1HEDA

Structural consequences of hydrophilic amino-acid substitutions in the hydrophobic pocket of human carbonic anhydrase ii
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
255
structure length
255
Chain Sequence
WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSATTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of hydrophilic amino acid substitutions in the hydrophobic pocket of human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase(oxo-acid)
molecule keywords CARBONIC ANHYDRASE II
total genus 75
structure length 255
sequence length 255
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1992-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1hedA00
1UGBA 1G1DA 3EFTA 5JGSB 2Q38A 5SZ2A 1YO0A 5DSKA 2IT4A 5G03A 4PZHA 1BNTA 3K7KA 1TG3A 3RG3A 4MLXA 3S71B 3V2JA 3P44A 4YGNA 4Q78A 3T82A 2CA2A 4MDLA 1IF5A 3MDZA 4DZ7A 4WUPA 3ML5A 4QK1A 1IF7A 1CNGA 4Q0LA 3N4BA 5SZ0A 3RZ8A 2X7SA 1XEVA 2HOCA 4Q83A 3U45X 4QSBA 1FLJA 3MNIA 2NWYA 4DZ9A 3RYXB 1CRMA 3Q31A 3DC9A 1CANA 1YDBA 1HEAA 1ZFKA 3OYQA 3ZNCA 3IEOA 4Q09A 3S97A 4L5VA 3HKNA 2VVAX 4R5AA 3IGPA 1HECA 4YGFA 1TEUX 7CA2A 5IPZA 2FOQA 1CAZA 4R59A 1YDAA 1FSQA 1CAJA 1OKLA 5FL5A 1YO1A 2FOVA 2W2JA 3M1JA 4RUXA 3S73B 1RZBA 4YXOA 1Z9YA 1AZMA 1G46A 2POVA 3KNEA 3IAIA 2WEHA 1CAYA 1KOPA 4Q49A 1BN3A 5FLOA 4HF3A 3V3IB 4LU3A 3OIMA 1G4OA 2FNNA 5FNJA 5BRUA 4HEYA 4QEFA 1CVFA 5EKMA 4KUYA 4L5WA 3GZ0A 2WEGA 4COQA 1TEQX 4Z0QA 3T85A 3OYSA 3BL0A 4YGLA 1CNCA 5FNLA 3B4FA 3KS3A 3M1QA 5FNGA 3DVBA 5FNMA 5CA2A 1CVHA 3C7PA 3V2MA 3IBIA 3DCSA 3DC3A 3RYJB 4RIUA 3CAJA 3NI5A 5DSMA 1TH9A 2HFWA 5LMDA 2QP6A 5EH7A 1A42A 5JQTA 1XPZA 3DVCA 3KONA 3U7CA 4XZ5A 4K0TA 2AW1A 1I9QA 3CZVA 3CYUA 1FR7A 1CCUA 2EZ7A 1BN1A 2HL4A 4Q08A 5FLRA 3W6IA 3M1WA 2HNCA 1H9NA 1CAMA 1CAHA 1YO2A 2F14A 1I91A 1URTA 4RFDA 3M5TA 1ZGEA 4WL4A 1BV3A 2QOAA 5FNIA 3FE4A 4MDMA 3SBIA 1FSRA 4KP5A 4HEWA 3D92A 4RUZA 1HUHA 1CNKA 3S9TA 2FNMA 1FQLA 3RLDA 1CINA 4ZWIA 5CACA 1KWQA 1Y7WA 3HFPA 5FL4A 1RAZA 4KNMA 1G0EA 3D93A 3MNJA 5E2SA 1I9LA 4QSJA 1KWRA 3DV7A 4KNJA 1CVAA 3BL1A 1LGDA 3V5GA 1ZGFA 3N2PA 5EOIA 3IBLA 1CCSA 4E3GA 1TTMA 4LHIA 1CAIA 3F7BA 5BNLA 4QY3A 1G0FA 4LP6A 2NNVA 3P55A 3L14A 5E5UA 5G0CA 5DSQA 3F8EA 1LG6A 4JSWA 4PYXA 4KAPA 2AX2A 4Q7PA 1HCAA 4JSZA 1CA3A 4JSAA 4E9OX 3D8WA 1CNJA 1UGAA 2OSMA 3SBHA 1H9QA 3M96A 5FDIA 1RAYA 5DSNA 3RZ1B 1FQMA 5DSRA 4FU5A 1CILA 4Q6EA 1H4NA 3S78B 3VBDA 4QJ0A 3T84A 4YXIA 1BNVA 4TWMA 4XIXA 4XE1A 3MYQA 1G4JA 3MNKA 4HT2A 3M5SA 3F7UA 3MHIA 4QK2A 3MHOA 1CVBA 5EKJA 2VVBX 1HUGA 1EOUA 1MOOA 2NN7A 4ITOA 5E2MA 3KIGA 3V3JA 4QK3A 4Q7VA 5EHEA 1TE3X 3T83A 8CA2A 3DCCA 1CZMA 2H15A 3MNAA 3TMJA 4Q99A 3KWAA 6CA2A 5DOGA 3D9ZA 4YWPA 1RZCA 3S76A 3K34A 4L5UA 4E49A 2NXRA 5SZ3A 5E2RA 1THKA 5L3OA 4HU1A 1ZSCA 4ZX0A 1MUAA 3KLDB 1I9PA 4R5BA 4Y0JA 5JG3B 4KP8A 4CNXA 3CA2A 4RIVA 1G45A 3OY0A 5AMDA 1BZMA 4CA2A 5EZTX 4X5SA 5G0BA 3U3AX 3HKUA 1UGFA 5DSLA 4YX4A 4MTYA 1FSNA 4QJXA 3ZP9A 4ZAOA 1TBTX 4Q07A 3SAPA 5C8IA 1CNXA 4G0CA 2CBAA 3JXHC 4E4AA 4IDRX 5EH8A 4Q06A 3N0NA 4Q8XA 1T9NA 5JQ0A 4CNVA 4E3DA 3RZ0B 4RUYA 5DRSA 1IF8A 5DSIA 1G53A 4Q9YA 3MZCA 5E5RA 1HEBA 4Z1KA 4ITPA 3S75B 1HVAA 3RZ5A 4FIKA 4YGKA 4E3FA 5SZ1A 2WEOA 3M3XA 2POUA 3M40A 9CA2A 2EU2A 5BRVA 3U47A 4YYTA 3M2NA 3NJ9A 5E2KA 4MDGA 1G54A 2CBBA 2NXSA 5FL6A 1XQ0A 1CIMA 3FW3A 4ZWXA 4Z1EA 2O4ZA 4RN4A 3MHMA 4K13A 1CA2A 1V9EA 5EHVA 4BCWA 1BN4A 3V3GB 1OKMA 3RJ7A 3V3HB 5CLUA 3M1KA 1CNIA 3T5UA 4Q8YA 3RGEA 1I8ZA 1FQRA 4Z1JA 1TG9A 3D0NA 2CBEA 4IWZA 4UOVA 1BNQA 3M2YA 5JEGB 1CRAA 1DCBA 2WD3A 5FLSA 1KOQA 1G52A 5JGTB 4PXXA 3T5ZA 2NWZA 5DSOA 4HEZA 4XIWA 4K0SA 2NWPA 4KV0A 4E5QA 4M2VA 4BF6A 3HKTA 3PO6A 4WUQA 4M2UA 2NN1A 4CNRA 4E3HA 1BNWA 4M2WA 4CACA 3S77B 12CAA 3UYQA 1IF6A 3MNHA 2NWOA 3DVDA 4HT0A 2Q1QA 5JG5B 1DMXA 4RH2A 3DCWA 3RZ7A 2FMGA 5DSJA 3HKQA 1RZDA 4K1QA 4M2RA 4KNIA 1I9OA 1UGEA 3M2XA 4QJPA 2ABEA 5A6HA 4CNWA 1DCAA 1JCZA 1IF9A 2CBCA 3RYVB 3F4XA 1OKNA 3FFPX 1LG5A 4YHAA 5JEHB 1HCBA 3DD0A 1TB0X 1Z97A 3R17B 1CNHA 4Q81A 4K0ZA 2NMXA 3HS4A 3MWOA 4N16A 3OKVA 3DAZA 4ZX1A 1FQNA 1RJ5A 5BRWA 1BNNA 5L6KA 4FL7A 4MO8A 3DD8A 1JD0A 3S8XA 1CCTA 4QSAA 4QIZA 3RG4A 2FMZA 3RYYA 3JXGA 4N0XB 2FOUA 4C3TA 3QYKA 1CVDA 2FOYA 3NB5A 4WR7A 1RJ6A 2WD2A 3V3FA 4Q87A 1CAOA 5SZ6A 3UYNA 1YDCA 2NNGA 4WW6A 5EKHA 4PYYA 1I9MA 4Q7WA 3JXFA 2GD8A 4FRCA 1UGDA 1UGGA 1CAKA 2WEJA 1G48A 1Z93A 2HD6A 2CBDA 3P3HA 3KKXA 5FNHA 2X7UA 3R16A 1ZSBA 3EFIA 3BETA 1AM6A 3P4VA 3PJJA 2ILIA 1ZE8A 4PQ7A 2FOSA 1CNBA 1UGCA 1CVCA 1LZVA 1FR4A 2H4NA 4CQ0A 4YVYA 5A25A 3M14A 5E2NA 5JEPB 3SAXA 