1HD1A

Heterogeneous nuclear ribonucleoprotein d0 (hnrnp d0 rbd1), nmr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
b'KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0)
publication title Structure and interactions with RNA of the N-terminal UUAG-specific RNA-binding domain of hnRNP D0.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1999-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hd1A00
2OSRA 1VQ7S 2LA6A 1WELA 2DGTA 3G6ES 2KT5A 2DNQA 2MPUA 1Q81T 4QPTA 3R1HA 1X4BA 2MXYA 4U67Q 2E5JA 4WFNQ 1NU4A 1NJIT 3H2VE 3G8SA 3CXCR 1M5OC 2M7SA 5IFMA 1S79A 3VAHA 1FO1A 1K9MT 2MZTA 3CCQS 3B4DA 2DNYA 2FPHX 2YH1A 2KH9A 1BY9A 2N3LA 1ZH5A 1X4HA 4QQBA 1DZ5A 4WFAQ 2CQ0A 2RQ4A 4CH0S 2HYIB 1OIAA 3EGNA 2D9OA 3TO8A 2ZJPQ 4CIOA 3TYTA 5DM6Q 1X4DA 3NS5A 1HD1A 5IM0B 2DGXA 2CQ3A 2RNEA 3Q2SC 1WTBA 1F9FA 2BZ2A 3I55S 4WIIA 2M8HA 1VQ6S 3MUTP 1U6BA 3THPA 2AYGA 2MHNA 1SJRA 2G4BA 1YJWS 4WF9Q 2DHAA 3ZZYA 1UW4A 1A9NB 2DNMA 2MKKA 5JVHQ 4UQTA 2CQPA 4TU7A 3CC7S 3L3CA 2CPDA 2J0QD 1HA1A 3G4SS 2M0GB 1N88A 1SJQA 2QA4S 1UFWA 2NZ4A 1WI8A 2DK2A 3TP2A 1YIJS 1H6KX 1R8HA 1VQ9S 1KQSR 2MJNA 3B4MA 1D8ZA 4YUDA 2DNNA 1VQ4S 1U1OA 1X0FA 3BEGB 1WF1A 1WG4A 3CCES 4WKRA 2OTLS 1OPIA 2HGNA 1WEXA 4C4WA 2MKIA 5LSLA 3RW7A 1YWXA 2L08A 2OJ3A 3P49B 3CCSS 2YWKA 2DIVA 2KVIA 2MY7A 2ADBA 1YHQS 2QFJA 2RVJA 2X1GA 2CQBA 1X4FA 2FHOB 2J8AA 2E5GA 4LIRA 4WFBQ 2MGZA 1WHYA 2VONA 1DRZA 2GO9A 2PEHA 2JX2A 3MD1A 3VAMA 2VOPA 2KM8C 1JJHA 3G9CA 2E5IA 5DM7Q 3DLLQ 2XS2A 1Q86T 2MSSA 2HGLA 3UCGA 1U1QA 1VBYA 4ERDA 3CCVS 4C0OC 2Q79A 1WEYA 1IQTA 2FC8A 1NO8A 3S01A 1FJ7A 2MZRA 3OW2R 3LQVA 1JJ4A 2CQHA 3FEXB 5DDRC 3HI9A 1M90T 2LYVA 4UY8T 1WHXA 3CTRA 2CPZA 2A3JA 1U6FA 2M8DB 1B7FA 2OSQA 2KXFA 2CJKA 2LA4A 2RQCA 2MKJA 3BS9A 2JWNA 2O3DA 1O0PA 3S8SA 4F26A 4J5OA 1N8RT 5D77A 2EK1A 1G2EA 2KRRA 4WCEQ 5JVGQ 1Q7YT 3P3DA 4BS2A 1WG1A 3R1LA 2MYFA 4TLQA 2X1AA 5IM0A 2MZJA 3MI7X 2DNHA 2G0CA 3UD3P 2DITA 2F9JA 2LMIA 3IWNC 3G8TA 2ERRA 1WF2A 2GHPA 2DIUA 1Q82T 2E5HA 3NNHA 4QU7A 1FJCA 1SJFA 2DNOA 2JVOA 2RRAA 1FXLA 3R27A 2DH7A 1FNXH 3S6EA 4LJMA 3CC2S 2BOPA 1L3KA 3D2WA 2DGOA 3VAJA 2MMYA 2VOOA 1VQMS 5D78A 2KM8B 2KXNB 2J0SD 2DISA 5LSOA 1HD0A 5HL7Q 2RU3A 4TU8A 2LQ5A 4FXWA 1WF0A 3U1LA 3CCMS 2DNRA 3US5A 1X4CA 2KG1A 3J7ZT 1M5KC 2CQCA 2L9WA 2MQPA 2JRSA 1VC0A 1X4EA 2OIHA 3ZZZA 2CQ2A 2N3OA 2DGWA 3MUVP 5GAGU 1VQ5S 2SXLA 1KC8T 2CPIA 2DH9A 4M5DB 2L41A 5CXTA 4ED5A 2X1BA 3P6YC 4YB1P 5LJ5Y 3VALA 3UWTA 1D9AA 2EVZA 2RT3A 1VQKS 3G96A 4OZ1A 3PIOQ 2CPXA 3BO3A 2DB1A 3JB9k 2N7CA 1QVFR 2DGSA 3MOJB 2DNLA 1KOOA 4Y0FA 3VAIA 2HVZA 3SDEB 2LECA 1M1KT 3CCUS 1K8AT 2DNGA 3CUNA 4TU9A 5GAHU 2DHGA 4PR6A 2FC9A 2KU7A 2LEAA 2MKHA 2CQIA 3N9UC 2D3OR 2UP1A 3UCUP 1X5TA 3RW6A 3PIPQ 1QVGR 5DDPC 1VQ8S 1H2TZ 4V19X 2E44A 1OWXA 2HGMA 2QEXS 1WG5A 1WWHA 2N82B 2U1AA 4IOCQ 2KRBA 2CPHA 2DNZA 4F25A 4PRFA 2G1DA 2DHXA 2CPJA 5GVQA 1N52B 2CQ1A 3VAKA 2XS7A 2RUGA 5GAEU 2M52A 2ZJQQ 2YKAA 2LEBA 1WHVA 2MKSA 2YTCA 1ZZNA 2MKCA 2CQDA 2LXIA 1SJ3P 1WI6A 3NNAA 3ULHA 2DGVA 3UD4P 1R8PA 2RS2A 2XNQA 2XNRA 2D9PA 3THTA 3EX7B 5LXYA 3CPWR 3P5TL 2AYBA 3G71S 1A7GE 2ADCA 2KI2A 1DHMA 3S7RA 5GMKa 3DXBA 1VC6A 2OTJS 3CF5Q 1U1RA 4CH1A 1YJNS 2KG0A 1SJ4P 5MLCV 1N54B 1KD1T 3VAGA 3CULA 1QM9A 1ZZFA 1M5PC 1WHWA 1FJEB 3CD6S 3MURP 2WBRA 2LCWA 2MQMA 4FXVA 4IUFA 1X4GA 2AYMA 2U2FA 5DDOC 2MZSA 3MD3A 4CQ1A 4OZ0A 2RRBA 1M5VC 2M88A 1JMTA 1U1MA 2DNKA 2KXHA 2DGUA 1X4AA 3UCZP 2DNPA 1X5OA 2M2BA 1YTYA 2DO0A 1VQNS 1KOHA 3V4MA 2CPFA 3H2UB 3NS6A 3UE2A 2CPEA 5ITHA 1YITS 4QU6A 3LPYA 5BJRA 3CMES 1YI2S 2AD9A 2MZ1A 1FT8A 2ZJRQ 4P6QA 3VF0B 1URNA 2JVRA 5EN1A 3FEYB 2MQNA 2NLWA 4RU2A 1HL6A 5DDQC 3J7YU 4IO9Q 1RKJA 3CCJS 2I2YA 1PGZA 2MSTA 1VBXA 2XSFA 4W90B 2XB2D 3MXHP 2MZQA 3CCLS 1PO6A 1SXLA 2XS5A 2I38A 1U1NA 1UAWA 3HHNB 1U1PA 5LXRA 5FJ4A 2LXUA 2LKZA 3Q2TC 3SDEA 3MDFA 3SXLA 4IOAQ 2DO4A 3BO2A 5H1SV 3U1MA 4PKDB 2MY8A 4F02A 1CVJA 1S72S 2CQ4A 1X5SA 5LJ3Y 1VQLS 2YH0A 1U1LA 4Y00A 2DGQA 3MUMP 1OO0B 2MB0B 2B0GA 3EGZA 5HO4A 2MQQA 3CCRS 2FY1A 1P1TA 1VQOS 3NMRA 4W92B 1JJ2R 2F9DA 3K0JA 4ZKAA 5CYJA 2F3JA 2MJUA 2DHSA 2K3KA 2HZCA 2MQOA 2VODA 1YJ9S 1VQPS 4C7QA 3IRWP 3SMZA 2K8GA 1H2UX 5DETA 1VC5A 3I56S 2MQLA 5CA5A 1X5PA 1W2BR 1H2VZ 1UP1A 1P27B 2MGZB 2KFYA 2PE8A 2AYEA 2CPYA 2KYXA 2M4MA 2CQGA 4Z2XA 1K73T 1FHTA 3CC4S 1U1KA 2KN4A 2RS8A 1U2FA 2X1FA 1VBZA 3BO4A 2DH8A 5GADU 4LMZA 2M9KA 2KHCA 1WEZA 5IQQA 4YOEA 2EK6A 2V94A 3VAFA 1DBDA 1AUDA 4EGLA 1XN9A 1RK8A 4A8XA 3NNCA 2M70A 2J76E 3CMAS
chains in the Genus database with same CATH superfamily
