1HOYA

Nmr structure of the complex between a-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
molecule tags Toxin
molecule keywords LONG NEUROTOXIN 1
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hoyA00
1KBSA 3FEVA 1IDGA 2CTXA 1IKCA 2JQPA 1CRFA 3HH7A 2J8BA 1MR6A 1NXBA 1CVOA 3U73U 5DZ5A 2NBTA 4HQPF 1CCQA 2UX2A 1IQ9A 3NDSA 4IYEA 1CXNA 3EVSC 3U74U 1KS6A 1KFHA 2QJAC 2HLQA 1CDTA 1HOYA 1G6MA 2BHIA 2PJYC 1NYUA 4XJJA 1I02A 1TFSA 5IMYC 1DRSA 2OFSA 2H7ZA 4FAOE 6EBXA 1FRAA 1KC4A 3KFDE 1KBTA 1BTEA 2JVEA 1ZADA 1CHVS 3BT1U 1FASA 1V6PA 2QJ9C 4EY8B 1XT3A 2MUOA 4OM4A 2MJ0A 1CDRA 1ERGA 2N99A 1H0JA 5EBXA 1LXGA 1FSSB 1NTNA 1QKDA 1YWHA 1IDLA 1MAHF 2CRTA 5DU1A 3PLCA 2MUPA 1CDQA 1HC9B 1KBAA 1LXHA 2VLWA 2BTXA 1CTXA 1UG4A 4QTIU 3NH7A 4BDTB 1FFJA 1HAJA 4UY2C 1L4WA 2HLRA 3NEQA 1KTZB 1ABTA 1KU6B 1NTXA 2L03A 1COEA 1LJZA 1W6BA 4FAOC 1KXIA 2FD6U 1RL5A 2LA1A 1HAAA 3KFDI 1IDHA 1NORA 1BXPA 1B41B 4AEAA 1LX5B 4LFTA 1QM7A 4P7UA 2MFAA 2H64B 3VTSA 2LCRA 1HC9A 1FF4A 1NYSA 2CDXA 1REWC 2H64C 2GOOC 2PJYB 1CREA 1PLOA 1ES7B 1S4YA 1TXBA 4ZQYA 1JGKA 1CB9A 1FSCA 2MHYA 2CCXA 1IJCA 4RUDA 2MJYA 1IDIA 1NEAA 1TXAA 2H62D 1IK8A 2H5FA 4OM5A 1ERAA 1QKEA 2CRSA 1CODA 2MJ4A 1LSIA 1F8UB 2ABXA 1CXOA 2H7ZB 1JE9A 5DO6A 1M9ZA 3LAQU 2UWRA 1VB0A 5IMTD 1F94A 1KL8A 2H8UA 2QJBC 2GOOB 1CDSA 4BIKB 4DO8A 1TGXA 2ERAA 1RGJA 2L5SA 2I9BE 3ERAA 3QB4B 3BT2U 2X8BB 2QC1A 2K3GA 2H62C 3EBXA 1JBDA 1ONJA
chains in the Genus database with same CATH superfamily
1KBSA 3FEVA 1IDGA 2CTXA 1IKCA 2JQPA 1CRFA 3HH7A 2J8BA 1MR6A 1NXBA 1CVOA 3U73U 5DZ5A 2NBTA 4HQPF 1CCQA 2UX2A 1IQ9A 3NDSA 4IYEA 1CXNA 3EVSC 3U74U 1KS6A 1KFHA 2QJAC 2HLQA 1CDTA 1HOYA 1G6MA 2BHIA 2PJYC 1NYUA 4XJJA 1I02A 1TFSA 5IMYC 1DRSA 2OFSA 2H7ZA 4FAOE 6EBXA 1FRAA 1KC4A 3KFDE 1KBTA 1BTEA 2JVEA 1ZADA 1CHVS 3BT1U 1FASA 1V6PA 2QJ9C 4EY8B 1XT3A 2MUOA 4OM4A 2MJ0A 1CDRA 1ERGA 2N99A 1H0JA 5EBXA 1LXGA 1FSSB 1NTNA 