  4NWG A;  1BF5 A;  1SHA A;  3HHM B;  4GL9 E;  2GE9 A;  5CDW A;  1Z3K A;  3PS5 A;  1F2F A;  3OP0 A;  1BLK A;  2RMX A;  5DC4 A;  1BKM A;  2KNO A;  1O4G A;  2EOB A;  1BHH B;  1CSZ A;  3BUO B;  3CWG A;  2DLZ A;  1BMB A;  1O45 A;  2IZV A;  2C0I A;  2L3T A;  3UF4 A;  1FU5 A;  1AB2 A;  1FMK A;  2LQW A;  3ZNI A;  2MRK A;  1O46 A;  1R1Q A;  3VS6 A;  3KFJ A;  2MC1 A;  1F1W A;  1BHH A;  2L6K A;  4OHD A;  4P9Z A;  3GXX A;  3OB1 B;  2EU0 A;  1AYC A;  2LCT A;  1O48 A;  4DGX A;  3TKZ A;  1BKL A;  1LKL A;  2EO3 A;  1A1B A;  4P9V A;  2B3O A;  2ABL A;  2OZO A;  1R1P A;  3PQZ A;  1LUM A;  1RJA A;  2KK6 A;  2VIF A;  3EAC A;  3VRP A;  1QCF A;  4F59 A;  3NHN A;  3VS2 A;  3IMJ A;  1R1S A;  2C0O A;  1UUS A;  1O47 A;  2K79 B;  4EY0 A;  3T04 A;  2PLE A;  1SHD A;  1Y57 A;  1A07 A;  1OO3 A;  4L1B B;  1MW4 A;  2Y1N A;  1A08 A;  1JWO A;  1M61 A;  5KAZ A;  5EG3 B;  2EYY A;  4OHL A;  4XZ0 A;  1O4E A;  3S8L A;  1BM2 A;  1OPK A;  1YVH A;  1WQU A;  1SKJ A;  2IUG A;  5HKZ A;  3CD3 A;  1D1Z A;  2H46 E;  1A1C A;  4F5A A;  4K44 A;  2HDX A;  3N8M A;  3BUM B;  1O43 A;  3GQI B;  5AUL A;  2CS0 A;  2MRJ A;  1QG1 E;  2Y3A B;  2HUW A;  1CSY A;  3BUW B;  3VGO A;  1SPS A;  1O4C A;  2QMS A;  2CBL A;  2BBU A;  3VS1 A;  2ROR A;  1BLJ A;  2EO6 A;  3WA4 A;  2AOB A;  5GJI A;  2AOA A;  1G83 A;  2EKX A;  3MAZ A;  3US4 A;  2LNW A;  4WWQ A;  1NZV A;  2K7A B;  3BUN B;  2PLD A;  5DF6 A;  1A1A A;  1KSW A;  2PTK A;  1PIC A;  2PNB A;  3VRZ A;  1CWD L;  1SHB A;  1O4D A;  3PJP A;  1KA6 A;  1RQQ C;  1CWE A;  2DCR A;  4EIH A;  1O4M A;  4DGP A;  4NWF A;  1X27 A;  1O42 A;  1O41 A;  1O49 A;  4H1O A;  3CBL A;  1HCT B;  1FBZ A;  1AYD A;  1QAD A;  2MK2 A;  1P13 A;  3BKB A;  4K11 A;  5IBS A;  3S8O A;  4K2R A;  3MXY A;  1UUR A;  3UYO A;  1AYA A;  2DX0 A;  4F5B A;  1X6C A;  3TL0 A;  1MIL A;  5AXI A;  3S9K A;  1GRI A;  2EYZ A;  4E93 A;  2FCI A;  1A81 A;  1A09 A;  1O4J A;  3S8N A;  1FU6 A;  3IN8 A;  4OHE A;  1O4O A;  2CIA A;  2DM0 A;  4E68 A;  1M27 A;  2YU7 A;  1JYU A;  1B47 A;  1NRV