1BNMA 2NNSA 3M04A 4QIYA 3IBNA 2HKKA 2Q1BA 3PYKA 2GEHA 3IBUA 4GL1X 4ILXA 3P58A 1BICA 1CNYA 1HEDA 1JV0A 2NXTA 5BYIA 2EU3A 4FVOA 1CVEA 4JSSA 4KUWA 3P5LA 4QTLA 3MMFA 5EIJA 3ML2A 5CJFA 3TVOX 5HPJA 5SZ4A 1YDDA 5SZ7A 4QJWA 3OILA 4XFWA 1V9IC 3MHLA 3OKUA 4QJMA 3B1BA 2NNOA 4QJOA 5FLTA 4JS6A 3MNUA 1BNUA 2FNKA 5SZ5A 3M67A 1KEQA 3P3JA 5FLQA 1ZFQA 3K2FA 3RYZA 3N3JA 2ZNCA 4TWLA 2OSFA 1IF4A 5DOHA 3MHCA 4Q90A 1AVNA 3DBUA 1G3ZA 4FPTA 5FDCA 3OIKA 5FNKA 5JDVB 5E28A 3DA2A 1I9NA 1ZSAA 1DMYA 5AMGA 4Z1NA 3S72B 2CABA 4FVNA 3M2ZA 4QSIA 4YGJA 1CALA 5EH5A 4ZWZA 1BCDA 4ETQC 1LUGA 2FW4A 4KNNA 4Q8ZA 4YXUA 4MLTA 3HLJA 2QO8A 3M98A 4G7AA 3W6HA 4ZWYA 2X7TA 1CNWA 1XEGA 3V7XA 4KUVA 3KOKA 3LXEA 5AMLA 5JESB 4WW8A 1RZEA 5EHWA 5G01A 5DSPA 4HBAA 2POWA 3M5EA 1I90A 3P5AA 4RFCA 4Q7SA 5DVXA 1J9WA 1F2WA 1RZAA 5FLPA 1OQ5A 1G6VA 5J8ZA 4BF1A 4Q6DA 1ZH9A 1ZNCA 3TVNX 3KOIA 3S74B
chains in the Genus database with same CATH superfamily
1UGBA 1G1DA 3EFTA 5JGSB 2Q38A 5SZ2A 1YO0A 5DSKA 2IT4A 5G03A 4PZHA 1BNTA 3K7KA 1TG3A 3RG3A 4MLXA 3S71B 3V2JA 3P44A 4YGNA 4Q78A 3T82A 2CA2A 4MDLA 1IF5A 3MDZA 4DZ7A 4WUPA 3ML5A 4QK1A 1IF7A 1CNGA 4Q0LA 3N4BA 5SZ0A 3RZ8A 2X7SA 1XEVA 2HOCA 4Q83A 3U45X 4QSBA 1FLJA 3MNIA 2NWYA 4DZ9A 3RYXB 1CRMA 3Q31A 3DC9A 1CANA 1YDBA 1HEAA 1ZFKA 3OYQA 3ZNCA 3IEOA 4Q09A 3S97A 4L5VA 3HKNA 2VVAX 4R5AA 3IGPA 1HECA 4YGFA 1TEUX 7CA2A 5IPZA 2FOQA 1CAZA 4R59A 1YDAA 1FSQA 1CAJA 1OKLA 5FL5A 1YO1A 2FOVA 2W2JA 3M1JA 4RUXA 3S73B 1RZBA 4YXOA 1Z9YA 1AZMA 1G46A 2POVA 3KNEA 3IAIA 2WEHA 1CAYA 1KOPA 4Q49A 1BN3A 5FLOA 4HF3A 3V3IB 4LU3A 3OIMA 1G4OA 2FNNA 5FNJA 5BRUA 4HEYA 4QEFA 1CVFA 5EKMA 4KUYA 4L5WA 3GZ0A 2WEGA 4COQA 1TEQX 4Z0QA 3T85A 3OYSA 3BL0A 4YGLA 1CNCA 5FNLA 3B4FA 3KS3A 3M1QA 5FNGA 3DVBA 5FNMA 5CA2A 1CVHA 3C7PA 3V2MA 3IBIA 3DCSA 3DC3A 3RYJB 4RIUA 3CAJA 3NI5A 5DSMA 1TH9A 2HFWA 5LMDA 2QP6A 5EH7A 1A42A 5JQTA 1XPZA 3DVCA 3KONA 3U7CA 4XZ5A 4K0TA 2AW1A 1I9QA 3CZVA 3CYUA 1FR7A 1CCUA 2EZ7A 1BN1A 2HL4A 4Q08A 5FLRA 3W6IA 3M1WA 2HNCA 1H9NA 1CAMA 1CAHA 1YO2A 2F14A 1I91A 1URTA 4RFDA 3M5TA 1ZGEA 4WL4A 1BV3A 2QOAA 5FNIA 3FE4A 4MDMA 3SBIA 1FSRA 4KP5A 4HEWA 3D92A 4RUZA 1HUHA 1CNKA 3S9TA 2FNMA 1FQLA 3RLDA 1CINA 4ZWIA 5CACA 1KWQA 1Y7WA 3HFPA 5FL4A 1RAZA 4KNMA 1G0EA 3D93A 3MNJA 5E2SA 1I9LA 4QSJA 1KWRA 3DV7A 4KNJA 1CVAA 3BL1A 1LGDA 3V5GA 1ZGFA 3N2PA 5EOIA 3IBLA 1CCSA 4E3GA 1TTMA 4LHIA 1CAIA 3F7BA 5BNLA 4QY3A 1G0FA 4LP6A 2NNVA 3P55A 3L14A 5E5UA 5G0CA 5DSQA 3F8EA 1LG6A 4JSWA 4PYXA 4KAPA 2AX2A 4Q7PA 1HCAA 4JSZA 1CA3A 4JSAA 4E9OX 3D8WA 1CNJA 1UGAA 2OSMA 3SBHA 1H9QA 3M96A 5FDIA 1RAYA 5DSNA 3RZ1B 1FQMA 5DSRA 4FU5A 1CILA 4Q6EA 1H4NA 3S78B 3VBDA 4QJ0A 3T84A 4YXIA 1BNVA 4TWMA 4XIXA 4XE1A 3MYQA 1G4JA 3MNKA 4HT2A 3M5SA 3F7UA 3MHIA 4QK2A 3MHOA 1CVBA 5EKJA 2VVBX 1HUGA 1EOUA 1MOOA 2NN7A 4ITOA 5E2MA 3KIGA 3V3JA 4QK3A 4Q7VA 5EHEA 1TE3X 3T83A 8CA2A 3DCCA 1CZMA 2H15A 3MNAA 3TMJA 4Q99A 3KWAA 6CA2A 5DOGA 3D9ZA 4YWPA 1RZCA 3S76A 3K34A 4L5UA 4E49A 2NXRA 5SZ3A 5E2RA 1THKA 5L3OA 4HU1A 1ZSCA 4ZX0A 1MUAA 3KLDB 1I9PA 4R5BA 4Y0JA 5JG3B 4KP8A 4CNXA 3CA2A 4RIVA 1G45A 3OY0A 5AMDA 1BZMA 4CA2A 5EZTX 4X5SA 5G0BA 3U3AX 3HKUA 1UGFA 5DSLA 4YX4A 4MTYA 1FSNA 4QJXA 3ZP9A 4ZAOA 1TBTX 4Q07A 3SAPA 5C8IA 1CNXA 4G0CA 2CBAA 3JXHC 4E4AA 4IDRX 5EH8A 4Q06A 3N0NA 4Q8XA 1T9NA 5JQ0A 4CNVA 4E3DA 3RZ0B 4RUYA 5DRSA 1IF8A 5DSIA 1G53A 4Q9YA 3MZCA 5E5RA 1HEBA 4Z1KA 4ITPA 3S75B 1HVAA 3RZ5A 4FIKA 4YGKA 4E3FA 5SZ1A 2WEOA 3M3XA 2POUA 3M40A 9CA2A 2EU2A 5BRVA 3U47A 4YYTA 3M2NA 3NJ9A 5E2KA 4MDGA 1G54A 2CBBA 2NXSA 5FL6A 1XQ0A 1CIMA 3FW3A 4ZWXA 4Z1EA 2O4ZA 4RN4A 3MHMA 4K13A 1CA2A 1V9EA 5EHVA 4BCWA 1BN4A 3V3GB 1OKMA 3RJ7A 3V3HB 5CLUA 3M1KA 1CNIA 3T5UA 4Q8YA 3RGEA 1I8ZA 1FQRA 4Z1JA 1TG9A 3D0NA 2CBEA 4IWZA 4UOVA 1BNQA 3M2YA 5JEGB 1CRAA 1DCBA 2WD3A 5FLSA 1KOQA 1G52A 5JGTB 4PXXA 3T5ZA 2NWZA 5DSOA 4HEZA 4XIWA 4K0SA 2NWPA 4KV0A 4E5QA 4M2VA 4BF6A 3HKTA 3PO6A 4WUQA 4M2UA 2NN1A 4CNRA 4E3HA 1BNWA 4M2WA 4CACA 3S77B 12CAA 3UYQA 1IF6A 3MNHA 2NWOA 3DVDA 4HT0A 2Q1QA 5JG5B 1DMXA 4RH2A 3DCWA 3RZ7A 2FMGA 5DSJA 3HKQA 1RZDA 4K1QA 4M2RA 4KNIA 1I9OA 1UGEA 3M2XA 4QJPA 2ABEA 5A6HA 4CNWA 1DCAA 1JCZA 1IF9A 2CBCA 3RYVB 3F4XA 1OKNA 3FFPX 1LG5A 4YHAA 5JEHB 1HCBA 3DD0A 1TB0X 1Z97A 3R17B 1CNHA 4Q81A 4K0ZA 2NMXA 3HS4A 3MWOA 4N16A 3OKVA 3DAZA 4ZX1A 1FQNA 1RJ5A 5BRWA 1BNNA 5L6KA 4FL7A 4MO8A 3DD8A 1JD0A 3S8XA 1CCTA 4QSAA 4QIZA 3RG4A 2FMZA 3RYYA 3JXGA 4N0XB 2FOUA 4C3TA 3QYKA 1CVDA 2FOYA 3NB5A 4WR7A 1RJ6A 2WD2A 3V3FA 4Q87A 1CAOA 5SZ6A 3UYNA 1YDCA 2NNGA 4WW6A 5EKHA 4PYYA 1I9MA 4Q7WA 3JXFA 2GD8A 4FRCA 1UGDA 