1QKDA 1YWHA 1IDLA 1MAHF 2CRTA 5DU1A 3PLCA 2MUPA 1CDQA 1HC9B 1KBAA 1LXHA 2VLWA 2BTXA 1CTXA 1UG4A 4QTIU 3NH7A 4BDTB 1FFJA 1HAJA 4UY2C 1L4WA 2HLRA 3NEQA 1KTZB 1ABTA 1KU6B 1NTXA 2L03A 1COEA 1LJZA 1W6BA 4FAOC 1KXIA 2FD6U 1RL5A 2LA1A 1HAAA 3KFDI 1IDHA 1NORA 1BXPA 1B41B 4AEAA 1LX5B 4LFTA 1QM7A 4P7UA 2MFAA 2H64B 3VTSA 2LCRA 1HC9A 1FF4A 1NYSA 2CDXA 1REWC 2H64C 2GOOC 2PJYB 1CREA 1PLOA 1ES7B 1S4YA 1TXBA 4ZQYA 1JGKA 1CB9A 1FSCA 2MHYA 2CCXA 1IJCA 4RUDA 2MJYA 1IDIA 1NEAA 1TXAA 2H62D 1IK8A 2H5FA 4OM5A 1ERAA 1QKEA 2CRSA 1CODA 2MJ4A 1LSIA 1F8UB 2ABXA 1CXOA 2H7ZB 1JE9A 5DO6A 1M9ZA 3LAQU 2UWRA 4KSNA 1VB0A 5IMTD 1F94A 1KL8A 2H8UA 2QJBC 2GOOB 1CDSA 4BIKB 4DO8A 1TGXA 2ERAA 1RGJA 2L5SA 2I9BE 3ERAA 3QB4B 3BT2U 2X8BB 2QC1A 2K3GA 2H62C 3EBXA 1JBDA 1ONJA
chains in the Genus database with same CATH topology
1KBSA 3FEVA 1IDGA 2CTXA 1IKCA 2JQPA 1CRFA 3HH7A 2J8BA 1MR6A 1NXBA 1CVOA 3U73U 5DZ5A 2NBTA 4HQPF 1CCQA 2UX2A 1IQ9A 3NDSA 4IYEA 1CXNA 3EVSC 3U74U 1KS6A 1KFHA 2QJAC 2HLQA 1CDTA 1HOYA 1G6MA 2BHIA 2PJYC 1NYUA 4XJJA 1I02A 1TFSA 5IMYC 1DRSA 2OFSA 2H7ZA 4FAOE 6EBXA 1FRAA 1KC4A 3KFDE 1KBTA 1BTEA 2JVEA 1ZADA 1CHVS 3BT1U 1FASA 1V6PA 2QJ9C 4EY8B 1XT3A 2MUOA 4OM4A 2MJ0A 1CDRA 1ERGA 2N99A 1H0JA 5EBXA 1LXGA 1FSSB 1NTNA 1QKDA 1YWHA 1IDLA 1MAHF 2CRTA 5DU1A 3PLCA 2MUPA 1CDQA 1HC9B 1KBAA 1LXHA 2VLWA 2BTXA 1CTXA 1UG4A 4QTIU 3NH7A 4BDTB 1FFJA 1HAJA 4UY2C 1L4WA 2HLRA 3NEQA 1KTZB 1ABTA 1KU6B 1NTXA 2L03A 1COEA 1LJZA 1W6BA 4FAOC 1KXIA 2FD6U 1RL5A 2LA1A 1HAAA 3KFDI 1IDHA 1NORA 1BXPA 1B41B 4AEAA 1LX5B 4LFTA 1QM7A 4P7UA 2MFAA 2H64B 3VTSA 2LCRA 1HC9A 1FF4A 1NYSA 2CDXA 1REWC 2H64C 2GOOC 2PJYB 1CREA 1PLOA 1ES7B 1S4YA 1TXBA 4ZQYA 1JGKA 1CB9A 1FSCA 2MHYA 2CCXA 1IJCA 4RUDA 2MJYA 1IDIA 1NEAA 1TXAA 2H62D 1IK8A 2H5FA 4OM5A 1ERAA 1QKEA 2CRSA 1CODA 2MJ4A 1LSIA 1F8UB 2ABXA 1CXOA 2H7ZB 1JE9A 5DO6A 1M9ZA 3LAQU 2UWRA 4KSNA 1VB0A 5IMTD 1F94A 1KL8A 2H8UA 2QJBC 