5H9FJ 2QIFA 4NXNJ 1JNRB 3BSNA 4L3KA 1S79A 1TELA 5CZVA 1K9MT 3B4DA 3EZOA 4LFAJ 5HP1B 1DZ5A 2XI3A 5A8KA 1T03A 4OL8A 1HBUB 3NP5A 2RF2B 4C3KA 3M4XA 1HBNB 3OXFA 1QJHA 1RAIB 1TAQA 5KFXA 3DRRB 1PYTA 1QE1A 4IH5A 2FVQA 2D41A 2ZBQA 4TU7A 4HLBA 1QTNB 1HWUA 2C3MA 2B43A 1HA1A 1HWIA 3G4SS 4WXOA 2VFTA 3GV5B 2EWHA 2NQPA 4ED3A 2DJWA 2YNFA 1MROA 3JTPA 5HVHA 3B4MA 3L7PA 1BQNB 2HHSA 2HMIB 1WG4A 3R2CJ 1RADB 3KJNB 3TA0A 1IKVB 2XULA 1JIHA 4Y2CA 4KHRA 4DPXA 4A8MP 2GJFA 2NXUA 1BHNA 1QSSA 2GO9A 1RHKB 3MGJA 3KLIB 2WSCC 4OYMA 3UCGA 1N48A 3E2EA 1LNQA 1VBYA 4OX6A 3H5YA 2YVSA 3A1YG 4HTJA 1EX8A 1RLCL 3M32B 2B9YA 2ZH9A 3IR7B 2YWFA 3A12A 3DNCA 3N01A 1VRTA 2K1RA 2GGPB 2BJ9A 5LMUJ 1H73A 4K4ZA 3RB4A 2JWNA 3PXGa 2NUUG 3KK3A 4XK8C 3OL9A 4Q2MA 4U6PA 4RNNA 1S1UB 2R2UA 2FJWA 2ZH4A 3ZZRA 5I3UA 2DIUA 2Y1JA 2HBQB 4AXJA 3KHRA 4WP8A 5D4PA 1FRLA 1FXLA 3QPIA 4PXCA 3K5PA 2IDEA 3PYDA 5IS2A 4BWMA 2BABA 2DGOA 2HRYA 3PO5A 3TZYA 1RT3A 2V2KA 3CDAA 5IZHA 2AQ4A 2RB7A 2DNRA 2CQCA 2LQ9A 2WW4A 2L9WA 2JRSA 3EWGA 2ZM6F 3BH7B 4NRTA 3MUVP 2CPIA 2DH9A 1NEEA 3AY0A 3P6YC 4C8OA 3IM9A 2HVHA 2RT3A 4U7UK 1JLAA 4OZ1A 1ROFA 3PIOQ 4Y34A 3PFEA 4ELUA 2HVZA 3CCUS 2V8PA 2HQFA 2KU7A 2ZH5A 1F2HA 1Y00A 3NBPB 1IBMF 3N9UC 3GIIA 4ECUA 3UCUP 3RW6A 2QZ8A 4MYTA 5KFGA 3J81U 4J9RA 2CPHA 3AFGA 1R0AB 2G1DA 2OUGA 2HS4A 1M1HA 1FDDA 1ZM3A 3NAIA 4Q8EA 1MSWD 2LXIA 1TL1A 3PY8A 2DGVA 3P45B 2XNRA 4NX9A 4Y28C 2D3O1 5CD4H 1S12A 2DHHA 3CULA 4C48A 2Q6BA 3MM8B 3A8IA 2QGFB 3CT9A 1LXNA 1RI7A 2MZSA 3O2IA 2WB4A 4LFBJ 3LGHA 4MKAA 6FDRA 2KXHA 4FVMA 3UCZP 2DNPA 2M2BA 4DSIA 2QL9B 2CPEA 3OHBA 5J2QA 1KVJA 5E3CA 3RR7A 3FSYA 4WU3A 3PRBA 2CJ9A 1RE1B 3KJFB 3GV8B 2XEXA 2UUTA 2QA4G 1U0HA 2LU1A 2FQQB 1Y4ZB 1UKUA 3P4UB 4TKTA 5JMNA 1IR0A 3SDEA 4DEZA 2HNZB 2G2YA 2CG8A 4RNOA 4LF4F 5KTQA 2BE2A 2CG4A 3UVJA 3TUIC 3M1VB 2HBYB 4WP9A 1Y11A 2EFNA 4JV2A 1VYAA 5HO4A 1Q8KA 4PAAA 4JI2F 1S1XB 3SI8A 1EJ7L 1BGXT 2IC3B 3MM6A 3M6WA 4Y6IA 4OV6A 1K0VA 1FHTA 2ZDPA 3KTQA 1WSVA 2KN4A 1U2FA 1CEZA 1B4SA 1KR4A 1YRXA 4AFFA 4ZLLA 2AHOB 2DEJA 4RW6A 4LT6A 1R27B 4DV1J 1AB8A 1X4BA 3BZQA 2BACA 4WYLA 2E66A 2J7KA 2R7XA 2CJBA 3JS9A 1MWYA 1ZH5A 3SZ2A 3T1YF 3UR3C 4NLRA 4IQMA 3ETOA 3H20A 1KP6A 5LSRA 3CEDA 2V8HA 2VZ9A 3QFWA 1JLCB 4IG3A 1N0UA 4LF8J 2G4BA 2BDPA 2BJ1A 1UFKA 5L1JA 2POKA 2OPSA 2Z8QA 2VFRA 3TP2A 1NB7A 2HEKA 3GSIA 4U8VA 1JLEA 3TOQA 1MW7A 3EZUA 3CWJA 4NPOA 3ILJA 1VQ4S 3BN4A 2H48B 4EYHB 1TMMA 5KG1A 2QYGA 4I6AA 4ZVTB 1YWXA 2AW0A 2WRMA 1S0OA 4QIVA 2MGZA 2VONA 3Q8VA 1L3TA 2UXBF 5J2MB 1LK5A 1NAQA 5DM7Q 3WQPA 2MSSA 3NXZA 3QQCD 1FI4A 2CIMA 2ILZA 1UVJA 2W01A 5G4DA 4DR6F 2Q43A 4DFMA 2E7XA 4EWTA 4IRKA 5DQGA 3R5CA 3FFIB 2C1EB 1YK9A 5HBMB 4NYPA 1WDTA 5J2NB 3PX6A 2JEJA 2GA7A 2XY6A 2MYFA 5DO2A 3ZTOA 4B3OB 2QA2A 5LL6d 4QYZK 4I2PB 3NGKA 4QU7A 2JVOA 2FVRA 4MTPA 2W2NP 1LWFA 2VOOA 3HX9A 1VQMS 1XQIA 4KT0C 5E2QA 3TX8A 3QMQA 1NRKA 2PMWA 1CS4A 1YKWA 3CVKA 3ZZZA 1VQ5S 2PFFB 3NGDA 5HROA 1IWAA 2L41A 3QYYA 3K7RA 1KEKA 2W9AA 3UWTA 1FEEA 2HNDB 4J9NA 1PBUA 4J9SA 2N4DA 1FWLA 1RACB 3MCMA 2DB1A 4Q43A 3VGTA 4P2FA 1KSPA 3SSRA 4AQYF 3GP9A 4JI6F 1GMUA 4LRCA 2VQEF 3N28A 4ZCLA 3ENWA 3GJRB 4EK2A 1AFIA 4WPAA 2I5JB 4DUZF 1Q5VA 2JC1A 4HT5A 5IC4B 4KY3A 5EX3A 4IFVB 4OFZA 2OO4A 1N52B 4CWBA 2FVPA 2XS7A 3OVAA 2GFFA 3QO9A 2NPFA 3ULHA 3WHIA 4ZLPA 2F4FA 3QIDA 1VLYA 1VDHA 1MWQA 3BR9A 4NEYA 2GIQA 2IDLA 4NOHA 3VV2B 1XMQF 1X31C 5F0WA 3V6HA 1AW0A 1RHQB 4ECVA 4M95A 2M88A 2HZAA 3KJVA 2B5JB 3TAPA 3RRKA 1KOHA 3UE2A 1MG7A 4QU6A 3HHLB 1YI2S 1VMBA 4V1Ak 4P6QA 5LT5A 5A2QU 2B9XA 4MAKA 3HVRA 2F5GA 2EXUA 1IVZA 3MMBB 1CLFA 3G8QA 4ZPBA 3CCLS 1T95A 3RTVA 2UUBF 4ZJQA 2YX4A 2Y8WA 1T0TV 3MCSA 3R6LB 4R8UA 4ZHRA 2R2TA 1TVRB 2PMZD 1YJ7A 3ILLA 1WC4A 3UFCX 5H1SV 4FDFA 1B64A 1OSDA 3EGWB 2IJRA 1VQLS 1FFGB 1C0UA 2E7VA 2FHMA 3C14B 4MIAA 5IWAF 3NMRA 5IOLA 4GKKJ 3M8QB 4ZKAA 4ZCKA 2VJVA 2YKQA 3OTBA 1CBKA 2YQ0A 5IV4A 2E9TA 3OXLA 3RAQA 3G82A 1H2VZ 2CPYA 4QYZJ 3N6LA 1SKRA 4PPDA 3A3PB 5KOWA 4MFBA 2NS1B 4A8XA 3H42A 4OYOA 3LP0A 1S99A 4DWIA 1NJYA 3QJLA 2KT5A 2IBOA 2V4JA 1Q81T 1B0TA 1DAXA 3IG1A 3DGPB 3CXCR 1FO1A 8ATCB 4B3TF 3LOUA 2VA3A 1SUQA 4ETZA 4CH0S 2YQ1A 5HANA 2UZAA 2CWKA 2CQ3A 1TK0A 3I55S 4DS4A 4ZDNA 3W1YC 4OHWA 3ITHA 5LOQA 2AYGA 2R8IA 1YX2A 4WF9Q 3NRBA 1CJKB 3FMBA 2VPWB 1KVKA 3JSRA 3LAMA 2F8HA 3TJAA 3CC7S 4C98A 3M8PB 2HK3A 2X3DA 3PTWA 3W3SA 4ZVGA 1U1OA 2R2RA 4EMDA 4OX7A 2IRXA 5KFKA 1RWXB 1JXVA 1LW0B 4DJBA 2LFVA 2YWKA 4FBTA 4YP3A 1RWWB 2DY9A 3SFUA 4N76A 4I7FA 3CDUA 5F9NA 2C42A 1K1SA 2EG2A 4WXWA 2VOPA 2CNOB 3Q8QB 2E5IA 4K4SA 4C8MA 2B4VA 1OJ4A 2MHEA 4N7TA 2DPIA 1NKCA 3VQTA 1RGVA 4UUWA 3W63A 4JI2J 1U4BA 3I31A 1M90T 3PR4A 4X65F 2LYVA 4C9DA 2A3JA 2M8DB 1S4FA 3PFOA 2CJKA 2R2SA 2GHVC 3DDNA 4LR7A 1FFWB 2KFNA 3PV8A 1Y3JA 5JVGQ 3OD2A 3CO9A 3P3DA 1WG1A 5D0HA 2ROPA 1F2GA 4JI1F 4RZRA 1FRXA 4I6YA 4O3QA 3CO0P 2RU9A 1XTZA 3VGUA 1D09B 2DNOA 4NLDA 3B6BA 4QW9A 4DU7A 3KHLA 3C16A 5L39A 3BGUA 1IBCB 1UL3A 5LSOA 1CC7A 1HD0A 1TKXB 4RO0A 1Y3KA 1Q53A 4B3RJ 1N36J 3HHDA 4M5DA 3ZZUA 2BJEA 1UJ6A 1K0TA 2PI4A 3GMGA 5B0FA 5L9XA 3SQGA 3WBZA 1D9AA 2EVZA 5HMXA 4DDFA 2CNNB 4K4XA 1Y7PA 3PEJA 1FKAF 1WD6A 3MM5A 3IS9A 4P74A 3KUGA 1C0TA 1I3OB 2DHGA 4B08A 3D9BA 3KMSA 2CQIA 3H7HB 3HHLC 1KWMA 1VQ8S 4QCLA 3CJQA 2X51A 3RRGA 1T9YA 5KG2A 5CYMB 2QMUB 1ZYQA 2MKSA 1ZZNA 2UXBJ 1VIOA 1VLOA 2BQUA 2R7WA 2VV5A 2CZ9A 1T8EA 5A0YA 3EX7B 2YNIB 4DR2J 1CPZA 2HBZB 3I0RB 4IKAA 3VAGA 4I2QA 4X4QA 1VK3A 4DR6J 4RBVA 3OL7A 1KLNA 4ZPVR 2OEJA 3V4MA 3ILIA 2Y8YA 1HBOA 3TQ1A 5BJRA 2VG7A 2AD9A 2MZ1A 3VF0B 4DV2F 2NLWA 4WZQA 1SC6A 1T03B 1OS5A 3OLAA 1HQEA 2K3IA 3FSXA 1L3UA 2VU5A 2Q6CA 2XS5A 3HD2A 4Y2KA 5KFHA 2ZZNA 1U1PA 4ZVSB 1QE1B 1SC3B 2V8VA 2CJAA 5IQ6A 2GQCA 3TA2A 3CSKA 3KWMA 