1UGGA 1CAKA 2WEJA 1G48A 1Z93A 2HD6A 2CBDA 3P3HA 3KKXA 5FNHA 2X7UA 3R16A 1ZSBA 3EFIA 3BETA 1AM6A 3P4VA 3PJJA 2ILIA 1ZE8A 4PQ7A 2FOSA 1CNBA 1UGCA 1CVCA 1LZVA 1FR4A 2H4NA 4CQ0A 4YVYA 5A25A 3M14A 5E2NA 5JEPB 3SAXA 1BNMA 2NNSA 3M04A 4QIYA 3IBNA 2HKKA 2Q1BA 3PYKA 2GEHA 3IBUA 4GL1X 4ILXA 3P58A 1BICA 1CNYA 1HEDA 1JV0A 2NXTA 5BYIA 2EU3A 4FVOA 1CVEA 4JSSA 4KUWA 3P5LA 4QTLA 3MMFA 5EIJA 3ML2A 5CJFA 3TVOX 5HPJA 5SZ4A 1YDDA 5SZ7A 4QJWA 3OILA 4XFWA 1V9IC 3MHLA 3OKUA 4QJMA 3B1BA 2NNOA 4QJOA 5FLTA 4JS6A 3MNUA 1BNUA 2FNKA 5SZ5A 3M67A 1KEQA 3P3JA 5FLQA 1ZFQA 3K2FA 3RYZA 3N3JA 2ZNCA 4TWLA 2OSFA 1IF4A 5DOHA 3MHCA 4Q90A 1AVNA 3DBUA 1G3ZA 4FPTA 5FDCA 3OIKA 5FNKA 5JDVB 5E28A 3DA2A 1I9NA 1ZSAA 1DMYA 5AMGA 4Z1NA 3S72B 2CABA 4FVNA 3M2ZA 4QSIA 4YGJA 1CALA 5EH5A 4ZWZA 1BCDA 4ETQC 1LUGA 2FW4A 4KNNA 4Q8ZA 4YXUA 4MLTA 3HLJA 2QO8A 3M98A 4G7AA 3W6HA 4ZWYA 2X7TA 1CNWA 1XEGA 3V7XA 4KUVA 3KOKA 3LXEA 5AMLA 5JESB 4WW8A 1RZEA 5EHWA 5G01A 5DSPA 4HBAA 2POWA 3M5EA 1I90A 3P5AA 4RFCA 4Q7SA 5DVXA 1J9WA 1F2WA 1RZAA 5FLPA 1OQ5A 1G6VA 5J8ZA 4BF1A 4Q6DA 1ZH9A 1ZNCA 3TVNX 3KOIA 3S74B
chains in the Genus database with same CATH topology
1UGBA 1G1DA 3EFTA 5JGSB 2Q38A 5SZ2A 1YO0A 5DSKA 2IT4A 5G03A 4PZHA 1BNTA 3K7KA 1TG3A 3RG3A 4MLXA 3S71B 3V2JA 3P44A 4YGNA 4Q78A 3T82A 2CA2A 4MDLA 1IF5A 3MDZA 4DZ7A 4WUPA 3ML5A 4QK1A 1IF7A 1CNGA 4Q0LA 3N4BA 5SZ0A 3RZ8A 2X7SA 1XEVA 2HOCA 4Q83A 3U45X 4QSBA 1FLJA 3MNIA 2NWYA 4DZ9A 3RYXB 1CRMA 3Q31A 3DC9A 1CANA 1YDBA 1HEAA 1ZFKA 3OYQA 3ZNCA 3IEOA 4Q09A 3S97A 4L5VA 3HKNA 2VVAX 4R5AA 3IGPA 1HECA 4YGFA 1TEUX 7CA2A 5IPZA 2FOQA 1CAZA 4R59A 1YDAA 1FSQA 1CAJA 1OKLA 5FL5A 1YO1A 2FOVA 2W2JA 3M1JA 4RUXA 3S73B 1RZBA 4YXOA 1Z9YA 1AZMA 1G46A 2POVA 3KNEA 3IAIA 2WEHA 1CAYA 1KOPA 4Q49A 1BN3A 5FLOA 4HF3A 3V3IB 4LU3A 3OIMA 1G4OA 2FNNA 5FNJA 5BRUA 4HEYA 4QEFA 1CVFA 5EKMA 4KUYA 4L5WA 3GZ0A 2WEGA 4COQA 1TEQX 4Z0QA 3T85A 3OYSA 3BL0A 4YGLA 1CNCA 5FNLA 3B4FA 3KS3A 3M1QA 5FNGA 3DVBA 5FNMA 5CA2A 1CVHA 3C7PA 3V2MA 3IBIA 3DCSA 3DC3A 3RYJB 4RIUA 3CAJA 3NI5A 5DSMA 1TH9A 2HFWA 5LMDA 2QP6A 5EH7A 1A42A 5JQTA 1XPZA 3DVCA 3KONA 3U7CA 4XZ5A 4K0TA 2AW1A 1I9QA 3CZVA 3CYUA 1FR7A 1CCUA 2EZ7A 1BN1A 2HL4A 4Q08A 5FLRA 3W6IA 3M1WA 2HNCA 1H9NA 1CAMA 1CAHA 1YO2A 2F14A 1I91A 1URTA 4RFDA 3M5TA 1ZGEA 4WL4A 1BV3A 2QOAA 5FNIA 3FE4A 4MDMA 3SBIA 1FSRA 4KP5A 4HEWA 3D92A 4RUZA 1HUHA 1CNKA 3S9TA 2FNMA 1FQLA 3RLDA 1CINA 4ZWIA 5CACA 1KWQA 1Y7WA 3HFPA 5FL4A 1RAZA 4KNMA 1G0EA 3D93A 3MNJA 5E2SA 1I9LA 4QSJA 1KWRA 3DV7A 4KNJA 1CVAA 3BL1A 1LGDA 3V5GA 1ZGFA 3N2PA 5EOIA 3IBLA 1CCSA 4E3GA 1TTMA 4LHIA 1CAIA 3F7BA 5BNLA 4QY3A 1G0FA 4LP6A 2NNVA 3P55A 3L14A 5E5UA 5G0CA 5DSQA 3F8EA 1LG6A 4JSWA 4PYXA 4KAPA 2AX2A 4Q7PA 1HCAA 4JSZA 1CA3A 4JSAA 4E9OX 3D8WA 1CNJA 1UGAA 2OSMA 3SBHA 1H9QA 3M96A 5FDIA 1RAYA 5DSNA 3RZ1B 1FQMA 5DSRA 4FU5A 1CILA 4Q6EA 1H4NA 3S78B 3VBDA 4QJ0A 3T84A 4YXIA 1BNVA 4TWMA 4XIXA 4XE1A 3MYQA 1G4JA 3MNKA 4HT2A 3M5SA 3F7UA 3MHIA 4QK2A 3MHOA 1CVBA 5EKJA 2VVBX 1HUGA 1EOUA 1MOOA 2NN7A 4ITOA 5E2MA 3KIGA 3V3JA 4QK3A 4Q7VA 5EHEA 1TE3X 3T83A 8CA2A 3DCCA 1CZMA 2H15A 3MNAA 3TMJA 4Q99A 3KWAA 6CA2A 5DOGA 3D9ZA 4YWPA 1RZCA 3S76A 3K34A 4L5UA 4E49A 2NXRA 5SZ3A 5E2RA 1THKA 5L3OA 4HU1A 1ZSCA 4ZX0A 1MUAA 3KLDB 1I9PA 4R5BA 4Y0JA 5JG3B 4KP8A 4CNXA 3CA2A 4RIVA 1G45A 3OY0A 5AMDA 1BZMA 4CA2A 5EZTX 4X5SA 5G0BA 3U3AX 3HKUA 1UGFA 5DSLA 4YX4A 4MTYA 1FSNA 4QJXA 3ZP9A 4ZAOA 1TBTX 4Q07A 3SAPA 5C8IA 1CNXA 4G0CA 2CBAA 3JXHC 4E4AA 4IDRX 5EH8A 4Q06A 3N0NA 4Q8XA 1T9NA 5JQ0A 4CNVA 4E3DA 3RZ0B 4RUYA 5DRSA 1IF8A 5DSIA 1G53A 4Q9YA 3MZCA 5E5RA 1HEBA 4Z1KA 4ITPA 3S75B 1HVAA 3RZ5A 4FIKA 4YGKA 4E3FA 5SZ1A 2WEOA 3M3XA 2POUA 3M40A 9CA2A 2EU2A 5BRVA 3U47A 4YYTA 3M2NA 3NJ9A 5E2KA 4MDGA 1G54A 2CBBA 2NXSA 5FL6A 1XQ0A 1CIMA 3FW3A 4ZWXA 4Z1EA 2O4ZA 4RN4A 3MHMA 4K13A 1CA2A 1V9EA 5EHVA 4BCWA 1BN4A 3V3GB 1OKMA 3RJ7A 3V3HB 5CLUA 3M1KA 1CNIA 3T5UA 4Q8YA 3RGEA 1I8ZA 1FQRA 4Z1JA 1TG9A 3D0NA 2CBEA 4IWZA 4UOVA 1BNQA 3M2YA 5JEGB 1CRAA 1DCBA 2WD3A 5FLSA 1KOQA 1G52A 5JGTB 4PXXA 3T5ZA 2NWZA 5DSOA 4HEZA 4XIWA 4K0SA 2NWPA 4KV0A 4E5QA 4M2VA 4BF6A 3HKTA 3PO6A 4WUQA 4M2UA 2NN1A 4CNRA 4E3HA 1BNWA 4M2WA 4CACA 3S77B 12CAA 3UYQA 1IF6A 3MNHA 2NWOA 3DVDA 4HT0A 2Q1QA 5JG5B 1DMXA 4RH2A 3DCWA 3RZ7A 2FMGA 5DSJA 3HKQA 1RZDA 4K1QA 4M2RA 4KNIA 1I9OA 1UGEA 3M2XA 4QJPA 2ABEA 5A6HA 4CNWA 1DCAA 1JCZA 1IF9A 2CBCA 3RYVB 3F4XA 1OKNA 3FFPX 1LG5A 4YHAA 5JEHB 1HCBA 3DD0A 1TB0X 1Z97A 3R17B 1CNHA 4Q81A 4K0ZA 2NMXA 3HS4A 3MWOA 4N16A 3OKVA 3DAZA 4ZX1A 1FQNA 1RJ5A 5BRWA 1BNNA 5L6KA 4FL7A 4MO8A 3DD8A 1JD0A 