2GOOB 1CDSA 4BIKB 4DO8A 1TGXA 2ERAA 1RGJA 2L5SA 2I9BE 3ERAA 3QB4B 3BT2U 2X8BB 2QC1A 2K3GA 2H62C 3EBXA 1JBDA 1ONJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBS A;  3FEV A;  1IDG A;  2CTX A;  1IKC A;  2JQP A;  1CRF A;  3HH7 A;  2J8B A;  1MR6 A;  1NXB A;  1CVO A;  3U73 U;  5DZ5 A;  2NBT A;  4HQP F;  1CCQ A;  2UX2 A;  1IQ9 A;  3NDS A;  4IYE A;  1CXN A;  3EVS C;  3U74 U;  1KS6 A;  1KFH A;  2QJA C;  2HLQ A;  1CDT A;  1HOY A;  1G6M A;  2BHI A;  2PJY C;  1NYU A;  4XJJ A;  1I02 A;  1TFS A;  5IMY C;  1DRS A;  2OFS A;  2H7Z A;  4FAO E;  6EBX A;  1FRA A;  1KC4 A;  3KFD E;  1KBT A;  1BTE A;  2JVE A;  1ZAD A;  1CHV S;  3BT1 U;  1FAS A;  1V6P A;  2QJ9 C;  4EY8 B;  1XT3 A;  2MUO A;  4OM4 A;  2MJ0 A;  1CDR A;  1ERG A;  2N99 A;  1H0J A;  5EBX A;  1LXG A;  1FSS B;  1NTN A;  1QKD A;  1YWH A;  1IDL A;  1MAH F;  2CRT A;  5DU1 A;  3PLC A;  2MUP A;  1CDQ A;  1HC9 B;  1KBA A;  1LXH A;  2VLW A;  2BTX A;  1CTX A;  1UG4 A;  4QTI U;  3NH7 A;  4BDT B;  1FFJ A;  1HAJ A;  4UY2 C;  1L4W A;  2HLR A;  3NEQ A;  1KTZ B;  1ABT A;  1KU6 B;  1NTX A;  2L03 A;  1COE A;  1LJZ A;  1W6B A;  4FAO C;  1KXI A;  2FD6 U;  1RL5 A;  2LA1 A;  1HAA A;  3KFD I;  1IDH A;  1NOR A;  1BXP A;  1B41 B;  4AEA A;  1LX5 B;  4LFT A;  1QM7 A;  4P7U A;  2MFA A;  2H64 B;  3VTS A;  2LCR A;  1HC9 A;  1FF4 A;  1NYS A;  2CDX A;  1REW C;  2H64 C;  2GOO C;  2PJY B;  1CRE A;  1PLO A;  1ES7 B;  1S4Y A;  1TXB A;  4ZQY A;  1JGK A;  1CB9 A;  1FSC A;  2MHY A;  2CCX A;  1IJC A;  4RUD A;  2MJY A;  1IDI A;  1NEA A;  1TXA A;  2H62 D;  1IK8 A;  2H5F A;  4OM5 A;  1ERA A;  1QKE A;  2CRS A;  1COD A;  2MJ4 A;  1LSI A;  1F8U B;  2ABX A;  1CXO A;  2H7Z B;  1JE9 A;  5DO6 A;  1M9Z A;  3LAQ U;  2UWR A;  1VB0 A;  5IMT D;  1F94 A;  1KL8 A;  2H8U A;  2QJB C;  2GOO B;  1CDS A;  4BIK B;  4DO8 A;  1TGX A;  2ERA A;  1RGJ A;  2L5S A;  2I9B E;  3ERA A;  3QB4 B;  3BT2 U;  2X8B B;  2QC1 A;  2K3G A;  2H62 C;  3EBX A;  1JBD A;  1ONJ A; 