2E29A 4X4UA 3PNIA 2VFUA 3BPDA 3P5BP 3GLJA 4DQPA 2QO3A 4M5LA 3RAMA 2ZOGA 2F9DA 3K89A 4RPFA 3UNGC 2HZCA 2MQOA 1UZDA 3DDKA 1LWEA 1PC4A 4AQYJ 4JI6J 2JH3A 2OAUA 4DLEA 2M4MA 3SCLE 3EJMA 3QBCA 4JI3F 2X1FA 3SSSA 5L8RC 4DUZJ 3QRPA 4PG8A 3CMAS 4AD6A 1WELA 4DQIA 2ZHBA 2MPUA 4PPZA 1K1QA 1OY8A 2RQKA 1VRTB 3LALA 3OUYA 2H3EB 3IFEA 5F8JA 9RUBA 3KK3B 1N5QA 1RU1A 3BBCA 4QQBA 3TJ8A 1NM2A 4O3PA 1RJJA 4IRCA 3NS5A 1KN6A 1WNEA 3SQOP 5CCMA 4ATNA 5I3UB 4WIIA 4HHHA 1J5EJ 1GK8A 4MT1A 2PSZA 2C3YA 5KFZA 4EBEA 4QWDA 2AT1B 1RT3B 4HR2A 3TZWA 4OI0A 5DGBA 1S1VA 3UN2A 5EUHA 1TV6B 3FEZA 1HNIB 2W4DA 4YB6A 4JV5J 4C4WA 1HHSA 2FZKB 2J9CA 4DLGA 2ALYB 2QN6B 3QT8A 2ADBA 1JLAB 1BQXA 4WFBQ 1D9FA 4JI7J 1DRZA 2JX2A 4MH8A 4ILMA 4GRSA 4ELTA 1TUWA 3T5HA 4ZPDA 1U1QA 2FJVA 1F3FA 3KLVA 2BE7D 2JFDA 5GADI 5DDRC 3A8KA 1IR2A 2DCLA 2VASA 2EC2A 1B7FA 4LRBA 3RBZA 3EDQB 2RQCA 3KHHA 1N8RT 4C3LA 2ROGA 2E1MC 1KBRA 3FK4A 4TYAA 2B8PA 4A8QA 3FVYA 3MAHA 4Y3CA 1YDLA 5IM0A 2C22A 2MQ8A 3F73A 4EEYA 4URGA 3C6TA 4QR0A 2CJXB 3HK2A 4HL9A 2RRAA 2HVIA 2LDIA 4I4BA 3R8YA 1S10A 3C8YA 3LGMA 2O66A 3Q23A 1B0VA 2IA6A 1CQNA 4AUKA 4B3TJ 2W8LA 2WVDA 2KHDA 1U2RA 1RT5B 4O3SA 3TI0A 2YWGA 4F0KA 5J2QB 1RXOB 3RUBL 3UDCA 1GX5A 4FYYB 3UO0A 2YX7A 5GAGU 4TNOA 3ENVA 4IQXA 4R25A 5CZXA 2DYAA 1RBOB 4Q7AA 2R7OA 3M2UB 3BF4A 1UWBA 4ZLNA 5KFPA 4X64F 2IAJA 4P2XA 1YJRA 2XMVA 4OYIA 4P52A 2ASDA 3SDEB 3CE8A 1PJ5A 4DXLA 5KT7A 1RAAB 2BE2B 4ZN3A 4ANDA 1HNWF 4TY9A 4F36A 3OL8A 3EGVA 4ZA1A 1Q5YA 2DRBA 1RTJA 4V19X 4MYUA 2VHGA 2DHXA 3QIPB 1GMWA 1AXQA 3RG6A 2UUAJ 4LF9F 1GEHA 5KFOA 3MEGA 1T3OA 1FKOA 2MTLA 2G9OA 4HHUA 4ZIVA 2KTQA 1XR5A 1UZHA 1S9EA 1DFDA 2HFNA 4X65J 2U2FA 3G2XA 4FF3A 1FDBA 1X7VA 4RW6B 4LSLB 1UA1A 3AD9C 1JMTA 1QY7A 4ZJOA 2VC1A 3PHTA 2R8HA 1R6VA 5C42B 4CM2A 1RTZA 4J9KA 3NS6A 2R7UA 4JI1J 1U0SA 4EBCA 2CA9A 1HQ2A 5EN1A 2OFGX 4A48A 1E6YA 2JLGA 4OZJA 4DBQA 4DCJB 2XMWA 4QYRA 3D3CJ 3W5ZA 3FRYA 3HHNB 4IG3B 4NCGA 1MU2B 3IC1A 3ZNUA 3J7A1 2OPSB 1NK0A 2EPIA 3QLHA 2FLLA 3TZZA 3D6MB 4ID8A 2MY8A 4ZVPB 4ECWA 2YH0A 1U1LA 1JLEB 2ZH2A 3EGZA 4YR2A 4W92B 4A8WA 3GTYX 2GJ2A 1XK8A 1VC5A 2ZHAA 1YG0A 3MPUB 1MN9A 2MGZB 2OEMA 3EMTA 2CJYB 4LMZA 3MECB 2EK6A 1UPMB 1DBDA 1RT1A 2CYYA 1RK8A 4ZVEA 3OJUA 2LA6A 5AXMA 2B9EA 5DGAA 2ACMA 2RUSA 3R1HA 1C4AA 2MXYA 1UEKA 3G8SA 1NH8A 2M7SA 4KH1B 3LANA 2KH9A 4X66J 1CQMA 1BY9A 2C2NA 2N3LA 2QSWA 2CNLB 2CQ0A 2RF2A 4E8UA 4ZJLA 2C2EA 2NZCA 1X4DA 1HBNA 6FD1A 3SFGA 3CW2C 3MUTP 4DPUA 3THPA 3KLHA 3W9HA 1OMSA 4EUVA 4UT4A 1XMBA 2KZMA 3N4WA 2GMLA 2CPDA 2JL9A 2FGOA 2J0QD 1N88A 4MMOA 5CQGA 2OKQA 3M9OB 2A6OA 1TK8A 3QWUA 1CS4B 5ADZA 2HPUA 4WKRA 1NKBA 3W2VB 5HROB 1NPKA 2CADA 1DQ8A 4JUZA 2IVFB 7FD1A 1X4FA 4LIRA 4AL7A 4A8YA 4N8NA 2MLYA 2ZC4A 1S0NA 1U8SA 2XS2A 2I1RA 3CCVS 4C0OC 2AF6A 3FJ2A 3MEEB 2MZRA 2GGPA 4UY8T 4CH7A 1G3OA 3QWPA 4O3OA 4JBCA 2ASLA 3QAUA 5CH7B 2OSQA 3HFKA 1S1UA 1H7XA 2FHJA 3SV3A 3QO9B 1ITPA 4BS2A 3G6YA 2XM3A 3D28A 2XTJP 4ELVA 2RAQA 1RYRA 4F7VA 3NNHA 4X4RA 3GILA 1RZMA 3H5XA 5D3GB 1K44A 4OJ1A 5CYQA 3W62A 4C2MA 4DZDA 4LJMA 4K5SA 4OQJA 2V63A 3C6UA 1IM6A 1R8BA 3KJVB 1Y9OA 4YY3F 1DJ0A 4OJHA 1I94F 1M5SA 4RW4A 1W2IA 1V5VA 5I4MA 2CQ2A 2KT3A 3LP2A 2X1BA 4J9MA 1WACA 4USMA 4YB1P 4B3SF 5LJ5Y 3HKZD 2V5HG 2DXFA 4OYWA 4UF4A 3KXDA 1XNQJ 4ECYA 2YBVA 1VISA 2UP1A 4NMLA 4LF6J 1RSCA 2XYGB 3J81j 1R0AA 4M8LA 1C0UB 3IGNA 1L3SA 5KFVA 4BC7A 1VQSA 4ZVUB 3NMAA 3DOMA 3D67A 2YTCA 3F56A 5ETNA 2F8MA 3T9ZA 2PMHA 4NYZA 1D1UA 1V3RA 3G82B 3JTOA 3G71S 4F50A 3BQ0A 3CF5Q 4CT9A 2OPRB 1SJ4P 5HATA 3QAEA 1FA0A 2UXCJ 4DL2A 1ZZFA 1JQGA 3HT0A 4FXVA 4QJVA 2I9SA 3LP0B 4ECSA 5ETOA 2JC0A 2RRBA 1M5VC 2V4JB 4B9NA 1VS3A 1U49A 4ZITA 4URSA 4JI4F 2B7CB 4LBHA 5K8NA 3F0NA 1SUQB 4F67A 4FF2A 4ZP6A 4NWBA 4C11A 2CZ4A 2XSJA 3M7VA 2QG9B 2KL8A 2MZQA 3LH2S 2HNZA 3BDEA 3F41A 4DX8H 3HHEA 1ZA2B 1PAEX 1NK7A 1H72C 1IR1A 3SXLA 2DO4A 1MMLA 3HXMA 4F02A 1UVLA 2HVDA 1TUGB 1ELOA 4YDXA 5EX0A 2AWZA 1P1TA 4ZCMA 5DLGA 3LWLA 1NDKA 3OLBA 5CYJA 3GSDA 3M9MB 3T1HF 2XZTB 5AJ3F 4LSNA 5E0OA 2BKPA 3NCQA 4DPYA 4I7FB 5KG6A 1P27B 4DR4J 2KYXA 1NXIA 3W5XA 4NLXA 2RS8A 4ECQA 1CJUB 4F4ZA 2EC0A 1T9VA 3ZXWA 1HI0P 4RW8B 4OI6A 4N41A 2QLFB 5ETVA 4UUXA 2XMUA 1VRUB 1VHFA 3C3LA 3AODA 1NU4A 4ETXA 4IR9A 4XO0A 4EO6A 1A6LA 2BX6A 3U02A 1S6QA 5KFWA 3HM9A 5HI7A 4J9VA 4CIOA 1U09A 2PD1A 1JLCA 2R4FA 1I5OB 2I6WA 2BW7A 1N32F 3MM9B 1RUSA 1YJWS 3QZ8A 1A9NB 9ATCB 3C16B 2IMWP 1URRA 2GJIA 2GVDA 3MR6A 1LEOA 2H9ZA 1R8HA 1KQSR 2HK2A 4K4YA 4AL6A 4O44B 3O44A 4ECRA 3GIKA 2L08A 1FTCA 2WOMA 3TW0A 3CCSS 2V6AA 2GX8A 2RVJA 3K8WA 2BQRA 4NA2A 1R7IA 5HQLA 1JJHA 4JP8A 1VGYA 3CJSA 3MM5B 3A8JA 3IS9B 1C0TB 3MEKA 4DV6J 2R8KA 5F8GA 3S01A 1HIYA 5KG7A 2IMOA 3HI9A 4N5SA 3BSCA 1WHXA 5HBMA 2CPZA 5J2NA 3POTB 3OJSA 2V8DA 4CO4A 1FDNA 4LFAF 3H25A 4B3MJ 4F8RA 5A0YB 4Y65A 2ZH6A 3FMWA 1F0XA 2ZZMA 4FKXA 4I2QB 5B0BA 1FNXH 3R5BA 3CC2S 4FZVA 2ZUAA 3W65A 3DKDA 5KFIA 1FVSA 5KFMA 2BMBA 1ZAXA 2KG1A 2Q3PA 1Z2LA 1M5KC 4MK9A 2HFUA 4HDGA 2VG7B 2P6TA 2OEKA 2HAFA 1KTVA 5CXTA 4ED5A 3R97A 1IJFB 1X8DA 3CIZA 1R31A 2Z30B 2XO6A 2XCAA 4CLKA 1RAGB 3LGNA 2DEIA 2X3GA 4A46A 2ATCB 4LBPA 4K50A 3GJQB 2ZH1A 3KK2B 