A;  2SRC A;  4OHH A;  1O4N A;  3OV1 A;  3PSJ A;  1JYQ A;  2LNX A;  2HCK A;  1OPL A;  3QWY A;  2YSX A;  1O4H A;  1OO4 A;  3OVE A;  1AOT F;  1O4R A;  3VRY A;  1LUK A;  1BHF A;  2C0T A;  3C7I A;  2CI9 A;  4FL2 A;  2Y1M A;  4U1P A;  3PFV A;  2IUH A;  3VRR A;  2PNA A;  4D8K A;  3OB2 B;  1LUN A;  1GHU A;  4GWF A;  4QSY A;  4TZI A;  1X0N A;  2CI8 A;  1FBV A;  4M4Z A;  3M7F A;  5HKY A;  2GSB A;  5EHP A;  1LCK A;  3K2M A;  2AUG A;  3N84 A;  1D4W A;  2EL8 A;  1O4I A;  1SPR A;  2RVF A;  1NZL A;  4FBN A;  2FO0 A;  2IUI A;  1BFI A;  4X6S A;  1FHS A;  4A4B A;  3VS3 A;  5DC0 B;  1K9A A;  2SHP A;  2MQI A;  4OHI A;  1CJ1 A;  1FYR A;  4ROJ A;  4U17 A;  5EEL A;  5EEQ A;  1LCJ A;  1Y1U A;  3VS0 A;  1KA7 A;  1RPY A; 
#chains in the Genus database with same CATH topology
 3BUX B;  1O4L A;  3CXL A;  1XA6 A;  2DLY A;  2CRH A;  1JU5 A;  2RSY A;  3VS4 A;  5EHR A;  5D0J A;  3VS7 A;  2HMH A;  1AOU F;  1YVL A;  3MXC A;  2DVJ A;  2HDV A;  3VRQ A;  5DC9 A;  4LUE A;  4LUD A;  3IMD A;  5BO4 A;  1O4A A;  5I6V A;  1D4T A;  1O4Q A;  1AYB A;  1O4K A;  3PLF B;  1H9O A;  1LKK A;  3GXW A;  4FL3 A;  2CR4 A;  1KC2 A;  4JEG A;  1IS0 A;  1I3Z A;  5HKW A;  2H8H A;  2L4K A;  2ECD A;  4GPL B;  3EAZ A;  2C9W A;  3PSK A;  1O44 A;  4H34 A;  2ETZ A;  2KGY A;  2LQN A;  4JGH A;  3VS5 A;  1HCS B;  1BG1 A;  4K45 A;  1ZFP E;  2XP1 A;  1TZE E;  3VRO A;  3HCK A;  2OQ1 A;  4A4C A;  3QWX X;  3VRN A;  5IBM A;  4JE4 A;  1AD5 A;  1O4B A;  1LUI A;  1JYR A;  5GJH A;  1O4P A;  1BFJ A;  3IN7 A;  3N7Y A;  1A1E A;  2EYV A;  1TCE A;  1IJR A;  4XZ1 A;  5J3X A;  2H5K A;  1O4F A;  2JYQ A;  3HIZ B;  4NWG A;  1BF5 A;  1SHA A;  3HHM B;  4GL9 E;  2GE9 A;  5CDW A;  1Z3K A;  3PS5 A;  1F2F A;  3OP0 A;  1BLK A;  2RMX A;  5DC4 A;  1BKM A;  2KNO A;  1O4G A;  2EOB A;  1BHH B;  1CSZ A;  3BUO B;  3CWG A;  2DLZ A;  1BMB A;  1O45 A;  2IZV A;  2C0I A;  2L3T A;  3UF4 A;  1FU5 A;  1AB2 A;  1FMK A;  2LQW A;  3ZNI A;  2MRK A;  1O46 A;  1R1Q A;  3VS6 A;  3KFJ A;  2MC1 A;  1F1W A;  1BHH A;  2L6K A;  