1HN3A

Solution structure of the n-terminal 37 amino acids of the mouse arf tumor suppressor protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
40
structure length
40
Chain Sequence
GSHMGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords P19 ARF PROTEIN
publication title Solution structure of the p53 regulatory domain of the p19Arf tumor suppressor protein.
pubmed doi rcsb
source organism Mus musculus
total genus 8
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2000-12-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...