1KS2A 1FF2A 2ZE2B 4USTA 3W8GA 3SCJE 4BDPA 1REVA 1HR0F 2ZITA 1U8WA 3EPGA 1D8YA 5F8IA 2QEXS 4A8KA 2DT9A 4F25A 3IAS9 4PRFA 4X62F 5GAEU 3FBFA 1GMVA 3D1HA 3R7BB 1LWEB 4NLWA 2PGCA 4F4WA 4QW8A 3S7RA 3DXBA 3MMAB 2AKWB 2VDHA 4UW2A 1S76D 5MLCV 2W2QP 4RKUC 5HN0A 2G2ZA 1FJEB 1SH2A 4FBUA 1X4GA 4QZVB 4DS5A 4YR3A 2DNKA 2C28A 1SL2A 2QLXA 3HHLA 2DGUA 2V4QA 2CPFA 1IXKA 1UVIA 3OUYB 3MMBA 2NUHA 2YWHA 3UDLA 2ZZTA 4RU2A 2DR5A 2HIYA 5ETKA 4QR1A 7FDRA 1YGYA 1RHJB 7AT1B 1EQMA 2W2OP 5J1PA 4ZVQB 2QTWA 5KT5A 5F0UA 2CKWA 4MKVA 4PZVA 4YY3J 3BO2A 4HKQA 1GTHA 1I94J 3C14A 1Q4RA 3CNQP 4OZ5A 1S72S 3HP6A 3RBXA 4IG0A 1OY6A 2O67A 2PA8D 3Q89A 3GZ7A 4B3SJ 4IDKA 3ISZA 2FB0A 2HHPA 2DHSA 3D1OA 4L3NA 3ZO7A 1VI7A 3ISND 5DG9A 1TU0B 4CT8A 4IR1A 4ANEA 2W9CB 4DFPA 2HFSA 3NCRA 2IM3A 4U7UD 2BJ3A 1FWKA 3BO4A 3PW7A 2KHCA 1RWNB 4GC6A 1BC6A 2NYHA 3BYRA 4RUBA 2B6AA 4LFBF 2OLWA 3HT3A 3IWLA 2K7KA 4U67Q 2UXDF 4MK8A 3L7OA 1IN0A 2MZTA 4FP9A 3N6NA 2YH1A 5BYQA 1HHQA 1BE4A 4OI3A 4NXMF 3W2WA 5IM0B 1HD1A 4YMEA 2Y9HA 1U24A 5EWGA 1IBLJ 5E5NA 4A47A 1EP4A 2LU2A 2VB6A 5D6GA 3HFVA 1SL0A 1RTDA 1VCTA 2ZC3A 4B9TA 3QRRA 1LFWA 4I56A 3LAKA 3M30A 3W5YA 3T41A 4FVCA 3M8PA 1HLWA 2FLOA 5JVHQ 2CQPA 1RTIA 4ZPCA 2M0GB 2DK2A 3MCNA 4WTYA 2FJXA 1VQ9S 2WW8A 5D15A 1LW0A 4H4OA 4J9UE 3K5LA 1X0FA 2GV1A 4M5IA 2RQMA 3CCES 4DX6A 4HYKA 2HGNA 1X60A 2H5JB 5G0RA 2WSFC 1RU2A 2CQBA 3KLGA 3GYXB 1UWBB 2H4YB 2IAJB 4PG4A 4G1QB 2FJEB 1HFEL 1X0PA 4ES2A 2GC8A 2Z2LA 2XLKA 3GCWP 5T14A 2HHXA 4DV3J 4Q2LA 2BJ8A 2BA9A 3LQVA 2EG1A 4RNHA 4EZ6A 1RTJB 4DV1F 2W24A 1NKEA 3OHAA 2V4RA 4KO0B 4DU8A 1Q16B 2IY5B 3S8SA 3AH6A 3H98A 3MI7X 4DR3J 1FKOB 1T9WA 1WC0A 3CD0A 2CVEA 5EWFA 1RT7A 2FYXA 4ZVRB 4ZN1A 4LF8F 3OVSA 2BOPA 2MLXA 2GIRA 2DR9A 1R6YA 2MMYA 4C97A 3I4PA 5F41A 4XDDA 3EYZA 1UW9A 3US5A 1X4CA 3B82A 2PDAA 2R7RA 3JXOA 3FQKA 4PUOB 2W4CA 1LOUA 1FXDA 2YNHB 3K57A 1E6YB 1N32J 4R0JA 2JEGA 3C19A 1DY3A 2BJ7A 4PG6A 3G96A 2FDNA 2CPXA 1U45A 3UNYA 4X4NA 4DL7A 3TWZA 4TU9A 4DQSA 3PR5B 3QLHB 2LLZA 2HHQA 3TJ9A 2DR6A 3ET6A 5A76A 2OP5A 4GMKA 1RWOB 4ILLA 4XDCA 4I0WA 4GKJJ 1NB2A 4P72A 4RW7B 2ABYA 2KRBA 3KMQA 1H0HB 2RUGA 1SH0A 3I0RA 1L3VA 1SQGA 2CRLA 1KNZA 4DPOA 1DHMA 3THVA 1U1RA 4C8ZA 2KG0A 3K2YA 3I5AA 1RT1B 3CD6S 3D0GE 3Q8UA 2QMWA 1GX6A 4FYDA 1ZM2A 2X7IA 3MR5A 3CJ0A 2JEFA 2C2DA 4CO2A 2DO0A 2Z2ZA 2AJ2A 4ZVOB 1HWKA 2Y1RI 5HLFA 5KG4A 1Q1KA 2EKYA 2BKNA 2B4UA 4M63A 3H5SA 2RH3A 2HWTA 1S57A 1HYSA 1S77D 2QL5B 1OQ3A 3ZZ0A 2I2YA 1RAJA 4PWWA 1ZAVA 4O23A 3OSNA 3KLHB 4QR2A 1KVIA 3HDSA 1RT6A 2J7UA 4CO0A 3KUHA 2QJ3A 2WVBA 3M8ZA 4LRDA 2Z56B 2XWYA 1FJGJ 4ALZA 5C25A 1VQOS 4F3OA 2BYCA 4DQRA 3O1LA 1JJ2R 5HAOA 1SKUB 3GFYA 4ED8A 4TY8A 1WOPA 5DETA 1PJ6A 4NE9C 1R89A 2RIJA 4USKA 4U9RA 2PE8A 4Z2XA 5HQ8A 4GO5X 2O01C 1QUPA 4CRJA 4YOEA 4MIWA 4KR0B 3Q8SB 2ZBRA 5L46A 3DHWC 2M70A 1HR0J 1MNEA 3VQSA 1XWLA 1UJ4A 1IKXB 4AE5A 5K8PA 4X62J 4OHYA 3DDIA 2OHDA 3DRXA 5L9NA 3H4BA 5IFMA 2XMMA 3VAHA 2BQ3A 4P7VA 5F9LA 5HVGA 2V9WA 2HYIB 5M2RA 3EGNA 5DQHA 3Q22A 1N5TA 2BM0A 2WVEA 3AQPA 3HMJG 2V9KA 5E33A 1RISA 3I87A 2KJWA 5CYQB 1QAJA 1YQHA 1PKUA 4NL5A 1JLGB 1Q8IA 3K5MA 1EHWA 3C6UB 1TV6A 1SJQA 1UFWA 1HNIA 3I96A 2UUWA 5K8MA 1UFLA 3FGVA 4RW4B 1GMWD 1LWCA 4GKKF 2FHKA 4KB7A 4I1TA 4NLPA 3J7Z5 3LP2B 3P49B 2MY7A 2Y0BB 4RW9A 1N5YA 2QRRA 4CTAB 3KDOA 3DLBA 4H54A 5BXIA 1ZBTA 2B4OA 4IOBA 3WIVA 3Q0AA 4CLZA 1Q86T 3D6HB 2IJFA 2DXDA 1SJ1A 2Q79A 1OY9A 2KDOA 2VPXB 2J6UA 1YRTA 4DSFA 2JJ4D 4NRUA 1H38A 3IAM9 3UPFA 2QV6A 1B99A 2KZZA 4LVNP 3KK1A 3DOMB 3LPEA 5D8HB 1WC6A 2GHWA 4DL3A 1DQAA 2JNJA 3R1LA 3AJDA 4ECZA 2MZJA 5KFJA 1Q82T 4QIFA 1RHMB 3DM2A 4WE1A 1T9TA 1V3ZA 2G1HA 2UXDJ 1RT5A 3VAJA 1S1TB 5D78A 2HLUA 3OV7A 5KT2A 3R5DA 3SIPB 3AXMA 1PILA 3ZZOA 1NHUA 4NXMJ 3X3UA 2E5LF 4NLVA 3C66A 2OFHX 2C3UA 3M2UA 2AU0A 4FPIA 2YKMA 4C11B 5KG5A 2XSJB 2RDIA 3QGPA 8AT1B 1QVFR 2DGSA 2XY5A 2EI5A 3DLKA 2HQ3A 2WHOA 4Y0FA 5B0EA 1LWXA 1RWUA 2FC9A 4ZP8A 3PX0A 5T7LA 2OH2A 1X5TA 4G1PA 2VBWA 3QIPA 4KPYA 4B02A 5KFRA 2N82B 3BKUA 4CZCA 3GIRA 5DQIA 3PZPA 5C2GA 3I9ZA 4QIEA 1FE0A 2M52A 1HMVB 4LSNB 5K8OA 3AJ2A 3W61A 1TKZB 4EBDA 4CH1A 3CJ8A 1EETB 2A18A 1IKWA 1UETA 3H90A 4LSLA 1SB6A 4IUFA 5ETRA 3HJFA 3TUZC 4XIUA 1DTQA 5C42A 4OZ0A 2P6SA 2ATLA 1S0VA 4RNFA 3W7BA 1X5OA 2V0NA 4MK7A 3M8RA 2B4PA 1NSAA 4B3RF 1N36F 5F8LA 2YXLA 1YITS 1T05B 1S6QB 3ONQA 4O0NA 2YQ3A 4AT1B 3AJ1A 5HJXA 1IWGA 3L4BC 2XSFA 1AYEA 3D7SB 4OHVA 1MU2A 5HMZA 3BR8A 1HI1A 4LF5F 3UQSA 4L74A 3L7UA 4O3NA 3AQOA 5F8MA 1FFSB 3U1MA 1H74A 2GVDB 1JLQA 5E3RA 2GVZB 4DFKA 1CVJA 3O3LA 3IP0A 1RWVB 4DL5A 5AXLA 2B0GA 1P1LA 3CCRS 1SC1B 3FCVA 4F4KA 1G4CA 1KQGB 4ICLA 2F3JA 1U26A 1WUUA 1SBRA 4PEOA 4K4VA 3BQ1A 3QJPA 1GXTA 2D7SA 2WOMB 3I4HX 3QFHA 1FNOA 3BGLA 1HWLA 1QSYA 2DRAA 3MECA 4KIAA 3J81Y 4DR2F 5F8NA 2OI2A 3TUPA 2AJ0A 2BOAA 1HPZB 3OTDA 3MAQA 4EGLA 1H7WA 4JI0J 1GFWB 4LF2A 2J76E 2R7QA 1VQ7S 3T6BA 2ZWOA 2FJDB 3E3XA 1UPPA 2BVZA 2M3DA 1VQYA 4C8YA 4Q5VA 4FN5A 2N7YA 2M5YA 1OIAA 3K5NA 3PX4A 4YB7A 2DGXA 4OZ2A 2AX1A 2BZ2A 4NCAA 4C6AA 2IA0A 1SVDA 2A6MA 1VQ6S 1U6BA 3MR2A 3C46A 4F3QA 4DSEA 4OV1A 1HW8A 3G6VA 2P9EA 1ZM4A 2R9LA 2XI2A 4DN0A 4ED6A 2NXEA 3GE9A 2HQGA 