4OHD A;  4P9Z A;  3GXX A;  3OB1 B;  2EU0 A;  1AYC A;  2LCT A;  1O48 A;  4DGX A;  3TKZ A;  1BKL A;  1LKL A;  2EO3 A;  1A1B A;  4P9V A;  2B3O A;  2ABL A;  2OZO A;  1R1P A;  3PQZ A;  1LUM A;  1RJA A;  2KK6 A;  2VIF A;  3EAC A;  3VRP A;  1QCF A;  4F59 A;  3NHN A;  3VS2 A;  3IMJ A;  1R1S A;  2C0O A;  1UUS A;  1O47 A;  2K79 B;  4EY0 A;  3T04 A;  2PLE A;  1SHD A;  1Y57 A;  1A07 A;  1OO3 A;  4L1B B;  1MW4 A;  2Y1N A;  1A08 A;  1JWO A;  1M61 A;  5KAZ A;  5EG3 B;  2EYY A;  4OHL A;  4XZ0 A;  1O4E A;  3S8L A;  1BM2 A;  1OPK A;  1YVH A;  3LYV A;  1WQU A;  1SKJ A;  2IUG A;  5HKZ A;  3CD3 A;  1D1Z A;  2H46 E;  1A1C A;  4F5A A;  4K44 A;  2HDX A;  3N8M A;  3BUM B;  1O43 A;  3GQI B;  5AUL A;  2CS0 A;  2MRJ A;  1QG1 E;  2Y3A B;  2HUW A;  1CSY A;  3BUW B;  3VGO A;  1SPS A;  1O4C A;  2QMS A;  2CBL A;  2BBU A;  3VS1 A;  2ROR A;  1BLJ A;  2EO6 A;  3WA4 A;  2AOB A;  5GJI A;  2AOA A;  1G83 A;  2EKX A;  3MAZ A;  3US4 A;  2LNW A;  4WWQ A;  1NZV A;  2K7A B;  3BUN B;  2PLD A;  5DF6 A;  1A1A A;  1KSW A;  2PTK A;  1PIC A;  2PNB A;  3VRZ A;  1CWD L;  1SHB A;  1O4D A;  3PJP A;  1KA6 A;  1RQQ C;  1CWE A;  2DCR A;  4EIH A;  1O4M A;  4DGP A;  4NWF A;  1X27 A;  1O42 A;  1O41 A;  1O49 A;  4H1O A;  3CBL A;  1HCT B;  1FBZ A;  1AYD A;  1QAD A;  2MK2 A;  1P13 A;  3BKB A;  4K11 A;  5IBS A;  3S8O A;  4K2R A;  3K2T A;  3MXY A;  1UUR A;  3UYO A;  1AYA A;  2DX0 A;  4F5B A;  1X6C A;  3TL0 A;  1MIL A;  5AXI A;  3S9K A;  1GRI A;  2EYZ A;  4E93 A;  2FCI A;  1A81 A;  1A09 A;  1O4J A;  3S8N A;  1FU6 A;  3IN8 A;  4OHE A;  1O4O A;  2LRA A;  2CIA A;  2DM0 A;  4E68 A;  1M27 A;  2YU7 A;  1JYU A;  1B47 A;  1NRV A;  2SRC A;  4OHH A;  1O4N A;  3OV1 A;  3PSJ A;  1JYQ A;  2LNX A;  2HCK A;  1OPL A;  3QWY A;  2YSX A;  1O4H A;  1OO4 A;  3OVE A;  1AOT F;  1O4R A;  3VRY A;  1LUK A;  1BHF A;  2C0T A;  3C7I A;  2CI9 A;  4FL2 A;  2Y1M A;  4U1P A;  3PFV A;  2IUH A;  3VRR A;  2PNA A;  4D8K A;  3OB2 B;  1LUN A;  1GHU A;  4GWF A;  4QSY A;  4TZI A;  1X0N A;  2CI8 A;  1FBV A;  4M4Z