#chains in the Genus database with same CATH topology
 1KBS A;  3FEV A;  1IDG A;  2CTX A;  1IKC A;  2JQP A;  1CRF A;  3HH7 A;  2J8B A;  1MR6 A;  1NXB A;  1CVO A;  3U73 U;  5DZ5 A;  2NBT A;  4HQP F;  1CCQ A;  2UX2 A;  1IQ9 A;  3NDS A;  4IYE A;  1CXN A;  3EVS C;  3U74 U;  1KS6 A;  1KFH A;  2QJA C;  2HLQ A;  1CDT A;  1HOY A;  1G6M A;  2BHI A;  2PJY C;  1NYU A;  4XJJ A;  1I02 A;  1TFS A;  5IMY C;  1DRS A;  2OFS A;  2H7Z A;  4FAO E;  6EBX A;  1FRA A;  1KC4 A;  3KFD E;  1KBT A;  1BTE A;  2JVE A;  1ZAD A;  1CHV S;  3BT1 U;  1FAS A;  1V6P A;  2QJ9 C;  4EY8 B;  1XT3 A;  2MUO A;  4OM4 A;  2MJ0 A;  1CDR A;  1ERG A;  2N99 A;  1H0J A;  5EBX A;  1LXG A;  1FSS B;  1NTN A;  1QKD A;  1YWH A;  1IDL A;  1MAH F;  2CRT A;  5DU1 A;  3PLC A;  2MUP A;  1CDQ A;  1HC9 B;  1KBA A;  1LXH A;  2VLW A;  2BTX A;  1CTX A;  1UG4 A;  4QTI U;  3NH7 A;  4BDT B;  1FFJ A;  1HAJ A;  4UY2 C;  1L4W A;  2HLR A;  3NEQ A;  1KTZ B;  1ABT A;  1KU6 B;  1NTX A;  2L03 A;  1COE A;  1LJZ A;  1W6B A;  4FAO C;  1KXI A;  2FD6 U;  1RL5 A;  2LA1 A;  1HAA A;  3KFD I;  1IDH A;  1NOR A;  1BXP A;  1B41 B;  4AEA A;  1LX5 B;  4LFT A;  1QM7 A;  4P7U A;  2MFA A;  2H64 B;  3VTS A;  2LCR A;  1HC9 A;  1FF4 A;  1NYS A;  2CDX A;  1REW C;  2H64 C;  2GOO C;  2PJY B;  1CRE A;  1PLO A;  1ES7 B;  1S4Y A;  1TXB A;  4ZQY A;  1JGK A;  1CB9 A;  1FSC A;  2MHY A;  2CCX A;  1IJC A;  4RUD A;  2MJY A;  1IDI A;  1NEA A;  1TXA A;  2H62 D;  1IK8 A;  2H5F A;  4OM5 A;  1ERA A;  1QKE A;  2CRS A;  1COD A;  2MJ4 A;  1LSI A;  1F8U B;  2ABX A;  1CXO A;  2H7Z B;  1JE9 A;  5DO6 A;  1M9Z A;  3LAQ U;  2UWR A;  4KSN A;  1VB0 A;  5IMT D;  1F94 A;  1KL8 A;  2H8U A;  2QJB C;  2GOO B;  1CDS A;  4BIK B;  4DO8 A;  1TGX A;  2ERA A;  1RGJ A;  2L5S A;  2I9B E;  3ERA A;  3QB4 B;  3BT2 U;  2X8B B;  2QC1 A;  2K3G A;  2H62 C;  3EBX A;  1JBD A;  1ONJ A; 