3S8XA 1CCTA 4QSAA 4QIZA 3RG4A 2FMZA 3RYYA 3JXGA 4N0XB 2FOUA 4C3TA 3QYKA 1CVDA 2FOYA 3NB5A 4WR7A 1RJ6A 2WD2A 3V3FA 4Q87A 1CAOA 5SZ6A 3UYNA 1YDCA 2NNGA 4WW6A 5EKHA 4PYYA 1I9MA 4Q7WA 3JXFA 2GD8A 4FRCA 1UGDA 1UGGA 1CAKA 2WEJA 1G48A 1Z93A 2HD6A 2CBDA 3P3HA 3KKXA 5FNHA 2X7UA 3R16A 1ZSBA 3EFIA 3BETA 1AM6A 3P4VA 3PJJA 2ILIA 1ZE8A 4PQ7A 2FOSA 1CNBA 1UGCA 1CVCA 1LZVA 1FR4A 2H4NA 4CQ0A 4YVYA 5A25A 3M14A 5E2NA 5JEPB 3SAXA 1BNMA 2NNSA 3M04A 4QIYA 3IBNA 2HKKA 2Q1BA 3PYKA 2GEHA 3IBUA 4GL1X 4ILXA 3P58A 1BICA 1CNYA 1HEDA 1JV0A 2NXTA 5BYIA 2EU3A 4FVOA 1CVEA 4JSSA 4KUWA 3P5LA 4QTLA 3MMFA 5EIJA 3ML2A 5CJFA 3TVOX 5HPJA 5SZ4A 1YDDA 5SZ7A 4QJWA 3OILA 4XFWA 1V9IC 3MHLA 3OKUA 4QJMA 3B1BA 2NNOA 4QJOA 5FLTA 4JS6A 3MNUA 1BNUA 2FNKA 5SZ5A 3M67A 1KEQA 3P3JA 5FLQA 1ZFQA 3K2FA 3RYZA 3N3JA 2ZNCA 4TWLA 2OSFA 1IF4A 5DOHA 3MHCA 4Q90A 1AVNA 3DBUA 1G3ZA 4FPTA 5FDCA 3OIKA 5FNKA 5JDVB 5E28A 3DA2A 1I9NA 1ZSAA 1DMYA 5AMGA 4Z1NA 3S72B 2CABA 4FVNA 3M2ZA 4QSIA 4YGJA 1CALA 5EH5A 4ZWZA 1BCDA 4ETQC 1LUGA 2FW4A 4KNNA 4Q8ZA 4YXUA 4MLTA 3HLJA 2QO8A 3M98A 4G7AA 3W6HA 4ZWYA 2X7TA 1CNWA 1XEGA 3V7XA 4KUVA 3KOKA 3LXEA 5AMLA 5JESB 4WW8A 1RZEA 5EHWA 5G01A 5DSPA 4HBAA 2POWA 3M5EA 1I90A 3P5AA 4RFCA 4Q7SA 5DVXA 1J9WA 1F2WA 1RZAA 5FLPA 1OQ5A 1G6VA 5J8ZA 4BF1A 4Q6DA 1ZH9A 1ZNCA 3TVNX 3KOIA 3S74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGB A;  1G1D A;  3EFT A;  5JGS B;  2Q38 A;  5SZ2 A;  1YO0 A;  5DSK A;  2IT4 A;  5G03 A;  4PZH A;  1BNT A;  3K7K A;  1TG3 A;  3RG3 A;  4MLX A;  3S71 B;  3V2J A;  3P44 A;  4YGN A;  4Q78 A;  3T82 A;  2CA2 A;  4MDL A;  1IF5 A;  3MDZ A;  4DZ7 A;  4WUP A;  3ML5 A;  4QK1 A;  1IF7 A;  1CNG A;  4Q0L A;  3N4B A;  5SZ0 A;  3RZ8 A;  2X7S A;  1XEV A;  2HOC A;  4Q83 A;  3U45 X;  4QSB A;  1FLJ A;  3MNI A;  2NWY A;  4DZ9 A;  3RYX B;  1CRM A;  3Q31 A;  3DC9 A;  1CAN A;  1YDB A;  1HEA A;  1ZFK A;  3OYQ A;  3ZNC A;  3IEO A;  4Q09 A;  3S97 A;  4L5V A;  3HKN A;  2VVA X;  4R5A A;  3IGP A;  1HEC A;  4YGF A;  1TEU X;  7CA2 A;  5IPZ A;  2FOQ A;  1CAZ A;  4R59 A;  1YDA A;  1FSQ A;  1CAJ A;  1OKL A;  5FL5 A;  1YO1 A;  2FOV A;  2W2J A;  3M1J A;  4RUX A;  3S73 B;  1RZB A;  4YXO A;  1Z9Y A;  1AZM A;  1G46 A;  2POV A;  3KNE A;  3IAI A;  2WEH A;  1CAY A;  1KOP A;  4Q49 A;  1BN3 A;  5FLO A;  4HF3 A;  3V3I B;  4LU3 A;  3OIM A;  1G4O A;  2FNN A;  5FNJ A;  5BRU A;  4HEY A;  4QEF A;  1CVF A;  5EKM A;  4KUY A;  4L5W A;  3GZ0 A;  2WEG A;  4COQ A;  1TEQ X;  4Z0Q A;  3T85 A;  3OYS A;  3BL0 A;  4YGL A;  1CNC A;  5FNL A;  3B4F A;  3KS3 A;  3M1Q A;  5FNG A;  3DVB A;  5FNM A;  5CA2 A;  1CVH A;  3C7P A;  3V2M A;  3IBI A;  3DCS A;  3DC3 A;  3RYJ B;  4RIU A;  3CAJ A;  3NI5 A;  5DSM A;  1TH9 A;  2HFW A;  5LMD A;  2QP6 A;  5EH7 A;  1A42 A;  5JQT A;  1XPZ A;  3DVC A;  3KON A;  3U7C A;  4XZ5 A;  4K0T A;  2AW1 A;  1I9Q A;  3CZV A;  3CYU A;  1FR7 A;  1CCU A;  2EZ7 A;  1BN1 A;  2HL4 A;  4Q08 A;  5FLR A;  3W6I A;  3M1W A;  2HNC A;  1H9N A;  1CAM A;  1CAH A;  1YO2 A;  2F14 A;  1I91 A;  1URT A;  4RFD A;  3M5T A;  1ZGE A;  4WL4 A;  1BV3 A;  2QOA A;  5FNI A;  3FE4 A;  4MDM A;  3SBI A;  1FSR A;  4KP5 A;  4HEW A;  3D92 A;  4RUZ A;  1HUH A;  1CNK A;  3S9T A;  2FNM A;  1FQL A;  3RLD A;  1CIN A;  4ZWI A;  5CAC A;  1KWQ A;  1Y7W A;  3HFP A;  5FL4 A;  1RAZ A;  4KNM A;  1G0E A;  3D93 A;  3MNJ A;  5E2S A;  1I9L A;  4QSJ A;  1KWR A;  3DV7 A;  4KNJ A;  1CVA A;  3BL1 A;  1LGD A;  3V5G A;  1ZGF A;  3N2P A;  5EOI A;  3IBL A;  1CCS A;  4E3G A;  1TTM A;  4LHI A;  1CAI A;  3F7B A;  5BNL A;  4QY3 A;  1G0F A;  4LP6 A;  2NNV A;  3P55 A;  3L14 A;  5E5U A;  5G0C A;  5DSQ A;  3F8E A;  1LG6 A;  4JSW A;  4PYX A;  4KAP A;  2AX2 A;  4Q7P A;  1HCA A;  4JSZ A;  1CA3 A;  4JSA A;  4E9O X;  3D8W A;  1CNJ A;  1UGA A;  2OSM A;  3SBH A;  1H9Q A;  3M96 A;  5FDI A;  1RAY A;  5DSN A;  3RZ1 B;  1FQM A;  5DSR A;  4FU5 A;  1CIL A;  4Q6E A;  1H4N A;  3S78 B;  3VBD A;  4QJ0 A;  3T84 A;  4YXI A;  1BNV A;  4TWM A;  4XIX A;  4XE1 A;  3MYQ A;  1G4J A;  3MNK A;  4HT2 A;  3M5S A;  3F7U A;  3MHI A;  4QK2 A;  3MHO A;  1CVB A;  5EKJ A;  2VVB X;  1HUG A;  1EOU A;  1MOO A;  2NN7 A;  4ITO A;  5E2M A;  3KIG A;  3V3J A;  4QK3 A;  4Q7V A;  5EHE A;  1TE3 X;  3T83 A;  8CA2 A;  3DCC A;  1CZM A;  2H15 A;  3MNA A;  3TMJ A;  4Q99 A;  3KWA A;  6CA2 A;  5DOG A;  3D9Z A;  4YWP A;  1RZC A;  3S76 A;  3K34 A;  4L5U A;  4E49 A;  2NXR A;  5SZ3 A;  5E2R A;  1THK A;  5L3O A;  4HU1 A;  1ZSC A;  4ZX0 A;  1MUA A;  3KLD B;  1I9P A;  4R5B A;  4Y0J A;  5JG3 B;  4KP8 A;  4CNX A;  3CA2 