5DG7A 1RQ0A 3PYEA 3W2VA 4ID5B 5ETSA 1NBEB 2IIHA 2ZNYA 2EFVA 2GW8A 1NLKL 5A8WB 4A8SA 3ZTQA 1SL1A 4FF4A 3CD7A 4NZ6A 2GAHC 4K7QA 2DPJA 3MD1A 5KFLA 3PW4A 3MEEA 4WTOB 3KJQB 2W7AA 2XMKA 4DCOB 1APSA 1XC9A 2I8EA 3H4DA 1E6VB 1REVB 4OLOA 2HHVA 4ZOSA 3W8PA 1TL3A 2LA4A 3JYTA 1S9FA 1FKPA 3BS9A 4GVBA 2EFOA 1SIWB 2FD2A 3JTNA 1Z2ZA 2AV5A 4PQUA 4F4AA 4WYWA 3K17A 3TUJC 2AX0A 3DU5A 5D3GA 3UD3P 5JXSA 2NYIA 2VC0A 2ERRA 1UEUA 2PN6A 5CAAA 1J5EF 2LEPA 1FJCA 1SJFA 4QIWD 3TVYA 1O8BA 4CLPA 2BANA 1AROP 3T3FA 1XMOJ 2H1YA 4WFZA 2KXNB 2DISA 1HHTP 4Y2IA 2H5IB 2FJAB 3U1LA 2AJQA 1W7WA 3BREA 2GMHA 1U25A 3LA0A 4AYBD 2WB1D 2VICA 1FX4A 4JV5F 5THWA 3PHEA 3EUNA 3CDBA 3NY0A 3RGIA 2GNKA 3GU0A 4JI7F 3ISNC 2UV8G 4OIXA 6AT1B 3ADAC 3MOJB 3R9LA 4KYZA 2N4CA 1M1KT 5HVFA 3BGRB 4A8OA 3CJKB 3IXQA 1QVGR 1PAUB 2YX1A 3A3NB 4IG0B 4USJC 4FNHA 1LXJA 2LQ8A 4IDKB 4N56A 3EVMA 4E2FB 2BR0A 4OYPA 1NJXA 3PJ9A 1UTAA 4PYDA 2OPRA 3VTIA 1NSQA 3QZ7A 3AOAA 3NWRA 2D9PA 2Z58B 1FXRA 2OTJS 1FTRA 2J5AA 2ZBPA 3BKFA 4LREA 1YBTA 5KFTA 1JB0C 3I9V9 1Y5NB 2WBRA 4J37A 3RRHA 4WZMA 4CO3A 4LF7F 2B6AB 1REGX 4N8OA 1FK9B 1NDLA 1G6BA 3CJ4A 3KLEA 4ZP7A 3CD5A 1P6TA 1S7IA 4OX9J 5KT3A 5B0AA 3J80Y 3RBDA 2XHWA 3BYPA 4K59A 2HBRB 4X4TA 4KGXB 3J7YU 1U47A 3W2WB 4KKOB 4DG1A 2XB2D 2HG4A 1EP4B 1RTDB 3IGVA 2NSCA 4KAIA 4TQSA 3HSDA 1UAWA 1ZPWX 5LXRA 3QT7A 2EFQA 3M30B 1HBMA 2NXCA 3V6KA 1K47A 4IOAQ 1RTIB 2UU9J 4N47A 2J7WA 2E5LJ 2FZGB 2B3TB 5LJ3Y 4Y00A 4H4MA 3BSAA 4H4OB 2AMCB 3V6DA 3IWXA 1GXLA 1OSCA 5G0RB 2B8QA 1JKHA 1VQPS 2UUAF 4Q45A 4MKBA 5CA5A 1CJUA 1WKJA 3KLGB 1NZ8A 4RW8A 2YPZA 1FEHA 1RA6A 2DH8A 3ZFVA 1Y0HA 2HHHJ 1JXEA 2PFDA 3DRPA 3ZTRA 1VRUA 3U1NA 2NCKL 3H2VE 2W7PA 5KFFA 3VZHA 1TMJA 2V67A 1CULB 3S1TA 1O5JA 2RQ4A 2RDDA 2F40A 2NR0A 5IT9Y 1IM4A 3MM9A 3NGSA 3TVKA 3BKTA 5E3PA 1WTBA 1F9FA 4FYWB 1CJTA 1RT7B 4YDDB 4PXDA 5B0CA 2HNYA 5DS7A 2YPYA 3MMCA 1RABB 4K4WA 2NZ4A 4O4RA 3M6UA 2XC9A 2C2KB 4U96A 4O44A 4CLFA 3GFXA 1J5OB 3QNWB 1H6KX 1IBKF 3MHYA 4DV0F 1D8ZA 2AJ1A 1XR6A 1XNRF 1IKYA 2RE1A 2OTLS 4ZPTR 3SEOA 4LF5J 3ICLA 1WOOA 2OJ3A 2OMLA 3RYLA 3JSBA 1AZSA 2QFJA 1PC5A 3D66A 4OYAA 2PEHA 3HZEA 1R8AA 1Q78A 5DZ6A 2WAQD 5AT1B 5AE1A 2WVFA 1IQTA 3ET6B 3DMJB 3POTA 1LK7A 2VG6A 3HHLD 1VIXA 2W9BB 2FIUA 3EZ5A 5DG8A 1IQZA 4M5KA 4DX5A 4TYBA 3NOCA 2KXFA 4CI0B 1NZAA 4DR5J 4X66F 2KRRA 2Y1IA 1F1BB 4F3MA 5GMEA 2ZOFA 3HLUA 4K2JA 1RDRA 4KFBB 3BBBA 5EGYA 3V81B 1AA1B 4MIBA 4FYXB 4P9SA 2ZWPA 4UTGA 5L1KA 2RU3A 3OTEA 3FZBA 3IBWA 2CNKB 2C3PA 3M2RA 2VKZG 5F3ZA 3EICA 5HLFB 5HMWA 4BC9A 3T5LA 2OIHA 1X4EA 1YJUA 1F5CA 2NXNA 1HYSB 4ITSA 2QX0A 4HHJA 3UR0A 4CP5A 4RWWA 1QD1A 3KK2A 4NASA 4KGKA 1T94A 5EHHA 5U47A 3NGRA 3OFHA 1RT6B 4WK1A 1KOOA 1UMJA 4YHHF 2ZE2A 1Q0NA 4RBUA 3RAXA 3WX4A 3PCOB 4WFXA 3T6JA 5D4OA 2EBEA 2D3OR 3VCDA 2HRTA 3DU6A 2PEBA 2JHEA 3UW1A 1PYOB 2VQFF 2IPOB 3FUYA 5C25B 3HVTB 4PWDA 1M0SA 1P8GA 3MZIA 2XGPA 2JFKA 3PW0A 4TY8B 3MMAA 2HFVA 3BPSP 3NNAA 3F44A 4NLGA 4ECTA 2ADCA 1T11A 2VUGA 2L3MA 1YJNS 3D6FB 2AGQA 1JLBB 1N54B 3DRSA 4E98A 3PRDA 3D4JA 3AXKA 1ZOTA 5FLXY 4TLRA 4YFUA 3CCWA 3KUEA 3CDEA 1VRQC 1NK4A 4NEZA 1GXUA 3PJWA 1X4AA 4PXBA 1QAXA 5D0EA 2YKPA 5A8RB 5BYSA 3AA9A 2H54B 5B09A 2ALZA 3HCXA 1URNA 5KG3A 5KFQA 3KG0A 3WIUA 4WFYA 3I6PA 3FQLA 4CYUB 3U7JA 3I32A 3Q8PB 2RKIA 2XLJA 2HKEA 3MDFA 2ZDOA 1XNQF 3R5JB 4XTTA 4USHA 4PKDB 2OELA 3DLEB 3N5FA 2IFXA 4LF6F 5K9FA 5J1NA 4ZCIA 3JQKA 3FC9A 1LWCB 2W9CA 3WDOA 4LQ9A 2HQDA 3GG0A 3M8SA 2KFZA 4USUA 1X5PA 4RW9B 1N5YB 2VG5A 2J9DA 2KFYA 3IO1A 2BEFA 4ZK7M 1K73T 4UQGA 3CC4S 2VPZB 3DOLA 1H3DA 1EB0A 2UXCF 2F1FA 4RJVA 3DC2A 3VVUA 2R7SA 1RHRB 4ZIWA 5SZTA 4P2MA 3TQEA 3HKWA 4WWSA 4X2BA 2DBBA 4KH0B 4WFNQ 3N0VA 2IYIA 1UVMA 4DQQA 2E1RA 3MMJA 4PYAA 3MEDA 2GMJA 3KK1B 1NH7A 2DNYA 3LP1B 4Q0BA 4IFYA 3NLCA 3ILOA 4FXDA 2D9OA 2KB2A 1W25A 4G65A 3D68A 4LF7J 2R3VA 2MHNA 3DM2B 4WE1B 1TL7B 2AGOA 5K20B 1R0CB 1R0BG 3DLJA 1ZA1B 1Q8LA 3W60A 1WI8A 2MJNA 5IT0A 4OI1A 4QWAA 3Q8YA 2DNNA 5E3QA 3HPOA 1LKZA 3PYGA 4WU2A 5B7WA 1MMDA 3CCZA 2MKIA 2HWIA 5LSLA 1D9DA 1KLMB 1RCXB 1BWVA 4G1QA 1WSRA 2KVIA 2V2ZA 2YKMB 4LFCJ 3TZXA 1I1GA 3H5UA 4DR4F 1KHWA 1VJWA 3DLKB 3GYGA 4I69A 4M5JA 3RBEA 3NG8A 3W64A 1N33F 4EYIB 2E7WA 2KO1A 1WEYA 2FC8A 3P96A 5T7LB 1FJ7A 4KO0A 1JJ4A 3NEKA 3HVWA 4ES3A 2Z2MA 4CLLA 3D54A 1FD2A 3WC2A 1OQ6A 2ZEJA 3Q24A 2O3DA 2AJ4A 3KLFB 4L76A 3GYNA 4O4GA 1EAYC 4IO1A 2BM1A 2BRLA 1G2EA 1NMEB 2IRYA 4JYAF 1O6XA 3IR6B 3DXSX 3MAAA 4RBTA 1QUVA 3H40A 2HRUA 2G0CA 1FNMA 2H5EA 4OYBA 1JK9B 1KDNA 1C4CA 2GHPA 3M8WA 2YNGB 1IKWB 1TL5A 1XR7A 3R27A 2F8EX 3JSYA 1QDUB 4KGMA 2XLIA 1DTQB 3J7YI 3R7NB 3FCWA 4FKYA 4NMXA 2AEFA 2QC3A 4PUOA 2RMLA 5HK4A 2YNHA 1Y5IB 1YVFA 3M2VA 2QL7B 2N3OA 2J0WA 3R5AA 2D1CA 2W7OA 4ED7A 4FPRA 1RAFB 2C3OA 3U27A 2KVQE 2AP6A 5ETLA 1NJWA 1GAOA 2Q1LA 2Y3YA 4KGZB 4KHMA 3E01B 3GIJA 5B0GA 3OTOJ 2DNLA 1MWZA 4OI4A 5FDLA 5I3PA 4DFJA 1RHUB 3DI6B 4RW7A 1IBKJ 4DV6F 1YZ7A 4DV0J 1JLQB 1XNRJ 3ZZTA 3I0SA 3PIPQ 4KRWA 1W26A 1A0OB 1R3NA 2HGMA 3V2UC 5ETQA 2U1AA 3QGHA 4J9LA 4ICLB 5C5JA 2R42A 2CPJA 3V6JA 1XJWB 3CJTA 2CQ1A 3VAKA 2NREA 3UDEA 1PIEA 3B8HA 1WI6A 4HI2A 2RS2A 1MN7A 4B3MF 2GS8A 1TR0A 1M5HA 