1HEVA

Hevein: the nmr assignment and an assessment of solution-state folding for the agglutinin-toxin motif
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
43
structure length
43
Chain Sequence
b'EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEVEIN
publication title Hevein: NMR assignment and assessment of solution-state folding for the agglutinin-toxin motif.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lectin
total genus 10
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1993-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1hevA00
1ULMA 1K7VA 7WGAA 1WKXA 4MPIA 1P9ZA 2CWGA 2UVOA 1K7TA 1Q9BA 1UHAA 1P9GA 2X52A 1HEVA 1WGTA 9WGAA 2LB7A 4AMLA 4WP4A 1K7UA 2WGCA 1ULNA 1WGCA 2X3TA 1ULKA 2DKVA
chains in the Genus database with same CATH superfamily
1SGEI 2ORVA 5HI7A 3UGLA 2QPOA 3VE5A 1R79A 2YQPA 1SGNI 2N17A 4FKDA 1LR8A 1CT4I 2KMQA 1KBEA 2RIJA 5JHWC 2N52A 2FNFX 2UZ3A 4UXHA 3FSYA 1KBFA 1OVOA 1WKXA 2P6AC 3OXLA 2SGPI 4MPIA 1XA6A 3TO9A 1Y1BA 2J87A 2CWGA 2OZUA 1Y1CA 5FUWA 2NU0I 2GVIA 2RC4A 3SEKC 1DS3I 2NU3I 1UHAA 1S20A 1SGPI 4DNCA 1IY5A 1HEVA 3VDUA 2L7XA 9WGAA 4E1RA 2Y0MA 3UFFA 1K7UA 5CCLA 1ULNA 2X3TA 1R0RI 1Z7KB 2E73A 5FUVA 2LEOA 1TBOA 1YU6C 3E59A 1ULMA 1RFHA 3R5BA 1K7VA 7WGAA 2WVJA 1OMTA 2QQEA 2QQDA 4A24A 2E5RA 4SGBI 1M8CA 1CT2I 2OU2A 1WTJA 2GKRI 2QQCA 1PJUA 1MT1A 2GKVA 4JCVE 1FY7A 3OXFA 1Z2IA 1CGII 1SGYI 5E3QA 3SGQI 3UOEA 3B4VC 2UVOA 2SGDI 2WCYA 1SGQI 1DS2I 1MJBA 2CWFA 1OMUA 1Q9BA 2K9HA 2KMRA 2N71A 2OD1A 1X74A 2DB6A 2JA1A 2VRWB 2X52A 4E1PA 1BUSA 1W3SA 1VDDA 2SGEI 2KMPA 3BJIA 1TURA 3TOAA 1CGJI 1TIHA 2ENZA 2ORWA 3KY9A 3RU0A 4AMLA 1NXUA 4UXIA 5J8FA 1UUCA 5J8CA 1MJAA 1CHOI 1SGRI 1WGCA 2WGCA 1ULKA 2V1CC 2A20A 2DKVA 2LUYA 2ERWA 3OL0A 1IY6A 1M8BA 2JW6A 2KCXA 2KMOA 4B6DA 1V1HA 2ODDA 2JXDA 1OYVI 2ROWA 5EX0A 1SGDI 1BMOA 1TGSI 1Y8FA 2DIPA 3FSXA 4UXJA 3TOBA 3VDPA 3D00A 3UEYA 3OVOA 3QTLD 1TBNA 2OVOA 1PTRA 1TOTA 4L9MA 5CCMA 2B8TA 4OVOA 1KMAA 3SGBI 3E2IA 1LR9A 1CT0I 2CJSC 2GIVA 1P9GA 1UVFA 2NU1I 3R5AA 2SGQI 3TO6A 1X4SA 3FC3A 4GI3C 2BUSA 5EX3A 1PTQA 2LB7A 4WP4A 1XX6A 2N1AB 3MEKA 2SGFI 1UVGA 1LR7A 5E3PA 1TUSA 3QWPA 3TJQA 5FUYA 2M5XA 1CE3A 5HQ8A 1N13A 1PCEA 1V1IA 3UEJA 1U5KA 1TBQR 3QAHA 1W4RA 2J9RA 1FYBA 2V1CA 2B0UC 2GKTI 1HJAI 2JZMA 3HH2C 3GOXA 1YTPA 3R5DA 5FUXA 1AN1I 1P9ZA 2JYYA 1XBTA 2XRCA 2L8EA 1PPFI 3PDNA 5E3RA 1CSOI 2PQ8A 2QQ0A 1K7TA 1NUBA 2V53A 3TO7A 3R5CA 1MJ9A 2CWHA 2NU4I 2YUUA 4HGUA 1HDLA 1WGTA 2ENNA 1IW4A 2W0TA 3CXLA 1FAQA 2ELIA 5DAEA 1HPTA 3UGIA 2ARPF 2NU2I 3UGDA 2F3CI 1TBRR 3OXGA 1FARA 1H0ZA
chains in the Genus database with same CATH topology
1ULMA 1K7VA 7WGAA 1WKXA 4MPIA 1P9ZA 2CWGA 2UVOA 1K7TA 1Q9BA 1UHAA 1P9GA 2X52A 1HEVA 1WGTA 9WGAA 2LB7A 4AMLA 4WP4A 1K7UA 2WGCA 1ULNA 1WGCA 2X3TA 1ULKA 2DKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULM A;  1K7V A;  7WGA A;  1WKX A;  4MPI A;  1P9Z A;  2CWG A;  2UVO A;  1K7T A;  1Q9B A;  1UHA A;  1P9G A;  2X52 A;  1HEV A;  1WGT A;  9WGA A;  2LB7 A;  4AML A;  4WP4 A;  1K7U A;  2WGC A;  1ULN A;  1WGC A;  2X3T A;  1ULK A;  2DKV A; 