A;  4RIV A;  1G45 A;  3OY0 A;  5AMD A;  1BZM A;  4CA2 A;  5EZT X;  4X5S A;  5G0B A;  3U3A X;  3HKU A;  1UGF A;  5DSL A;  4YX4 A;  4MTY A;  1FSN A;  4QJX A;  3ZP9 A;  4ZAO A;  1TBT X;  4Q07 A;  3SAP A;  5C8I A;  1CNX A;  4G0C A;  2CBA A;  3JXH C;  4E4A A;  4IDR X;  5EH8 A;  4Q06 A;  3N0N A;  4Q8X A;  1T9N A;  5JQ0 A;  4CNV A;  4E3D A;  3RZ0 B;  4RUY A;  5DRS A;  1IF8 A;  5DSI A;  1G53 A;  4Q9Y A;  3MZC A;  5E5R A;  1HEB A;  4Z1K A;  4ITP A;  3S75 B;  1HVA A;  3RZ5 A;  4FIK A;  4YGK A;  4E3F A;  5SZ1 A;  2WEO A;  3M3X A;  2POU A;  3M40 A;  9CA2 A;  2EU2 A;  5BRV A;  3U47 A;  4YYT A;  3M2N A;  3NJ9 A;  5E2K A;  4MDG A;  1G54 A;  2CBB A;  2NXS A;  5FL6 A;  1XQ0 A;  1CIM A;  3FW3 A;  4ZWX A;  4Z1E A;  2O4Z A;  4RN4 A;  3MHM A;  4K13 A;  1CA2 A;  1V9E A;  5EHV A;  4BCW A;  1BN4 A;  3V3G B;  1OKM A;  3RJ7 A;  3V3H B;  5CLU A;  3M1K A;  1CNI A;  3T5U A;  4Q8Y A;  3RGE A;  1I8Z A;  1FQR A;  4Z1J A;  1TG9 A;  3D0N A;  2CBE A;  4IWZ A;  4UOV A;  1BNQ A;  3M2Y A;  5JEG B;  1CRA A;  1DCB A;  2WD3 A;  5FLS A;  1KOQ A;  1G52 A;  5JGT B;  4PXX A;  3T5Z A;  2NWZ A;  5DSO A;  4HEZ A;  4XIW A;  4K0S A;  2NWP A;  4KV0 A;  4E5Q A;  4M2V A;  4BF6 A;  3HKT A;  3PO6 A;  4WUQ A;  4M2U A;  2NN1 A;  4CNR A;  4E3H A;  1BNW A;  4M2W A;  4CAC A;  3S77 B;  12CA A;  3UYQ A;  1IF6 A;  3MNH A;  2NWO A;  3DVD A;  4HT0 A;  2Q1Q A;  5JG5 B;  1DMX A;  4RH2 A;  3DCW A;  3RZ7 A;  2FMG A;  5DSJ A;  3HKQ A;  1RZD A;  4K1Q A;  4M2R A;  4KNI A;  1I9O A;  1UGE A;  3M2X A;  4QJP A;  2ABE A;  5A6H A;  4CNW A;  1DCA A;  1JCZ A;  1IF9 A;  2CBC A;  3RYV B;  3F4X A;  1OKN A;  3FFP X;  1LG5 A;  4YHA A;  5JEH B;  1HCB A;  3DD0 A;  1TB0 X;  1Z97 A;  3R17 B;  1CNH A;  4Q81 A;  4K0Z A;  2NMX A;  3HS4 A;  3MWO A;  4N16 A;  3OKV A;  3DAZ A;  4ZX1 A;  1FQN A;  1RJ5 A;  5BRW A;  1BNN A;  5L6K A;  4FL7 A;  4MO8 A;  3DD8 A;  1JD0 A;  3S8X A;  1CCT A;  4QSA A;  4QIZ A;  3RG4 A;  2FMZ A;  3RYY A;  3JXG A;  4N0X B;  2FOU A;  4C3T A;  3QYK A;  1CVD A;  2FOY A;  3NB5 A;  4WR7 A;  1RJ6 A;  2WD2 A;  3V3F A;  4Q87 A;  1CAO A;  5SZ6 A;  3UYN A;  1YDC A;  2NNG A;  4WW6 A;  5EKH A;  4PYY A;  1I9M A;  4Q7W A;  3JXF A;  2GD8 A;  4FRC A;  1UGD A;  1UGG A;  1CAK A;  2WEJ A;  1G48 A;  1Z93 A;  2HD6 A;  2CBD A;  3P3H A;  3KKX A;  5FNH A;  2X7U A;  3R16 A;  1ZSB A;  3EFI A;  3BET A;  1AM6 A;  3P4V A;  3PJJ A;  2ILI A;  1ZE8 A;  4PQ7 A;  2FOS A;  1CNB A;  1UGC A;  1CVC A;  1LZV A;  1FR4 A;  2H4N A;  4CQ0 A;  4YVY A;  5A25 A;  3M14 A;  5E2N A;  5JEP B;  3SAX A;  1BNM A;  2NNS A;  3M04 A;  4QIY A;  3IBN A;  2HKK A;  2Q1B A;  3PYK A;  2GEH A;  3IBU A;  4GL1 X;  4ILX A;  3P58 A;  1BIC A;  1CNY A;  1HED A;  1JV0 A;  2NXT A;  5BYI A;  2EU3 A;  4FVO A;  1CVE A;  4JSS A;  4KUW A;  3P5L A;  4QTL A;  3MMF A;  5EIJ A;  3ML2 A;  5CJF A;  3TVO X;  5HPJ A;  5SZ4 A;  1YDD A;  5SZ7 A;  4QJW A;  3OIL A;  4XFW A;  1V9I C;  3MHL A;  3OKU A;  4QJM A;  3B1B A;  2NNO A;  4QJO A;  5FLT A;  4JS6 A;  3MNU A;  1BNU A;  2FNK A;  5SZ5 A;  3M67 A;  1KEQ A;  3P3J A;  5FLQ A;  1ZFQ A;  3K2F A;  3RYZ A;  3N3J A;  2ZNC A;  4TWL A;  2OSF A;  1IF4 A;  5DOH A;  3MHC A;  4Q90 A;  1AVN A;  3DBU A;  1G3Z A;  4FPT A;  5FDC A;  3OIK A;  5FNK A;  5JDV B;  5E28 A;  3DA2 A;  1I9N A;  1ZSA A;  1DMY A;  5AMG A;  4Z1N A;  3S72 B;  2CAB A;  4FVN A;  3M2Z A;  4QSI A;  4YGJ A;  1CAL A;  5EH5 A;  4ZWZ A;  1BCD A;  4ETQ C;  1LUG A;  2FW4 A;  4KNN A;  4Q8Z A;  4YXU A;  4MLT A;  3HLJ A;  2QO8 A;  3M98 A;  4G7A A;  3W6H A;  4ZWY A;  2X7T A;  1CNW A;  1XEG A;  3V7X A;  4KUV A;  3KOK A;  3LXE A;  5AML A;  5JES B;  4WW8 A;  1RZE A;  5EHW A;  5G01 A;  5DSP A;  4HBA A;  2POW A;  3M5E A;  1I90 A;  3P5A A;  4RFC A;  4Q7S A;  5DVX A;  1J9W A;  1F2W A;  1RZA A;  5FLP A;  1OQ5 A;  1G6V A;  5J8Z A;  4BF1 A;  4Q6D A;  1ZH9 A;  1ZNC A;  3TVN X;  3KOI A;  3S74 B; 
#chains in the Genus database with same CATH topology