5LXYA 3LTOA 5KFDA 2WK4A 1SIZA 2XY7A 5KT4A 3M9NB 1EKSA 3CMQA 4LBIA 1QM9A 2MEWA 1WHWA 2JDJA 2LCWA 3UDVA 4LQ3A 2A10A 1HI8A 1HW9A 3J80U 4EU0A 3GWCA 4F04B 1VQNS 4CO5A 2O5DA 1RCOB 2I0XA 1PJ7A 3VVTA 4DX7A 4YEAA 2XYHB 2V2QA 2VD3A 2F7VA 2EKNA 2G0JA 1ZAWA 3OFFA 1U1NA 3SCKE 5J2PA 4WBFA 4QIGA 5BYRA 3N79A 3Q2TC 3AB4B 4MKYA 2HQIA 2O1PA 3UD5A 3M05A 4QBUA 1XEZA 1SKWA 3LWMA 2OPPA 3OTCA 2DGQA 1OO0B 1DLOA 2Z4PA 3FDSA 2IYGA 2NPIA 1HQUA 5A6WA 1F3VA 2BKOA 2K3KA 4ZLJA 2VODA 2BV3A 2H51B 3W9IA 4YHHJ 1W2BR 4OJGA 2IM0A 2HW3A 3OFEA 1RYSA 5GADU 4K2XA 4TVAB 1KONA 3OL6A 1IKXA 1F5BA 1D3WA 4QPXA 2PC6A 1B3TA 3OR2A 2UVUA 2VQFJ 5DLFA 3GR1A 1UEVA 3QT6A 4IH6A 2DGTA 1F60B 4F2RA 2HZVA 3MOZA 1YZ6A 1TAUA 4QPTA 1NK8A 1TL3B 3JYTB 1FKPB 5IT9U 3TAMB 4GVBB 4PQUB 4OZNA 1NPRA 1F9HA 2ZUGA 3CJRA 5F8HA 2ACYA 3FBCA 2R8GA 3PDNA 1JLGA 1KHVA 3OR1A 1CJVA 1T7PA 3ZZYA 2BANB 1GT8A 1ICEB 1QLNA 2CWXA 2BUNA 4UQTA 3KOAA 1RT2A 2Z57B 2QA4S 1NNDA 3D0HE 1YIJS 4DN9A 1VJQA 1RT4A 2E1CA 1PCAA 2ZM6J 4DPTA 3BEGB 3MCOA 3IMQJ 4ED4A 4CTAA 4RNMA 2XGQA 2DRDA 4P71A 3N5BA 5J1EA 4C8LA 5E3AA 3KG4A 5K14A 3AB2B 4DV7F 4NZ0A 2VPYB 3K59A 2HGLA 2GAGC 4ENOA 4ERDA 1C1CA 1IBMJ 3OW2R 2ZBCA 4ES1A 4ED2A 2K06A 3CTRA 2QE5A 1OYEA 4FYVB 2GIFA 4B17A 4F26A 4J5OA 5EWEA 5D77A 1ACMB 1HNVB 3HFZB 4CM0A 4NCBA 1QAYA 4ANCA 3HD1A 1PG5B 4HH0A 3VZIA 2XZDB 3IWNC 1IBLF 2E5HA 3MR3A 2IM1A 1S1TA 2BJDA 4ZP9A 1VFJA 1B70B 4JI5F 4Z37A 1L3KA 1S5ZA 4OYZA 4K5RA 2ZOMA 3FCHA 1UCNA 2V34A 5FD1A 2ZD1A 1WF0A 5C2CA 3CCMS 1HWJA 3KLEB 1DTTA 4AL5A 2XG8A 1VC0A 4TN2A 2FGCA 2ZKUA 3CB4A 2DXEA 4OHZA 2JEIA 3B54A 4DG1B 1VQKS 4LRAA 3JAMY 4DSLA 2EFGA 3R7SB 4DCPB 3KDNA 1HBMB 5KFCA 3HJVA 1RTHB 3CUNA 3I5CA 4L73A 1CSJA 4Q8FA 2HHWA 4LF4J 2MKHA 1LW2A 3QGIA 4KHPF 4DV3F 4EO8A 4C0HA 4O0IA 3FBBA 4H4MB 4NI2A 2E44A 4USWA 4DUYF 1N0VC 1HMVA 1WG5A 3EVOA 1SV5A 4IOCQ 3T19A 4D3GA 3IM8A 3V6DB 3TR5A 1TKZA 1TKDA 1JKHB 2QYCA 3PW5A 3UD4P 1R8PA 1EETA 3THTA 2RILA 1N33J 3CPWR 1A7GE 4CLSA 1HKAA 4DR3F 4I68A 5FLXU 3PACA 2RRNA 2DR7A 2RD5C 3T5KA 3MURP 5I42B 3DRPB 5L1IA 2AYMA 3MPYA 3RB0A 1JLFA 2COLA 4J9PA 4YQWA 1G7CB 2IRUA 1T05A 1YTYA 2XQCA 1Q7LB 2P5VA 4JYAJ 1NSPA 3QT5A 3H2UB 3D1QA 4JI8F 5ITHA 1S4EA 3CMES 5IC6B 1KFDA 3T1YJ 4AXIA 2JVRA 2AIRB 4CLYA 2LQJA 5JUMA 3NWGA 3R3TA 5DDQC 3M6XA 3RZAA 4M5MA 5IXUA 4DF8A 1CJTB 5GAGI 2I38A 2HNYB 2YKNA 1CC8A 3PRVA 1XIQA 4P75A 1T3NA 2GVZA 4NLSA 2V68A 2RJZA 3MMCB 2FVSA 2JLFA 4J9QA 3BB5A 3DOKA 2W1BA 4LVOP 4GKJF 2JZ5A 4DR1F 1IKYB 4DSJA 3HO1A 1FD8A 1X9SA 4C0BA 2ZVIA 2MJUA 1BUXA 1RAEB 4HACA 1SPBP 1AZSB 5T41A 3SMZA 2K8GA 1HPZA 2HHUA 1ZM9A 2CQGA 4DV4F 3PO4A 5C24B 2KKHA 3EDRB 3VAFA 2QLWA 1AUDA 2ZFHA 5ETTA 3BH6B 3DYAB 3D3BJ 4NA3A 4OYXA 2VG6B 3L95X 1ZS6A 1LFPA 5KFBA 3LF0A 4IRDA 1M5OC 4K0KF 2FPHX 3W9JA 4UY85 4PCQA 8RUCA 1X4HA 3MTKA 3TO8A 4EI2A 2GQ2A 3KNAA 3NOGA 5B08A 1V9OA 2QLBB 4S0MA 5A8KB 5E7OB 3O6QA 4WKYA 3BSOA 2PO4A 4NLQA 1Q8BA 1C1BA 2W8KA 2DNMA 2MKKA 4DR7F 3Q86A 1BWEA 5ETPA 1BQMA 3HSZA 4ID5A 1JWWA 3E51A 2GZOA 4H4KC 4ER8A 3TRGA 1UJ5A 4QWEA 3M2RB 1NHVA 1FJGF 3TVZA 1TFYA 5EDWA 3MR7A 3CDWA 1PBAA 3T5JA 5A8WA 5GMDA 2YNFB 1MROB 1JJCB 3BBFA 1TTHB 3FSIA 4R5PA 2C2ZB 2DIVA 3MWBA 1YHQS 3AD8C 1WHYA 2VBZA 1MMNA 1BLUA 2AGPA 1KTQA 1FVQA 3WZ0A 4QOTA 3EXYA 1RKIA 4L6V3 2IM2A 1C2PA 2ZVSA 3FKBA 2VQEJ 1E6VA 4V19J 2A2DA 4M1KA 3JQJA 1CG2A 2G13A 2CQHA 1Y10A 2P9CA 1SQFA 4RU9A 5JJBA 4RWXA 4PWDB 2DCUB 5F3TA 5DJBA 1O0PA 1VK8A 4KBIA 1S9GA 2K1RB 1WJ9A 1GTEA 1N5SA 1P9QC 2VDIA 2DITA 1AUSL 3TA1A 2LMIA 3SSQA 1WF2A 2LXFA 3PJXA 2Y1LB 2B56A 2F4VF 3IRXA 4CNZA 1NCLA 3DRSB 4E0DA 4NYOA 1XMQJ 3T1AA 3OXGA 3N6MA 3NAHA 1Q95G 4LR8A 4Y2MA 2ILYA 3D2WA 2J0SD 2LQ5A 4JV0A 3AOCA 2KYZA 2HHTA 1VBKA 3MFHA 3D5MA 2VF3A 4XPEA 2HFZA 4X4VA 3NGUA 1F9EB 2SXLA 3WX8A 2FY8A 4NLTA 4WK3A 3Q8RB 4JV1A 2RKIB 4ILRA 5D4NA 2UUBJ 4YS2A 4GO7X 1V5IB 3BGRA 3CJKA 1S6PA 2H4WB 3DCAA 1NHKL 5GAHU 3NL0A 1B7YB 2XMAA 3KFWX 4PQAA 1SH3A 2XWXA 3VR1A 3EM1A 4USVA 5DDPC 5IWAJ 3BGOP 3GIMA 1EARA 1JXLA 3HHKA 3NGTA 1FRJA 3V4IA 4EZ9A 4CO1A 4LR9A 2ZJQQ 2H65B 4FS1A 1IUJA 2MKCA 2CQDA 1EIYB 4LRFA 4DV7J 2XNQA 3ZTSA 2VG5B 3PW2A 1S6OA 4LSZB 2KI2A 3CIMA 1TL1B 2E9ZA 3KHGA 1LQ9A 3DOLB 2P9GA 4HH1A 3ELHA 4MJKA 2UV8A 1FK9A 3TAQA 2MQMA 3NS7B 2QFIA 4RL1A 3D0IE 4B9UA 1U1MA 4DPWA 3HSGA 1U2CA 3MEDB 1XBWA 1TZ0A 1BMQB 1N6QA 3LPYA 4Q0BB 1FRMA 3HZGA 4KKOA 4IFYB 4OMFG 1HL6A 3CCJS 1VBXA 4DUTA 4JI5J 3I82A 4FNIA 1D0EA 4W90B 5AXNA 5KAKA 4ED0A 1BXNA 2CUYA 2C2RA 5KFYA 3MM7A 1U0HB 2WBMA 1TFWA 1RWKB 2VL1A 1QSLA 1F5AA 2AEJA 2OPQA 1RWMB 4ZVHA 1YBAA 2GO8A 3UVJB 1TKTA 2WONA 2F63A 3I5BA 1H2UX 2YWWA 1IJEB 1S1WA 1UP1A 2UVRA 3MM6B 4DF4A 3DLGA 3C15A 1VBZA 4KHPJ 1R8CA 1NUEA 3NNCA 5HQMA 4DUYJ 4QWCA 1NK6A 2DNQA 1O51A 2CVIA 3LO3A 2E5JA 2W2PP 2HS3A 1CULA 4A8FA 2FTRA 3ETMA 4C8NA 2MKYA 2L9DA 3MFIA 3CCQS 4O4GB 1J27A 2JSXA 1MLAA 4LF1A 3GB0A 3MAAB 3TYTA 5KFNA 2RNEA 3OPKA 4CDIA 4K4TA 2M8HA 4ZS6A 2DHAA 1J5OA 3L3CA 3GCXP 4JI8J 3H59A 4BHQA 5KG0A 3FNNA 1UWAA 2WTFA 2QA1A 3JSMA 1FRIA 3AHPA 4DMZA 2ZKTA 3QSYB 2HQCA 3MPVA 4ZVFA 3RU0A 3O5TB 3M2VB 2CDQA 2HWHA 2XCPA 2HS0A 4HTIA 5KFUA 3A13A 3BDPA 3K8VA 5DZ7A 2J8AA 2E5GA 4KV8A 4NA1A 4KGVB 