1HQIA

Component p2 from the multicomponent phenol hydroxylase, nmr, 11 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
b'MSSLVYIAFQDNDNARYVVEAIIQDNPHAVVQHHPAMIRIEAEKRLEIRRETVEENLGRAWDVQEMLVDVITIGGNVDEDDDRFVLEWKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHENOL HYDROXYLASE P2 PROTEIN
publication title Solution structure of phenol hydroxylase protein component P2 determined by NMR spectroscopy.
pubmed doi rcsb
molecule tags Hydroxylase
total genus 13
structure length 90
sequence length 90
ec nomenclature ec 1.14.13.7: Phenol 2-monooxygenase (NADPH).
pdb deposition date 1996-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02406 MmoB_DmpM MmoB/DmpM family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.56.10 Alpha Beta Alpha-Beta Complex Phenol Hydroxylase P2 Protein Monooxygenase component MmoB/DmpM 1hqiA00
2BF3B 3Q3ME 2BF2A 2BF3A 3DHIE 2BF5A 2INNL 3Q2AE 2INPL 1G11A 1HQIA 3Q14E 1CKVA 1G10A 3I5JE 3Q3OE 3GE3E 3I63E 3DHHE 3RI7E 3Q3NE 2MOBA 4GAMD 3GE8E
chains in the Genus database with same CATH superfamily
2BF3B 3Q3ME 2BF2A 2BF3A 3DHIE 2BF5A 2INNL 3Q2AE 2INPL 1G11A 1HQIA 3Q14E 1CKVA 1G10A 3I5JE 3Q3OE 3GE3E 3I63E 3DHHE 3RI7E 3Q3NE 2MOBA 4GAMD 3GE8E
chains in the Genus database with same CATH topology
2BF3B 3Q3ME 2BF2A 2BF3A 3DHIE 2BF5A 2INNL 3Q2AE 2INPL 1G11A 1HQIA 3Q14E 1CKVA 1G10A 3I5JE 3Q3OE 3GE3E 3I63E 3DHHE 3RI7E 3Q3NE 2MOBA 4GAMD 3GE8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BF3 B;  3Q3M E;  2BF2 A;  2BF3 A;  3DHI E;  2BF5 A;  2INN L;  3Q2A E;  2INP L;  1G11 A;  1HQI A;  3Q14 E;  1CKV A;  1G10 A;  3I5J E;  3Q3O E;  3GE3 E;  3I63 E;  3DHH E;  3RI7 E;  3Q3N E;  2MOB A;  4GAM D;  3GE8 E; 
#chains in the Genus database with same CATH topology
 2BF3 B;  3Q3M E;  2BF2 A;  2BF3 A;  3DHI E;  2BF5 A;  2INN L;  3Q2A E;  2INP L;  1G11 A;  1HQI A;  3Q14 E;  1CKV A;  1G10 A;  3I5J E;  3Q3O E;  3GE3 E;  3I63 E;  3DHH E;  3RI7 E;  3Q3N E;  2MOB A;  4GAM D;  3GE8 E; 
#chains in the Genus database with same CATH homology
 2BF3 B;  3Q3M E;  2BF2 A;  2BF3 A;  3DHI E;  2BF5 A;  2INN L;  3Q2A E;  2INP L;  1G11 A;  1HQI A;  3Q14 E;  1CKV A;  1G10 A;  3I5J E;  3Q3O E;  3GE3 E;  3I63 E;  3DHH E;  3RI7 E;  3Q3N E;  2MOB A;  4GAM D;  3GE8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...