A;  3M7F A;  5HKY A;  2GSB A;  5EHP A;  1LCK A;  3K2M A;  2AUG A;  3N84 A;  1D4W A;  2EL8 A;  1O4I A;  1SPR A;  2RVF A;  1NZL A;  4FBN A;  2FO0 A;  2IUI A;  1BFI A;  4X6S A;  1FHS A;  4A4B A;  3VS3 A;  5DC0 B;  1K9A A;  2SHP A;  2MQI A;  4OHI A;  1CJ1 A;  1FYR A;  4ROJ A;  4U17 A;  5EEL A;  5EEQ A;  1LCJ A;  1Y1U A;  3VS0 A;  1KA7 A;  1RPY A; 
#chains in the Genus database with same CATH homology
 3BUX B;  1O4L A;  3CXL A;  1XA6 A;  2DLY A;  2CRH A;  1JU5 A;  2RSY A;  3VS4 A;  5EHR A;  5D0J A;  3VS7 A;  2HMH A;  1AOU F;  1YVL A;  3MXC A;  2DVJ A;  2HDV A;  3VRQ A;  5DC9 A;  4LUE A;  4LUD A;  3IMD A;  5BO4 A;  1O4A A;  5I6V A;  1D4T A;  1O4Q A;  1AYB A;  1O4K A;  3PLF B;  1H9O A;  1LKK A;  3GXW A;  4FL3 A;  2CR4 A;  1KC2 A;  4JEG A;  1IS0 A;  1I3Z A;  5HKW A;  2H8H A;  2L4K A;  2ECD A;  4GPL B;  3EAZ A;  2C9W A;  3PSK A;  1O44 A;  4H34 A;  2ETZ A;  2LQN A;  4JGH A;  3VS5 A;  1HCS B;  1BG1 A;  4K45 A;  1ZFP E;  2XP1 A;  1TZE E;  3VRO A;  3HCK A;  2OQ1 A;  4A4C A;  3QWX X;  3VRN A;  5IBM A;  4JE4 A;  1AD5 A;  1O4B A;  1LUI A;  1JYR A;  5GJH A;  1O4P A;  1BFJ A;  3IN7 A;  3N7Y A;  1A1E A;  2EYV A;  1TCE A;  1IJR A;  4XZ1 A;  5J3X A;  2H5K A;  1O4F A;  2JYQ A;  3HIZ B;  4NWG A;  1BF5 A;  1SHA A;  3HHM B;  4GL9 E;  2GE9 A;  5CDW A;  1Z3K A;  3PS5 A;  1F2F A;  3OP0 A;  1BLK A;  2RMX A;  5DC4 A;  1BKM A;  2KNO A;  1O4G A;  2EOB A;  1BHH B;  1CSZ A;  3BUO B;  3CWG A;  2DLZ A;  1BMB A;  1O45 A;  2IZV A;  2C0I A;  2L3T A;  3UF4 A;  1FU5 A;  1AB2 A;  1FMK A;  2LQW A;  3ZNI A;  2MRK A;  1O46 A;  1R1Q A;  3VS6 A;  3KFJ A;  2MC1 A;  1F1W A;  1BHH A;  2L6K A;  4OHD A;  4P9Z A;  3GXX A;  3OB1 B;  2EU0 A;  1AYC A;  2LCT A;  1O48 A;  4DGX A;  3TKZ A;  1BKL A;  1LKL A;  2EO3 A;  1A1B A;  4P9V A;  2B3O A;  2ABL A;  2OZO A;  1R1P A;  3PQZ A;  1LUM A;  1RJA A;  2KK6 A;  2VIF A;  3EAC A;  3VRP A;  1QCF A;  4F59 A;  3NHN A;  3VS2 A;  3IMJ A;  1R1S A;  2C0O A;  1UUS A;  1O47 A;  2K79 B;  4EY0 A;  3T04 A;  2PLE A;  1SHD A;  1Y57 A;  