#chains in the Genus database with same CATH topology
 1SGE I;  2ORV A;  5HI7 A;  3UGL A;  2QPO A;  3VE5 A;  1R79 A;  2YQP A;  1SGN I;  2N17 A;  4FKD A;  1LR8 A;  1CT4 I;  2KMQ A;  1KBE A;  2RIJ A;  5JHW C;  2N52 A;  2FNF X;  2UZ3 A;  4UXH A;  3FSY A;  1KBF A;  1OVO A;  1WKX A;  2P6A C;  3OXL A;  2SGP I;  4MPI A;  1XA6 A;  3TO9 A;  1Y1B A;  2J87 A;  2CWG A;  2OZU A;  1Y1C A;  5FUW A;  2NU0 I;  2GVI A;  2RC4 A;  3SEK C;  1DS3 I;  2NU3 I;  1UHA A;  1S20 A;  1SGP I;  4DNC A;  1IY5 A;  1HEV A;  3VDU A;  2L7X A;  9WGA A;  4E1R A;  2Y0M A;  3UFF A;  1K7U A;  5CCL A;  1ULN A;  2X3T A;  1R0R I;  1Z7K B;  2E73 A;  5FUV A;  2LEO A;  1TBO A;  1YU6 C;  3E59 A;  1ULM A;  1RFH A;  3R5B A;  1K7V A;  7WGA A;  2WVJ A;  1OMT A;  2QQE A;  2QQD A;  4A24 A;  2E5R A;  4SGB I;  1M8C A;  1CT2 I;  2OU2 A;  1WTJ A;  2GKR I;  2QQC A;  1PJU A;  1MT1 A;  2GKV A;  4JCV E;  1FY7 A;  3OXF A;  1Z2I A;  1CGI I;  1SGY I;  5E3Q A;  3SGQ I;  3UOE A;  3B4V C;  2UVO A;  2SGD I;  2WCY A;  1SGQ I;  1DS2 I;  1MJB A;  2CWF A;  1OMU A;  1Q9B A;  2K9H A;  2KMR A;  2N71 A;  2OD1 A;  1X74 A;  2DB6 A;  2JA1 A;  2VRW B;  2X52 A;  4E1P A;  1BUS A;  1W3S A;  1VDD A;  2SGE I;  2KMP A;  3BJI A;  1TUR A;  3TOA A;  1CGJ I;  1TIH A;  2ENZ A;  2ORW A;  3KY9 A;  3RU0 A;  4AML A;  1NXU A;  4UXI A;  5J8F A;  1UUC A;  5J8C A;  1MJA A;  1CHO I;  1SGR I;  1WGC A;  2WGC A;  1ULK A;  2V1C C;  2A20 A;  2DKV A;  2LUY A;  2ERW A;  3OL0 A;  1IY6 A;  1M8B A;  2JW6 A;  2KCX A;  2KMO A;  4B6D A;  1V1H A;  2ODD A;  2JXD A;  1OYV I;  2ROW A;  5EX0 A;  1SGD I;  1BMO A;  1TGS I;  1Y8F A;  2DIP A;  3FSX A;  4UXJ A;  3TOB A;  3VDP A;  3D00 A;  3UEY A;  3OVO A;  3QTL D;  1TBN A;  2OVO A;  1PTR A;  1TOT A;  4L9M A;  5CCM A;  2B8T A;  4OVO A;  1KMA A;  3SGB I;  3E2I A;  1LR9 A;  1CT0 I;  2CJS C;  2GIV A;  1P9G A;  1UVF A;  2NU1 I;  3R5A A;  2SGQ I;  3TO6 A;  1X4S A;  3FC3 A;  4GI3 C;  2BUS A;  5EX3 A;  1PTQ A;  2LB7 A;  4WP4 A;  1XX6 A;  2N1A B;  3MEK A;  2SGF I;  1UVG A;  1LR7 A;  5E3P A;  1TUS A;  3QWP A;  3TJQ A;  5FUY A;  2M5X A;  1CE3 A;  5HQ8 A;  1N13 A;  1PCE A;  1V1I A;  3UEJ A;  1U5K A;  1TBQ R;  3QAH A;  1W4R A;  2J9R A;  1FYB A;  2V1C A;  2B0U C;  2GKT I;  1HJA I;  2JZM A;  3HH2 C;  3GOX A;  1YTP A;  3R5D A;  5FUX A;  1AN1 I;  1P9Z A;  2JYY A;  1XBT A;  2XRC A;  2L8E A;  1PPF I;  3PDN A;  5E3R A;  1CSO I;  2PQ8 A;  2QQ0 A;  1K7T A;  1NUB A;  2V53 A;  3TO7 A;  3R5C A;  1MJ9 A;  2CWH A;  2NU4 I;  2YUU A;  4HGU A;  1HDL A;  1WGT A;  2ENN A;  1IW4 A;  2W0T A;  3CXL A;  1FAQ A;  2ELI A;  5DAE A;  1HPT A;  3UGI A;  2ARP F;  2NU2 I;  3UGD A;  2F3C I;  1TBR R;  3OXG A;  1FAR A;  1H0Z A; 
#chains in the Genus database with same CATH homology
 1ULM A;  1K7V A;  7WGA A;  1WKX A;  4MPI A;  1P9Z A;  2CWG A;  2UVO A;  1K7T A;  1Q9B A;  1UHA A;  1P9G A;  2X52 A;  1HEV A;  1WGT A;  9WGA A;  2LB7 A;  4AML A;  4WP4 A;  1K7U A;  2WGC A;  1ULN A;  1WGC A;  2X3T A;  1ULK A;  2DKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...