2JLEA 1YRUA 3DMJA 5FDLB 3E8OA 1NDPA 5A6PA 4JI0F 2W9BA 2LVWA 3AA8A 1NO8A 4DR1J 1YSJA 3I0SB 3X1LB 2J6SA 3G86A 3FZ2A 3BGFA 3RR8A 2A0FB 4I6WA 1VHIA 3W66A 3HSJA 2DY1A 2DD8S 4XAKA 5HP1A 4DV4J 4J91A 4ZMMA 1HBUA 4RUAA 2XYPB 2DNHA 4KFBA 3TANA 3DGVA 3V81A 4I67A 1S48A 4M5GA 2DVIA 4CCHA 4IH7A 2XZWA 2R7VA 3DRRA 2UUCF 2BXJA 1AFJA 4F2SA 5C7PA 2BW2A 1SKSA 1YLXA 3AD7C 4K0KJ 4BCAA 4RUHA 4BLGA 2ZH7A 4TU8A 1LWFB 5K5MA 1TK5A 4DL6A 4DI6A 4F0HA 1BQNA 2HMIA 5DRKA 1KQFB 5AXKA 2MQPA 1RB0A 4DV2J 1IKVA 3ZZPA 3JAMU 1DARA 1VOMA 2W25A 3RB3A 2D69A 4F0MA 4DR7J 3NKYA 5J2PB 2N7CA 3KLIA 2YY3A 4BBYA 1WC1A 5IT4A 1ZPVA 2D3UA 2AZ1A 2OPPB 3HVTA 3M32A 2QMXA 2HIQA 1DLOB 3V5RA 3BV8A 1V3SA 4HEA9 4ECXA 1WWHA 5ETMA 2IVMA 4DSKA 1HQUB 4CLTA 2APOA 4PG5A 1L5UA 1WHVA 4HDHA 3VGSA 2IBKA 4F4YA 2J6TA 3GJTB 1JLBA 1SQEA 1Y5LB 1I51B 3O8WA 1NJZA 1VC6A 4JI3J 1U02A 1KFSA 3PKYA 2RDJA 2F65A 1KD1T 5H9EK 5FIIA 3OR2B 2EW9A 4G6VB 3GPAA 4HVZA 2CFXA 1XMOF 3DLHA 2GCFA 3NCPA 5A8RA 1FE4A 1EQ0A 2LDYA 3OSPA 5HSPA 1RAHB 1HNZF 3IBCB 2HLTA 3H0PA 4RX6A 3Q83A 1S59A 3P8BB 4CYUA 2QSFA 5CHCB 4IYQA 1OYDA 2F4VJ 2IVYA 2XMTA 1RKJA 2MSTA 4P2SA 2J9EA 4EFAC 4P73A 4RLEA 4B9LA 3CGIA 3OR1B 3G87A 4I64A 1CJVB 2EEYA 4L72B 3AOBA 4OJ3A 3DLEA 3H8YA 4DL0C 2VA2A 1V6HA 1FWPA 1RT2B 3SCIE 4R8UB 3NBPA 4ZHRB 1N34F 3LUYA 1N56A 5KT6A 3QRQA 2MB0B 2W4PA 1RT4B 2AZ3A 4HT7A 5KFEA 3K0JA 4WIQA 4KC5A 3VGVA 5J1EB 3MTJA 5AE2A 5I3QA 5RUBA 4O3RA 2AYEA 4DHVA 5GAEI 1NK5A 2PA3A 5K14B 1U1KA 1HNXF 2J9DE 1WEZA 4GC7A 3C2PA 3MM8A 1XN9A 3A4TA 2WZ1A 2OSRA 1C1CB 3L9ZA 4MFBB 2E1PA 1WTFA 5M2PA 1WORA 1GQEA 3LP1A 3TNVA 4DV5F 1NJIT 5D0RA 4U7CA 3UN5A 4C3MA 4OX9F 3FRZA 4TQRA 2FVCA 3K58A 3PEHA 4Q44A 2LQBA 2AJFE 3IG1B 2L48A 4PWUA 4WFAQ 3SV4A 1M1GA 2RHQB 2ZJPQ 4C8KA 3Q2SC 3J7AN 1TL7A 1UVKA 4R0EA 1SJRA 2VBYA 2ZNZA 1UW4A 1YBUA 2FLNA 4OZ3A 2HURA 3ITHB 1SC4B 2ZD1B 4UOFA 4N77A 2UU9F 4X4SA 3GFHA 3L09A 4B9MA 3M1VA 1TQLA 1DTTB 1KLMA 4YUDA 1U6ZA 2XO7A 1S1XA 3KKFA 1OPIA 5GAHI 1WEXA 2XHCA 1FDAA 3OFGA 2IC3A 3RW7A 2LP4A 2EBGA 1BD6A 4X64J 4M5HA 3VAMA 1FX2A 3EVWA 4U8YA 4YR0A 3G9CA 2OMOA 2YKOA 5H9EJ 2HHHF 1PYSB 1N4LA 2ROEA 1LW2B 1NPPA 4WP3A 1HNWJ 2KJVA 5BR8F 3FEXB 3KLFA 4NI2B 1U6FA 3DFEA 1SV5B 1JX4A 3MPWA 3SBMA 2ASJA 1SCJB 2MKJA 4RUCA 3CJ5A 2EK1A 2QT7A 2FLPA 4LF9J 3R5GA 4BWJA 1Q7YT 2YNGA 4KPCA 3PM9A 5KFSA 5L38A 4UZBA 1RAOA 2Q66A 2VIHA 3G8TA 1G1XA 1RP5A 5M2UA 2B51A 2IJNA 3S6EA 1SI9A 1LV5A 2YWEA 2ZBIA 2D3ZA 2CAJA 2KM8B 3MF5A 1JLFB 4DL4A 4FXWA 1R43A 4OI2A 1N5VA 2R7TA 4TXSA 1B0PA 2UVWA 2E1AA 4UZCA 1KC8T 3IBFB 3UI3A 4M5DB 3E01A 2V2VA 3VALA 3TARA 1OPZA 2P2CB 3BO3A 3ZTPA 3SQGB 2YKNB 3DI6A 5J2MA 5LMNF 1KQKA 3VAIA 2BE9B 4ZPWR 2C2MB 4PR6A 2LEAA 4M5NA 1X9WA 2RHSB 4PABA 4DZ6A 3DOKB 3KYLA 1NDCA 2FHJD 2WVCA 3KNGA 3PKMA 4W98A 1S49A 3FFIA 4DR5F 2RSQA 1QAIA 4NXNF 5GVQA 5CABA 1UVNA 4HACB 2BBEA 3EPIA 2L9NA 2J0XA 4B3OA 2NXJA 3P5TL 5GMKa 4Z7YA 4I2PA 3GONA 1M5PC 3OBIA 2V50A 3CCTA 3B78A 5LM7E 4X4OA 3IA0A 1S0MA 4UOCA 2OD4A 1S6UA 4ED1A 3VWSA 1FCAA 2ZJRQ 4QWBA 3KG1A 2MQNA 1RA7A 1HBOB 2Y0SD 3PYFA 2QLJB 3AT1B 4KQZA 2UUCJ 3SYZA 1F6TA 1WKKA 2HNDA 2DR8A 1TUVA 5E41A 1PO6A 1SXLA 2HAIA 4FS2A 1HQEB 1KRPA 3G6XA 2BRKA 1C1BB 1ULRA 1BQMB 2IHR1 2PI5A 2R8JA 2I5JA 5KOXA 2G2OA 3MUMP 2WSEC 2W2MP 3RJMB 2MQQA 2ZH3A 4IFVA 2FY1A 4JB8B 3QGGA 4RR5A 1FRKA 3R2DJ 1WOSA 4R5PB 4URQU 1T02A 1YJ9S 1Z4UA 4P7TA 3IRWP 5LMUF 3I56S 2VKRA 1DQ9A 2OGUA 2A1BA 3PG9A 4XPCA 3GQCA 3A8EA 2V94A 2VFVA 4OX8A 3QSIA 4YB5A 4UOHA 3FBEA 1TL4A 3G6ES 3AAWB 4UOGA 4NLYA 3TAMA 2B5JA 3ENAA 2CZVC 1RBLA 5L1LA 4HI1A 1S9GB 3A3OB 4KTQA 3IN5A 5DM6Q 3GFZA 2CDRB 2P8IA 1RBAA 3IRXB 3OT9A 2CJQA 1FRHA 4K8RA 4KE5A 3JQMA 1TVRA 1HNZJ 1RLDA 2JOQA 1XERA 5IV3A 3QJJA 4YN3B 1WC3A 1S1VB 3VHQA 1WF1A 2FJBB 2HFOA 2XBPA 3M8QA 3HULA 2K2PA 1WDDA 4G1IA 1WKLA 5MAOA 3BN7A 3LW5C 2X1GA 2FHOB 4WJBA 1AT1B 4L75A 2KM8C 4B9SA 3PVXA 3ZC4A 1HARA 1FESA 1U48A 1S6PB 1N34J 3DLLQ 4KJIA 4J7CA 2GQQA 3WC0A 3BJYA 1J2VA 2HSEB 4JOUA 2ZH8A 4G3IA 4P10A 1S97A 4H4KA 1NSKL 1QTMA 5KFAA 1HNVA 3OQ2A 3DGPA 2EFPA 2A2CA 2NSBA 3V4IB 1NK9A 1DURA 1ZTTA 4WCEQ 3GG1A 1HNXJ 4TLQA 2X1AA 2F9JA 4F4XA 2CXEA 2V69A 5D4LA 3MPDA 5B0DA 4USIA 2B7BB 4K4UA 2DH7A 3DN9A 3HVAA 1CJKA 5CCLA 3C6TB 3TEGA 4DV5J 5H9FK 3K5OA 2UVVA 1RWPB 1JNZB 2E9RX 5HL7Q 3EE3A 4A4JA 1H98A 2HVEA 4JI4J 1WC5A 3TEHB 3J7ZT 2D74B 1S7HA 1N6QB 5SUHA 3H2LA 2DGWA 1VR6A 3M8YA 2ZHOA 4NLUA 4LFCF 3DHXA 2C2OB 2Z2YB 1RTHA 4FF1A 3JB9k 4DOZA 3EXCX 2XMJA 4D3HA 2LECA 1K8AT 2DNGA 3MM7B 1T9XA 1I6JA 1U7LA 4NLOA 1Z1ZA 2VJUA 3CJ2A 3GJSB 1EKRA 4OHXA 3M6VA 4W4MA 1T9UA 1H2TZ 1KKHA 2OPQB 1OWXA 4X84A 2DNZA 2Z0GA 1TKTB 3T1HJ 3T9NA 2WONB 4X4PA 2YKAA 5HMYA 5AJ3J 2LEBA 1SJ3P 1ZETA 1S1WB 4NZ7A 2AYBA 5I42A 3D6TB 2VH7A 2DTJA 4Z7CA 3DLGB 3R6GB 3C15B 4CNYA 3CJ3A 3GR0A 2WCXA 5BR8J 3MEGB 2VFSA 4J9OA 3TX0A 2AEMA 2G0IA 4LIWA 4OZLA 4Y2AA 4B9VA 4CLUA 5DDOC 3IR5B 2ASYA 3MD3A 1S9EB 4CQ1A 5AE3A 1TKXA 1PSDA 4CLWA 2PIIA 1P9YA 5CD4A 4J90A 1EZZB 5HJYA 2V8GA 3DRYA 1GNKA 1YJTA 1FT8A 2MLZA 2J8SA 2MDAA 3FEYB 3ZNJ1 4IO9Q 3UN3A 4OLPA 1PGZA 4ZPAA 3QATA 2DKOB 3MXHP 3BM7A 4GVLA 5A2QY 2KT2A 3BQ2A 5D0GA 4PXEA 2B9WA 5FJ4A 4M94A 2LXUA 2LKZA 4PG7A 3OTOF 1ZTWA 2K7JA 1TP7A 2VBXA 3RB6A 1GH8A 4NCGB 4LUBA 1UA0A 2CQ4A 1X5SA 3JSMB 1FERA 2PT0A 4U95A 4KSEB 5CYMA 3HF5A 3ENQA 1X9MA 2OD6A 4C7QA 5LMNJ 1YJVA 2MQLA 5C24A 3GV7B 4KV8B 2YNIA 1Q79A 2FZCB 2FUG9 3DYAA 2M9KA 3OVBA 5IQQA