 1UGB A;  1G1D A;  3EFT A;  5JGS B;  2Q38 A;  5SZ2 A;  1YO0 A;  5DSK A;  2IT4 A;  5G03 A;  4PZH A;  1BNT A;  3K7K A;  1TG3 A;  3RG3 A;  4MLX A;  3S71 B;  3V2J A;  3P44 A;  4YGN A;  4Q78 A;  3T82 A;  2CA2 A;  4MDL A;  1IF5 A;  3MDZ A;  4DZ7 A;  4WUP A;  3ML5 A;  4QK1 A;  1IF7 A;  1CNG A;  4Q0L A;  3N4B A;  5SZ0 A;  3RZ8 A;  2X7S A;  1XEV A;  2HOC A;  4Q83 A;  3U45 X;  4QSB A;  1FLJ A;  3MNI A;  2NWY A;  4DZ9 A;  3RYX B;  1CRM A;  3Q31 A;  3DC9 A;  1CAN A;  1YDB A;  1HEA A;  1ZFK A;  3OYQ A;  3ZNC A;  3IEO A;  4Q09 A;  3S97 A;  4L5V A;  3HKN A;  2VVA X;  4R5A A;  3IGP A;  1HEC A;  4YGF A;  1TEU X;  7CA2 A;  5IPZ A;  2FOQ A;  1CAZ A;  4R59 A;  1YDA A;  1FSQ A;  1CAJ A;  1OKL A;  5FL5 A;  1YO1 A;  2FOV A;  2W2J A;  3M1J A;  4RUX A;  3S73 B;  1RZB A;  4YXO A;  1Z9Y A;  1AZM A;  1G46 A;  2POV A;  3KNE A;  3IAI A;  2WEH A;  1CAY A;  1KOP A;  4Q49 A;  1BN3 A;  5FLO A;  4HF3 A;  3V3I B;  4LU3 A;  3OIM A;  1G4O A;  2FNN A;  5FNJ A;  5BRU A;  4HEY A;  4QEF A;  1CVF A;  5EKM A;  4KUY A;  4L5W A;  3GZ0 A;  2WEG A;  4COQ A;  1TEQ X;  4Z0Q A;  3T85 A;  3OYS A;  3BL0 A;  4YGL A;  1CNC A;  5FNL A;  3B4F A;  3KS3 A;  3M1Q A;  5FNG A;  3DVB A;  5FNM A;  5CA2 A;  1CVH A;  3C7P A;  3V2M A;  3IBI A;  3DCS A;  3DC3 A;  3RYJ B;  4RIU A;  3CAJ A;  3NI5 A;  5DSM A;  1TH9 A;  2HFW A;  5LMD A;  2QP6 A;  5EH7 A;  1A42 A;  5JQT A;  1XPZ A;  3DVC A;  3KON A;  3U7C A;  4XZ5 A;  4K0T A;  2AW1 A;  1I9Q A;  3CZV A;  3CYU A;  1FR7 A;  1CCU A;  2EZ7 A;  1BN1 A;  2HL4 A;  4Q08 A;  5FLR A;  3W6I A;  3M1W A;  2HNC A;  1H9N A;  1CAM A;  1CAH A;  1YO2 A;  2F14 A;  1I91 A;  1URT A;  4RFD A;  3M5T A;  1ZGE A;  4WL4 A;  1BV3 A;  2QOA A;  5FNI A;  3FE4 A;  4MDM A;  3SBI A;  1FSR A;  4KP5 A;  4HEW A;  3D92 A;  4RUZ A;  1HUH A;  1CNK A;  3S9T A;  2FNM A;  1FQL A;  3RLD A;  1CIN A;  4ZWI A;  5CAC A;  1KWQ A;  1Y7W A;  3HFP A;  5FL4 A;  1RAZ A;  4KNM A;  1G0E A;  3D93 A;  3MNJ A;  5E2S A;  1I9L A;  4QSJ A;  1KWR A;  3DV7 A;  4KNJ A;  1CVA A;  3BL1 A;  1LGD A;  3V5G A;  1ZGF A;  3N2P A;  5EOI A;  3IBL A;  1CCS A;  4E3G A;  1TTM A;  4LHI A;  1CAI A;  3F7B A;  5BNL A;  4QY3 A;  1G0F A;  4LP6 A;  2NNV A;  3P55 A;  3L14 A;  5E5U A;  5G0C A;  5DSQ A;  3F8E A;  1LG6 A;  4JSW A;  4PYX A;  4KAP A;  2AX2 A;  4Q7P A;  1HCA A;  4JSZ A;  1CA3 A;  4JSA A;  4E9O X;  3D8W A;  1CNJ A;  1UGA A;  2OSM A;  3SBH A;  1H9Q A;  3M96 A;  5FDI A;  1RAY A;  5DSN A;  3RZ1 B;  1FQM A;  5DSR A;  4FU5 A;  1CIL A;  4Q6E A;  1H4N A;  3S78 B;  3VBD A;  4QJ0 A;  3T84 A;  4YXI A;  1BNV A;  4TWM A;  4XIX A;  4XE1 A;  3MYQ A;  1G4J A;  3MNK A;  4HT2 A;  3M5S A;  3F7U A;  3MHI A;  4QK2 A;  3MHO A;  1CVB A;  5EKJ A;  2VVB X;  1HUG A;  1EOU A;  1MOO A;  2NN7 A;  4ITO A;  5E2M A;  3KIG A;  3V3J A;  4QK3 A;  4Q7V A;  5EHE A;  1TE3 X;  3T83 A;  8CA2 A;  3DCC A;  1CZM A;  2H15 A;  3MNA A;  3TMJ A;  4Q99 A;  3KWA A;  6CA2 A;  5DOG A;  3D9Z A;  4YWP A;  1RZC A;  3S76 A;  3K34 A;  4L5U A;  4E49 A;  2NXR A;  5SZ3 A;  5E2R A;  1THK A;  5L3O A;  4HU1 A;  1ZSC A;  4ZX0 A;  1MUA A;  3KLD B;  1I9P A;  4R5B A;  4Y0J A;  5JG3 B;  4KP8 A;  4CNX A;  3CA2 A;  4RIV A;  1G45 A;  3OY0 A;  5AMD A;  1BZM A;  4CA2 A;  5EZT X;  4X5S A;  5G0B A;  3U3A X;  3HKU A;  1UGF A;  5DSL A;  4YX4 A;  4MTY A;  1FSN A;  4QJX A;  3ZP9 A;  4ZAO A;  1TBT X;  4Q07 A;  3SAP A;  5C8I A;  1CNX A;  4G0C A;  2CBA A;  3JXH C;  4E4A A;  4IDR X;  5EH8 A;  4Q06 A;  3N0N A;  4Q8X A;  1T9N A;  5JQ0 A;  4CNV A;  4E3D A;  3RZ0 B;  4RUY A;  5DRS A;  1IF8 A;  5DSI A;  1G53 A;  4Q9Y A;  3MZC A;  5E5R A;  1HEB A;  4Z1K A;  4ITP A;  3S75 B;  1HVA A;  3RZ5 A;  4FIK A;  4YGK A;  4E3F A;  5SZ1 A;  2WEO A;  3M3X A;  2POU A;  3M40 A;  9CA2 A;  2EU2 A;  5BRV A;  3U47 A;  4YYT A;  3M2N A;  3NJ9 A;  5E2K A;  4MDG A;  1G54 A;  2CBB A;  2NXS A;  5FL6 A;  1XQ0 A;  1CIM A;  3FW3 A;  4ZWX A;  4Z1E A;  2O4Z A;  4RN4 A;  3MHM A;  4K13 A;  1CA2 A;  1V9E A;  5EHV A;  4BCW A;  1BN4 A;  3V3G B;  1OKM A;  3RJ7 A;  3V3H B;  5CLU A;  3M1K A;  1CNI A;  3T5U A;  4Q8Y A;  3RGE A;  1I8Z A;  1FQR A;  4Z1J A;  1TG9 A;  3D0N A;  2CBE A;  4IWZ A;  4UOV A;  1BNQ A;  3M2Y A;  5JEG B;  1CRA A;  1DCB A;  2WD3 A;  5FLS A;  1KOQ A;  1G52 A;  5JGT B;  4PXX A;  3T5Z A;  2NWZ A;  5DSO A;  4HEZ A;  4XIW A;  4K0S A;  2NWP A;  4KV0 A;  4E5Q A;  4M2V A;  4BF6 A;  3HKT A;  3PO6 A;  4WUQ A;  4M2U A;  2NN1 A;  4CNR A;  4E3H A;  1BNW A;  4M2W A;  4CAC A;  3S77 B;  12CA A;  3UYQ A;  1IF6 A;  3MNH A;  2NWO A;  3DVD A;  4HT0 A;  2Q1Q A;  5JG5 B;  1DMX A;  4RH2 A;  3DCW A;  3RZ7 A;  2FMG A;  5DSJ A;  3HKQ A;  1RZD A;  4K1Q A;  4M2R A;  4KNI A;  1I9O A;  1UGE A;  3M2X A;  4QJP A;  2ABE A;  5A6H A;  4CNW A;  1DCA A;  1JCZ A;  1IF9 A;  2CBC A;  3RYV B;  3F4X A;  1OKN A;  3FFP X;  1LG5 A;  4YHA A;  5JEH B;  1HCB A;  3DD0 A;  1TB0 X;  1Z97 A;  3R17 B;  1CNH A;  4Q81 A;  4K0Z A;  2NMX A;  3HS4 A;  3MWO A;  4N16 A;  3OKV A;  3DAZ A;  4ZX1 A;  1FQN A;  1RJ5 A;  5BRW A;  1BNN A;  5L6K A;  4FL7 A;  4MO8 A;  3DD8 A;  1JD0 A;  3S8X A;  1CCT A;  4QSA A;  4QIZ A;  3RG4 A;  2FMZ A;  3RYY A;  