1A07 A;  1OO3 A;  4L1B B;  1MW4 A;  2Y1N A;  1A08 A;  1JWO A;  1M61 A;  5KAZ A;  5EG3 B;  2EYY A;  4OHL A;  4XZ0 A;  1O4E A;  3S8L A;  1BM2 A;  1OPK A;  1YVH A;  1WQU A;  1SKJ A;  2IUG A;  5HKZ A;  3CD3 A;  1D1Z A;  2H46 E;  1A1C A;  4F5A A;  4K44 A;  2HDX A;  3N8M A;  3BUM B;  1O43 A;  3GQI B;  5AUL A;  2CS0 A;  2MRJ A;  1QG1 E;  2Y3A B;  2HUW A;  1CSY A;  3BUW B;  3VGO A;  1SPS A;  1O4C A;  2QMS A;  2CBL A;  2BBU A;  3VS1 A;  2ROR A;  1BLJ A;  2EO6 A;  3WA4 A;  2AOB A;  5GJI A;  2AOA A;  1G83 A;  2EKX A;  3MAZ A;  3US4 A;  2LNW A;  4WWQ A;  1NZV A;  2K7A B;  3BUN B;  2PLD A;  5DF6 A;  1A1A A;  1KSW A;  2PTK A;  1PIC A;  2PNB A;  3VRZ A;  1CWD L;  1SHB A;  1O4D A;  3PJP A;  1KA6 A;  1RQQ C;  1CWE A;  2DCR A;  4EIH A;  1O4M A;  4DGP A;  4NWF A;  1X27 A;  1O42 A;  1O41 A;  1O49 A;  4H1O A;  3CBL A;  1HCT B;  1FBZ A;  1AYD A;  1QAD A;  2MK2 A;  1P13 A;  3BKB A;  4K11 A;  5IBS A;  3S8O A;  4K2R A;  3MXY A;  1UUR A;  3UYO A;  1AYA A;  2DX0 A;  4F5B A;  1X6C A;  3TL0 A;  1MIL A;  5AXI A;  3S9K A;  1GRI A;  2EYZ A;  4E93 A;  2FCI A;  1A81 A;  1A09 A;  1O4J A;  3S8N A;  1FU6 A;  3IN8 A;  4OHE A;  1O4O A;  2CIA A;  2DM0 A;  4E68 A;  1M27 A;  2YU7 A;  1JYU A;  1B47 A;  1NRV A;  2SRC A;  4OHH A;  1O4N A;  3OV1 A;  3PSJ A;  1JYQ A;  2LNX A;  2HCK A;  1OPL A;  3QWY A;  2YSX A;  1O4H A;  1OO4 A;  3OVE A;  1AOT F;  1O4R A;  3VRY A;  1LUK A;  1BHF A;  2C0T A;  3C7I A;  2CI9 A;  4FL2 A;  2Y1M A;  4U1P A;  3PFV A;  2IUH A;  3VRR A;  2PNA A;  4D8K A;  3OB2 B;  1LUN A;  1GHU A;  4GWF A;  4QSY A;  4TZI A;  1X0N A;  2CI8 A;  1FBV A;  4M4Z A;  3M7F A;  5HKY A;  2GSB A;  5EHP A;  1LCK A;  3K2M A;  2AUG A;  3N84 A;  1D4W A;  2EL8 A;  1O4I A;  1SPR A;  2RVF A;  1NZL A;  4FBN A;  2FO0 A;  2IUI A;  1BFI A;  4X6S A;  1FHS A;  4A4B A;  3VS3 A;  5DC0 B;  1K9A A;  2SHP A;  2MQI A;  4OHI A;  1CJ1 A;  1FYR A;  4ROJ A;  4U17 A;  5EEL A;  5EEQ A;  1LCJ A;  1Y1U A;  3VS0 A;  1KA7 A;  1RPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...