chains in the Genus database with same CATH topology
4ZVEA 3OJUA 3DYAB 2R7QA 1VQ7S 3T6BA 5H9FJ 2LA6A 2QIFA 5AXMA 4NA3A 5DGAA 2FJDB 3E3XA 2VG6B 3L95X 2BVZA 1LFPA 3R1HA 2M3DA 1C4AA 2MXYA 5KFBA 1VQYA 4C8YA 4Q5VA 3G8SA 1JNRB 3LF0A 4IRDA 3BSNA 1M5OC 4FN5A 1NH8A 2M7SA 1S79A 2N7YA 4K0KF 5CZVA 1K9MT 3LANA 3B4DA 2FPHX 2KH9A 4UY85 1CQMA 1BY9A 4PCQA 2N3LA 2QSWA 5HP1B 1X4HA 1DZ5A 2XI3A 5A8KA 2CQ0A 2M5YA 3MTKA 1T03A 1OIAA 2RF2A 3TO8A 4E8UA 4OL8A 3K5NA 3PX4A 2C2EA 1HBUB 2GQ2A 1X4DA 1HBNA 4YB7A 2DGXA 3KNAA 6FD1A 5B08A 1V9OA 2AX1A 3NP5A 3SFGA 2BZ2A 5A8KB 4NCAA 5E7OB 2IA0A 1VQ6S 2RF2B 3MUTP 1U6BA 3MR2A 3C46A 4C3KA 3M4XA 3O6QA 1HBNB 3OXFA 3THPA 4OV1A 1QJHA 4F3QA 3KLHA 4DSEA 4WKYA 1TAQA 5KFXA 3DRRB 3BSOA 1HW8A 3G6VA 1QE1A 2PO4A 4IH5A 4NLQA 1Q8BA 4EUVA 1C1BA 2W8KA 2DNMA 1XMBA 2FVQA 2MKKA 4DR7F 3N4WA 2KZMA 1BWEA 2P9EA 1ZM4A 1BQMA 2D41A 4ID5A 4TU7A 4HLBA 1JWWA 2R9LA 1HWUA 2GMLA 2XI2A 4DN0A 2CPDA 2C3MA 2B43A 2FGOA 2JL9A 4ED6A 2J0QD 1HA1A 1HWIA 3G4SS 1N88A 3E51A 2VFTA 4WXOA 4H4KC 3GE9A 3GV5B 5DG7A 2EWHA 1UJ5A 1RQ0A 3TRGA 4MMOA 4QWEA 5CQGA 2OKQA 3W2VA 2NQPA 4ID5B 4ED3A 3M2RB 1NHVA 3M9OB 2DJWA 2YNFA 1MROA 3JTPA 1TK8A 1FJGF 3QWUA 3B4MA 3L7PA 5ADZA 1BQNB 3TVZA 2HPUA 2HHSA 2HMIB 1TFYA 2ZNYA 5EDWA 3CDWA 3T5JA 1WG4A 2EFVA 5A8WA 1NKBA 4WKRA 3W2VB 2GW8A 2YNFB 1IKVB 1MROB 3TA0A 5HROB 3FSIA 4R5PA 2XULA 1JIHA 1DQ8A 4Y2CA 2IVFB 4JUZA 4KHRA 2DIVA 5A8WB 4A8SA 1SL1A 4FF4A 7FD1A 3CD7A 3MWBA 1YHQS 4A8MP 1X4FA 4NZ6A 2NXUA 4LIRA 4AL7A 4A8YA 4N8NA 1WHYA 2VBZA 1QSSA 1MMNA 1BLUA 2ZC4A 2AGPA 2GO9A 1KTQA 2DPJA 3MD1A 1S0NA 5KFLA 3MGJA 1FVQA 1U8SA 3KLIB 3WZ0A 4QOTA 3PW4A 2WSCC 3EXYA 3MEEA 1RKIA 4L6V3 2XS2A 2IM2A 2I1RA 1C2PA 2ZVSA 3UCGA 1N48A 3E2EA 1VBYA 1E6VA 4V19J 2A2DA 3CCVS 4C0OC 2W7AA 2AF6A 2XMKA 4M1KA 1APSA 4OX6A 3FJ2A 3H5YA 2YVSA 1CG2A 3A1YG 4HTJA 3MEEB 2MZRA 1XC9A 2G13A 2CQHA 2GGPA 2I8EA 3M32B 2B9YA 3H4DA 1E6VB 2ZH9A 4UY8T 4CH7A 1REVB 1G3OA 3IR7B 2P9CA 3QWPA 4O3OA 2YWFA 4OLOA 4RU9A 3DNCA 4JBCA 3N01A 5JJBA 2HHVA 2ASLA 1VRTA 3QAUA 5CH7B 2OSQA 4ZOSA 2K1RA 1TL3A 4RWXA 2GGPB 3HFKA 4K4ZA 2LA4A 3JYTA 1S9FA 1FKPA 3RB4A 3BS9A 2DCUB 2JWNA 3PXGa 4PWDB 5F3TA 5DJBA 1S1UA 1O0PA 1VK8A 2EFOA 1H7XA 1SIWB 2NUUG 4KBIA 2FD2A 3JTNA 3KK3A 1Z2ZA 2AV5A 2FHJA 4PQUA 3SV3A 3QO9B 4XK8C 4WYWA 4Q2MA 1S9GA 2K1RB 3TUJC 2AX0A 3OL9A 1GTEA 4BS2A 4U6PA 3G6YA 4RNNA 1N5SA 1S1UB 1P9QC 3DU5A 2R2UA 5D3GA 3UD3P 3D28A 2FJWA 5JXSA 2ZH4A 2DITA 3TA1A 2NYIA 4ELVA 3ZZRA 5I3UA 2LMIA 2VC0A 1RYRA 2ERRA 1UEUA 3SSQA 1WF2A 2LXFA 3KTQA 2DIUA 2PN6A 2Y1JA 3PJXA 2F4VF 2B56A 3IRXA 4CNZA 4AXJA 4X4RA 3DRSB 5D4PA 3GILA 3KHRA 1J5EF 4E0DA 3H5XA 3NNHA 1FRLA 2LEPA 1SJFA 5D3GB 1FJCA 4NYOA 4QIWD 3T1AA 1FXLA 4OJ1A 3OXGA 3N6MA 3QPIA 4PXCA 3NAHA 3K5PA 5CYQA 3TVYA 1O8BA 4C2MA 4LJMA 4K5SA 2BANA 5IS2A 4BWMA 1AROP 4OQJA 4Y2MA 2BABA 3T3FA 2ILYA 3D2WA 2DGOA 2HRYA 3PO5A 4WFZA 1RT3A 2KXNB 3C6UA 2DISA 1HHTP 2J0SD 1R8BA 4Y2IA 2V2KA 2LQ5A 3KJVB 3CDAA 5IZHA 4JV0A 2FJAB 1Y9OA 3U1LA 2AJQA 4YY3F 2KYZA 2AQ4A 2HHTA 2RB7A 2DNRA 3BREA 1DJ0A 3MFHA 4OJHA 2CQCA 2LQ9A 3D5MA 1I94F 2GMHA 1M5SA 1U25A 4XPEA 4RW4A 2L9WA 4AYBD 1W2IA 2JRSA 2WB1D 2ZM6F 2HFZA 4X4VA 5I4MA 2CQ2A 4JV5F 3MUVP 4NRTA 2SXLA 5THWA 2CPIA 2DH9A 3PHEA 1NEEA 2KT3A 3EUNA 3AY0A 3LP2A 2X1BA 4J9MA 3P6YC 3CDBA 4C8OA 1WACA 4NLTA 4YB1P 4WK3A 4B3SF 5LJ5Y 3Q8RB 4JV1A 2GNKA 3HKZD 2RT3A 4U7UK 2HVHA 1JLAA 2V5HG 4OZ1A 1ROFA 2RKIB 3PIOQ 4Y34A 4ILRA 4JI7F 5D4NA 4GO7X 3ISNC 2UV8G 4OIXA 3PFEA 3BGRA 3MOJB 2N4CA 3CJKA 4ELUA 2HVZA 1M1KT 1S6PA 3CCUS 3DCAA 5GAHU 3NL0A 3KFWX 4PQAA 3BGRB 1SH3A 2KU7A 2ZH5A 1Y00A 2XWXA 3VR1A 4ECYA 4A8OA 3CJKB 3NBPB 1IBMF 3N9UC 3GIIA 2UP1A 4ECUA 3UCUP 3IXQA 4NMLA 3RW6A 1QVGR 5DDPC 1R0AA 4M8LA 2YX1A 1C0UB 4IG0B 3IGNA 4USJC 2QZ8A 4FNHA 1LXJA 4MYTA 5KFGA 1L3SA 3GIMA 1JXLA 5KFVA 4J9RA 3HHKA 2CPHA 4IDKB 4N56A 4BC7A 1VQSA 1R0AB 2G1DA 1FRJA 3V4IA 3NMAA 2BR0A 3DOMA 4EZ9A 2HS4A 4CO1A 2ZJQQ 1FDDA 1ZM3A 3NAIA 2YTCA 4FS1A 1NJXA 4Q8EA 1IUJA 3F56A 1MSWD 2MKCA 2F8MA 3T9ZA 2CQDA 2LXIA 2PMHA 2OPRA 1TL1A 3PY8A 3VTIA 2DGVA 4NYZA 1D1UA 1V3RA 2XNQA 3QZ7A 2VG5B 2XNRA 4NX9A 3PW2A 4Y28C 2D9PA 1S6OA 3JTOA 3G71S 1FXRA 2KI2A 3CIMA 4F50A 5CD4H 2OTJS 3BQ0A 1FTRA 2J5AA 3CF5Q 4CT9A 2OPRB 1TL1B 2E9ZA 3KHGA 1SJ4P 5KFTA 1LQ9A 1JB0C 3DOLB 3I9V9 3CULA 3QAEA 1FA0A 4DL2A 2Q6BA 2P9GA 3MM8B 4HH1A 1ZZFA 1Y5NB 4MJKA 2UV8A 1FK9A 2WBRA 4J37A 3TAQA 2MQMA 3CT9A 4FXVA 4QJVA 2I9SA 3LP0B 1LXNA 3RRHA 4CO3A 4ECSA 4LF7F 4WZMA 2B6AB 1RI7A 3D0IE 2MZSA 3O2IA 2WB4A 2JC0A 4MKAA 2RRBA 1M5VC 4N8OA 6FDRA 1FK9B 4B9UA 1U1MA 2V4JB 4B9NA 2KXHA 1VS3A 4FVMA 1G6BA 3CJ4A 3UCZP 2DNPA 1U49A 2M2BA 3KLEA 4ZP7A 4URSA 3CD5A 4JI4F 2B7CB 1P6TA 3MEDB 4DSIA 1XBWA 1TZ0A 5B0AA 5KT3A 3J80Y 2CPEA 3RBDA 5K8NA 3OHBA 2XHWA 5J2QA 1N6QA 3LPYA 4Q0BB 1FRMA 4K59A 3HZGA 1SUQB 4IFYB 4KKOA 1KVJA 4X4TA 5E3CA 4OMFG 3RR7A 3FSYA 4F67A 1HL6A 3J7YU 4WU3A 3CCJS 1U47A