3JXG A;  4N0X B;  2FOU A;  4C3T A;  3QYK A;  1CVD A;  2FOY A;  3NB5 A;  4WR7 A;  1RJ6 A;  2WD2 A;  3V3F A;  4Q87 A;  1CAO A;  5SZ6 A;  3UYN A;  1YDC A;  2NNG A;  4WW6 A;  5EKH A;  4PYY A;  1I9M A;  4Q7W A;  3JXF A;  2GD8 A;  4FRC A;  1UGD A;  1UGG A;  1CAK A;  2WEJ A;  1G48 A;  1Z93 A;  2HD6 A;  2CBD A;  3P3H A;  3KKX A;  5FNH A;  2X7U A;  3R16 A;  1ZSB A;  3EFI A;  3BET A;  1AM6 A;  3P4V A;  3PJJ A;  2ILI A;  1ZE8 A;  4PQ7 A;  2FOS A;  1CNB A;  1UGC A;  1CVC A;  1LZV A;  1FR4 A;  2H4N A;  4CQ0 A;  4YVY A;  5A25 A;  3M14 A;  5E2N A;  5JEP B;  3SAX A;  1BNM A;  2NNS A;  3M04 A;  4QIY A;  3IBN A;  2HKK A;  2Q1B A;  3PYK A;  2GEH A;  3IBU A;  4GL1 X;  4ILX A;  3P58 A;  1BIC A;  1CNY A;  1HED A;  1JV0 A;  2NXT A;  5BYI A;  2EU3 A;  4FVO A;  1CVE A;  4JSS A;  4KUW A;  3P5L A;  4QTL A;  3MMF A;  5EIJ A;  3ML2 A;  5CJF A;  3TVO X;  5HPJ A;  5SZ4 A;  1YDD A;  5SZ7 A;  4QJW A;  3OIL A;  4XFW A;  1V9I C;  3MHL A;  3OKU A;  4QJM A;  3B1B A;  2NNO A;  4QJO A;  5FLT A;  4JS6 A;  3MNU A;  1BNU A;  2FNK A;  5SZ5 A;  3M67 A;  1KEQ A;  3P3J A;  5FLQ A;  1ZFQ A;  3K2F A;  3RYZ A;  3N3J A;  2ZNC A;  4TWL A;  2OSF A;  1IF4 A;  5DOH A;  3MHC A;  4Q90 A;  1AVN A;  3DBU A;  1G3Z A;  4FPT A;  5FDC A;  3OIK A;  5FNK A;  5JDV B;  5E28 A;  3DA2 A;  1I9N A;  1ZSA A;  1DMY A;  5AMG A;  4Z1N A;  3S72 B;  2CAB A;  4FVN A;  3M2Z A;  4QSI A;  4YGJ A;  1CAL A;  5EH5 A;  4ZWZ A;  1BCD A;  4ETQ C;  1LUG A;  2FW4 A;  4KNN A;  4Q8Z A;  4YXU A;  4MLT A;  3HLJ A;  2QO8 A;  3M98 A;  4G7A A;  3W6H A;  4ZWY A;  2X7T A;  1CNW A;  1XEG A;  3V7X A;  4KUV A;  3KOK A;  3LXE A;  5AML A;  5JES B;  4WW8 A;  1RZE A;  5EHW A;  5G01 A;  5DSP A;  4HBA A;  2POW A;  3M5E A;  1I90 A;  3P5A A;  4RFC A;  4Q7S A;  5DVX A;  1J9W A;  1F2W A;  1RZA A;  5FLP A;  1OQ5 A;  1G6V A;  5J8Z A;  4BF1 A;  4Q6D A;  1ZH9 A;  1ZNC A;  3TVN X;  3KOI A;  3S74 B; 
#chains in the Genus database with same CATH homology
 1UGB A;  1G1D A;  3EFT A;  5JGS B;  2Q38 A;  5SZ2 A;  1YO0 A;  5DSK A;  2IT4 A;  5G03 A;  4PZH A;  1BNT A;  3K7K A;  1TG3 A;  3RG3 A;  4MLX A;  3S71 B;  3V2J A;  3P44 A;  4YGN A;  4Q78 A;  3T82 A;  2CA2 A;  4MDL A;  1IF5 A;  3MDZ A;  4DZ7 A;  4WUP A;  3ML5 A;  4QK1 A;  1IF7 A;  1CNG A;  4Q0L A;  3N4B A;  5SZ0 A;  3RZ8 A;  2X7S A;  1XEV A;  2HOC A;  4Q83 A;  3U45 X;  4QSB A;  1FLJ A;  3MNI A;  2NWY A;  4DZ9 A;  3RYX B;  1CRM A;  3Q31 A;  3DC9 A;  1CAN A;  1YDB A;  1HEA A;  1ZFK A;  3OYQ A;  3ZNC A;  3IEO A;  4Q09 A;  3S97 A;  4L5V A;  3HKN A;  2VVA X;  4R5A A;  3IGP A;  1HEC A;  4YGF A;  1TEU X;  7CA2 A;  5IPZ A;  2FOQ A;  1CAZ A;  4R59 A;  1YDA A;  1FSQ A;  1CAJ A;  1OKL A;  5FL5 A;  1YO1 A;  2FOV A;  2W2J A;  3M1J A;  4RUX A;  3S73 B;  1RZB A;  4YXO A;  1Z9Y A;  1AZM A;  1G46 A;  2POV A;  3KNE A;  3IAI A;  2WEH A;  1CAY A;  1KOP A;  4Q49 A;  1BN3 A;  5FLO A;  4HF3 A;  3V3I B;  4LU3 A;  3OIM A;  1G4O A;  2FNN A;  5FNJ A;  5BRU A;  4HEY A;  4QEF A;  1CVF A;  5EKM A;  4KUY A;  4L5W A;  3GZ0 A;  2WEG A;  4COQ A;  1TEQ X;  4Z0Q A;  3T85 A;  3OYS A;  3BL0 A;  4YGL A;  1CNC A;  5FNL A;  3B4F A;  3KS3 A;  3M1Q A;  5FNG A;  3DVB A;  5FNM A;  5CA2 A;  1CVH A;  3C7P A;  3V2M A;  3IBI A;  3DCS A;  3DC3 A;  3RYJ B;  4RIU A;  3CAJ A;  3NI5 A;  5DSM A;  1TH9 A;  2HFW A;  5LMD A;  2QP6 A;  5EH7 A;  1A42 A;  5JQT A;  1XPZ A;  3DVC A;  3KON A;  3U7C A;  4XZ5 A;  4K0T A;  2AW1 A;  1I9Q A;  3CZV A;  3CYU A;  1FR7 A;  1CCU A;  2EZ7 A;  1BN1 A;  2HL4 A;  4Q08 A;  5FLR A;  3W6I A;  3M1W A;  2HNC A;  1H9N A;  1CAM A;  1CAH A;  1YO2 A;  2F14 A;  1I91 A;  1URT A;  4RFD A;  3M5T A;  1ZGE A;  4WL4 A;  1BV3 A;  2QOA A;  5FNI A;  3FE4 A;  4MDM A;  3SBI A;  1FSR A;  4KP5 A;  4HEW A;  3D92 A;  4RUZ A;  1HUH A;  1CNK A;  3S9T A;  2FNM A;  1FQL A;  3RLD A;  1CIN A;  4ZWI A;  5CAC A;  1KWQ A;  1Y7W A;  3HFP A;  5FL4 A;  1RAZ A;  4KNM A;  1G0E A;  3D93 A;  3MNJ A;  5E2S A;  1I9L A;  4QSJ A;  1KWR A;  3DV7 A;  4KNJ A;  1CVA A;  3BL1 A;  1LGD A;  3V5G A;  1ZGF A;  3N2P A;  5EOI A;  3IBL A;  1CCS A;  4E3G A;  1TTM A;  4LHI A;  1CAI A;  3F7B A;  5BNL A;  4QY3 A;  1G0F A;  4LP6 A;  2NNV A;  3P55 A;  3L14 A;  5E5U A;  5G0C A;  5DSQ A;  3F8E A;  1LG6 A;  4JSW A;  4PYX A;  4KAP A;  2AX2 A;  4Q7P A;  1HCA A;  4JSZ A;  1CA3 A;  4JSA A;  4E9O X;  3D8W A;  1CNJ A;  1UGA A;  2OSM A;  3SBH A;  1H9Q A;  3M96 A;  5FDI A;  1RAY A;  5DSN A;  3RZ1 B;  1FQM A;  5DSR A;  4FU5 A;  1CIL A;  4Q6E A;  1H4N A;  3S78 B;  3VBD A;  4QJ0 A;  3T84 A;  4YXI