#chains in the Genus database with same CATH homology
 1KBS A;  3FEV A;  1IDG A;  2CTX A;  1IKC A;  2JQP A;  1CRF A;  3HH7 A;  2J8B A;  1MR6 A;  1NXB A;  1CVO A;  3U73 U;  5DZ5 A;  2NBT A;  4HQP F;  1CCQ A;  2UX2 A;  1IQ9 A;  3NDS A;  4IYE A;  1CXN A;  3EVS C;  3U74 U;  1KS6 A;  1KFH A;  2QJA C;  2HLQ A;  1CDT A;  1HOY A;  1G6M A;  2BHI A;  2PJY C;  1NYU A;  4XJJ A;  1I02 A;  1TFS A;  5IMY C;  1DRS A;  2OFS A;  2H7Z A;  4FAO E;  6EBX A;  1FRA A;  1KC4 A;  3KFD E;  1KBT A;  1BTE A;  2JVE A;  1ZAD A;  1CHV S;  3BT1 U;  1FAS A;  1V6P A;  2QJ9 C;  4EY8 B;  1XT3 A;  2MUO A;  4OM4 A;  2MJ0 A;  1CDR A;  1ERG A;  2N99 A;  1H0J A;  5EBX A;  1LXG A;  1FSS B;  1NTN A;  1QKD A;  1YWH A;  1IDL A;  1MAH F;  2CRT A;  5DU1 A;  3PLC A;  2MUP A;  1CDQ A;  1HC9 B;  1KBA A;  1LXH A;  2VLW A;  2BTX A;  1CTX A;  1UG4 A;  4QTI U;  3NH7 A;  4BDT B;  1FFJ A;  1HAJ A;  4UY2 C;  1L4W A;  2HLR A;  3NEQ A;  1KTZ B;  1ABT A;  1KU6 B;  1NTX A;  2L03 A;  1COE A;  1LJZ A;  1W6B A;  4FAO C;  1KXI A;  2FD6 U;  1RL5 A;  2LA1 A;  1HAA A;  3KFD I;  1IDH A;  1NOR A;  1BXP A;  1B41 B;  4AEA A;  1LX5 B;  4LFT A;  1QM7 A;  4P7U A;  2MFA A;  2H64 B;  3VTS A;  2LCR A;  1HC9 A;  1FF4 A;  1NYS A;  2CDX A;  1REW C;  2H64 C;  2GOO C;  2PJY B;  1CRE A;  1PLO A;  1ES7 B;  1S4Y A;  1TXB A;  4ZQY A;  1JGK A;  1CB9 A;  1FSC A;  2MHY A;  2CCX A;  1IJC A;  4RUD A;  2MJY A;  1IDI A;  1NEA A;  1TXA A;  2H62 D;  1IK8 A;  2H5F A;  4OM5 A;  1ERA A;  1QKE A;  2CRS A;  1COD A;  2MJ4 A;  1LSI A;  1F8U B;  2ABX A;  1CXO A;  2H7Z B;  1JE9 A;  5DO6 A;  1M9Z A;  3LAQ U;  2UWR A;  4KSN A;  1VB0 A;  5IMT D;  1F94 A;  1KL8 A;  2H8U A;  2QJB C;  2GOO B;  1CDS A;  4BIK B;  4DO8 A;  1TGX A;  2ERA A;  1RGJ A;  2L5S A;  2I9B E;  3ERA A;  3QB4 B;  3BT2 U;  2X8B B;  2QC1 A;  2K3G A;  2H62 C;  3EBX A;  1JBD A;  1ONJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...