A;  1BNV A;  4TWM A;  4XIX A;  4XE1 A;  3MYQ A;  1G4J A;  3MNK A;  4HT2 A;  3M5S A;  3F7U A;  3MHI A;  4QK2 A;  3MHO A;  1CVB A;  5EKJ A;  2VVB X;  1HUG A;  1EOU A;  1MOO A;  2NN7 A;  4ITO A;  5E2M A;  3KIG A;  3V3J A;  4QK3 A;  4Q7V A;  5EHE A;  1TE3 X;  3T83 A;  8CA2 A;  3DCC A;  1CZM A;  2H15 A;  3MNA A;  3TMJ A;  4Q99 A;  3KWA A;  6CA2 A;  5DOG A;  3D9Z A;  4YWP A;  1RZC A;  3S76 A;  3K34 A;  4L5U A;  4E49 A;  2NXR A;  5SZ3 A;  5E2R A;  1THK A;  5L3O A;  4HU1 A;  1ZSC A;  4ZX0 A;  1MUA A;  3KLD B;  1I9P A;  4R5B A;  4Y0J A;  5JG3 B;  4KP8 A;  4CNX A;  3CA2 A;  4RIV A;  1G45 A;  3OY0 A;  5AMD A;  1BZM A;  4CA2 A;  5EZT X;  4X5S A;  5G0B A;  3U3A X;  3HKU A;  1UGF A;  5DSL A;  4YX4 A;  4MTY A;  1FSN A;  4QJX A;  3ZP9 A;  4ZAO A;  1TBT X;  4Q07 A;  3SAP A;  5C8I A;  1CNX A;  4G0C A;  2CBA A;  3JXH C;  4E4A A;  4IDR X;  5EH8 A;  4Q06 A;  3N0N A;  4Q8X A;  1T9N A;  5JQ0 A;  4CNV A;  4E3D A;  3RZ0 B;  4RUY A;  5DRS A;  1IF8 A;  5DSI A;  1G53 A;  4Q9Y A;  3MZC A;  5E5R A;  1HEB A;  4Z1K A;  4ITP A;  3S75 B;  1HVA A;  3RZ5 A;  4FIK A;  4YGK A;  4E3F A;  5SZ1 A;  2WEO A;  3M3X A;  2POU A;  3M40 A;  9CA2 A;  2EU2 A;  5BRV A;  3U47 A;  4YYT A;  3M2N A;  3NJ9 A;  5E2K A;  4MDG A;  1G54 A;  2CBB A;  2NXS A;  5FL6 A;  1XQ0 A;  1CIM A;  3FW3 A;  4ZWX A;  4Z1E A;  2O4Z A;  4RN4 A;  3MHM A;  4K13 A;  1CA2 A;  1V9E A;  5EHV A;  4BCW A;  1BN4 A;  3V3G B;  1OKM A;  3RJ7 A;  3V3H B;  5CLU A;  3M1K A;  1CNI A;  3T5U A;  4Q8Y A;  3RGE A;  1I8Z A;  1FQR A;  4Z1J A;  1TG9 A;  3D0N A;  2CBE A;  4IWZ A;  4UOV A;  1BNQ A;  3M2Y A;  5JEG B;  1CRA A;  1DCB A;  2WD3 A;  5FLS A;  1KOQ A;  1G52 A;  5JGT B;  4PXX A;  3T5Z A;  2NWZ A;  5DSO A;  4HEZ A;  4XIW A;  4K0S A;  2NWP A;  4KV0 A;  4E5Q A;  4M2V A;  4BF6 A;  3HKT A;  3PO6 A;  4WUQ A;  4M2U A;  2NN1 A;  4CNR A;  4E3H A;  1BNW A;  4M2W A;  4CAC A;  3S77 B;  12CA A;  3UYQ A;  1IF6 A;  3MNH A;  2NWO A;  3DVD A;  4HT0 A;  2Q1Q A;  5JG5 B;  1DMX A;  4RH2 A;  3DCW A;  3RZ7 A;  2FMG A;  5DSJ A;  3HKQ A;  1RZD A;  4K1Q A;  4M2R A;  4KNI A;  1I9O A;  1UGE A;  3M2X A;  4QJP A;  2ABE A;  5A6H A;  4CNW A;  1DCA A;  1JCZ A;  1IF9 A;  2CBC A;  3RYV B;  3F4X A;  1OKN A;  3FFP X;  1LG5 A;  4YHA A;  5JEH B;  1HCB A;  3DD0 A;  1TB0 X;  1Z97 A;  3R17 B;  1CNH A;  4Q81 A;  4K0Z A;  2NMX A;  3HS4 A;  3MWO A;  4N16 A;  3OKV A;  3DAZ A;  4ZX1 A;  1FQN A;  1RJ5 A;  5BRW A;  1BNN A;  5L6K A;  4FL7 A;  4MO8 A;  3DD8 A;  1JD0 A;  3S8X A;  1CCT A;  4QSA A;  4QIZ A;  3RG4 A;  2FMZ A;  3RYY A;  3JXG A;  4N0X B;  2FOU A;  4C3T A;  3QYK A;  1CVD A;  2FOY A;  3NB5 A;  4WR7 A;  1RJ6 A;  2WD2 A;  3V3F A;  4Q87 A;  1CAO A;  5SZ6 A;  3UYN A;  1YDC A;  2NNG A;  4WW6 A;  5EKH A;  4PYY A;  1I9M A;  4Q7W A;  3JXF A;  2GD8 A;  4FRC A;  1UGD A;  1UGG A;  1CAK A;  2WEJ A;  1G48 A;  1Z93 A;  2HD6 A;  2CBD A;  3P3H A;  3KKX A;  5FNH A;  2X7U A;  3R16 A;  1ZSB A;  3EFI A;  3BET A;  1AM6 A;  3P4V A;  3PJJ A;  2ILI A;  1ZE8 A;  4PQ7 A;  2FOS A;  1CNB A;  1UGC A;  1CVC A;  1LZV A;  1FR4 A;  2H4N A;  4CQ0 A;  4YVY A;  5A25 A;  3M14 A;  5E2N A;  5JEP B;  3SAX A;  1BNM A;  2NNS A;  3M04 A;  4QIY A;  3IBN A;  2HKK A;  2Q1B A;  3PYK A;  2GEH A;  3IBU A;  4GL1 X;  4ILX A;  3P58 A;  1BIC A;  1CNY A;  1HED A;  1JV0 A;  2NXT A;  5BYI A;  2EU3 A;  4FVO A;  1CVE A;  4JSS A;  4KUW A;  3P5L A;  4QTL A;  3MMF A;  5EIJ A;  3ML2 A;  5CJF A;  3TVO X;  5HPJ A;  5SZ4 A;  1YDD A;  5SZ7 A;  4QJW A;  3OIL A;  4XFW A;  1V9I C;  3MHL A;  3OKU A;  4QJM A;  3B1B A;  2NNO A;  4QJO A;  5FLT A;  4JS6 A;  3MNU A;  1BNU A;  2FNK A;  5SZ5 A;  3M67 A;  1KEQ A;  3P3J A;  5FLQ A;  1ZFQ A;  3K2F A;  3RYZ A;  3N3J A;  2ZNC A;  4TWL A;  2OSF A;  1IF4 A;  5DOH A;  3MHC A;  4Q90 A;  1AVN A;  3DBU A;  1G3Z A;  4FPT A;  5FDC A;  3OIK A;  5FNK A;  5JDV B;  5E28 A;  3DA2 A;  1I9N A;  1ZSA A;  1DMY A;  5AMG A;  4Z1N A;  3S72 B;  2CAB A;  4FVN A;  3M2Z A;  4QSI A;  4YGJ A;  1CAL A;  5EH5 A;  4ZWZ A;  1BCD A;  4ETQ C;  1LUG A;  2FW4 A;  4KNN A;  4Q8Z A;  4YXU A;  4MLT A;  3HLJ A;  2QO8 A;  3M98 A;  4G7A A;  3W6H A;  4ZWY A;  2X7T A;  1CNW A;  1XEG A;  3V7X A;  4KUV A;  3KOK A;  3LXE A;  5AML A;  5JES B;  4WW8 A;  1RZE A;  5EHW A;  5G01 A;  5DSP A;  4HBA A;  2POW A;  3M5E A;  1I90 A;  3P5A A;  4RFC A;  4Q7S A;  5DVX A;  1J9W A;  1F2W A;  1RZA A;  5FLP A;  1OQ5 A;  1G6V A;  5J8Z A;  4BF1 A;  4Q6D A;  1ZH9 A;  1ZNC A;  3TVN X;  3KOI A;  3S74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...