1HYIA

Solution structure of the eea1 fyve domain complexed with inositol 1,3-bisphosphate
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of endosome docking by the FYVE domain.
pubmed doi rcsb
molecule keywords ENDOSOME-ASSOCIATED PROTEIN
molecule tags Endocytosis/exocytosis
source organism Homo sapiens
total genus 7
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1hyiA00
2KWOA 5G05B 2YYRA 4FO9A 1CHCA 1HYJA 2MNZA 1V87A 2YURA 3MHHA 3PURA 3U5PA 4N3WA 4LJNA 3RTRB 2BAYA 4AVXA 2KWJA 3EB6A 4YABA 2G45A 2KREA 5TBNA 2M6MA 4F52B 2L43A 3HCTA 3U5NA 4BBQA 3LQJA 1FBVA 5JG6A 4YADA 2LGKA 2L0BA 2YUCA 2LDRA 3N9LA 1RMDA 2M1RA 4B86C 5LKZA 1WFKA 2EA6A 4L7XA 2VJFB 5TDRA 5G04B 2LGLA 5FEYA 2KWNA 2NAAA 4O64A 3LQHA 2ECVA 4FK5A 3O33A 2EGPA 5EYAF 3N9MA 1F62A 5I3LA 5H9MA 2PNXA 2ECIA 2ECWA 3MHSA 4WZ3B 1LDKC 3ZVZB 2L80A 2VP7A 4V3KC 3ZPV1 5KH7A 2MD8C 4ZQLA 1X4JA 5KH3A 5D1KB 2LGVA 2YQMA 3SHBA 2YSMA 4CA1A 1N87A 3ZTGA 1WIMA 2LV9A 1VFYA 3C6WA 3U5OA 4I7CA 4WZ2A 2YREA 3L1XA 2PUYA 3L11A 1X4IA 2CSYA 2HYED 4LK9A 3ZYQA 2QIZA 2F6NA 2MT5A 5TRBA 3N9PA 2FUIA 3FL2A 2M85A 3VK6A 5H1TA 3SOWA 4UI9B 1HYIA 4Q6FA 2E6SA 5LKXA 2RI7A 4QF2A 1JM7A 4A49A 4FIPA 5H1VA 1IYMA 1WEPA 1FP0A 1Z6UA 4FJCA 2LGGA 3SOXA 5B79A 1WEEA 4R2YA 4P5OB 3C5KA 4A4BA 2FUUA 2ECGA 2MUMA 2FSAA 4V3LC 1ZBDB 2MD7B 2LRIC 4ZDTA 4YBSA 4TKPB 3V43A 2YSJA 4NN2A 1XWHA 2F42A 2YHOA 3HTKC 2XEUA 3PHDA 2LXHC 2L5UA 1Z2QA 2QICA 4AYCA 1WEQA 2QJ0A 2MIQA 4UP0A 2Y1MA 4N4FA 4GNDA 4YAXA 1VD4A 2VJEA 3IHPA 3O70A 4L58A 4IC3A 2MNYA 2VJEB 4BHWA 2ECJA 1K2FA 3QZVA 4UP5A 2CSZA 2KYUA 3EB5A 2JRJA 4B7YC 4AUQB 5DINA 5J3XA 3O7AA 4A0CD 1WEVA 2VPDA 4S3OC 1DVPA 2MA5A 2H0DA 5FB1A 2XB1A 4CCGX 1WEMA 4YC9A 3I2DA 2CT2A 2AN6A 5DKAA 3N9NA 5LKUA 3ZVYA 2G43A 2K16A 2K17A 1LDJB 2CKLA 2VPEA 3RPGC 3KV6A 2M3HA 3O35A 1E4UA 5B78A 3ASLA 5B8DA 2KE1A 3ZNIA 1G25A 3SOUA 3LQIA 1WILA 2ECNA 2Y43A 4C9ZA 4WA6A 4WZ0A 2L75A 1WEWA 4QF3A 5D1MB 2JMIA 2DX8A 3PUQA 2YHNA 3M99A 1WEOA 4MVTA 2G6QA 1U6GB 1Z60A 1BORA 2LN0A 1JM7B 3LRQA 3KNVA 3M62A 4I7BA 3DPLR 2KGGA 2JMDA 5B76A 3KV5A 2MA6A 2K1JA 5FERA 5TDWA 2HDPA 4X3GA 2KWKA 5B77A 5AITA 1VYXA 1T1HA 2F6JA 1WGMA 5FB0A 1WESA 2LQ6A 3N9OA 4LADB 1JOCA 2YQLA 2VPBA 4AYCB 2ECTA 2RSDA 3L1ZB 4ZUXU 5D1LB 2K4DA 3O34A 5C11A 5KH9A 3M63A 2KR4A 3DQVR 5G0FA 2ZETC 5AIUA 1X4UA 2C2LA 4IC2A 2VNFA 3KQIA 2VJFA 2YU4A 2E6RA 2OXQC 3GV4A 3T6RA 4PPEA 5C13A 5LCWB 2UZGA 2YT5A 3T7LA 2IDAA 5B75A 4AP4A 4I7DA 4XI1A 5H1UA 4GNFA 2H0DB 4R7EA 2LXPC 4YBMA 4S3OB 3NG2A 3O36A 4MSXA 5TABA 4GB0A 5LKTA 1WE9A 4LKAA 4A4CA 4R8PK 2KIZA 3ZPVE 2I50A 1WEUA 2CKLB 3HCUA 2KU3A 2KFTA 2KGIA 2C2VS 2VPGA 3O37A 2D8SA 3GL6A 2EODA 3U5MA 4PTBA 3RPGB 3HCSA 3N9QA 4GNEA 1MM2A 1MM3A 1WENA 4YBTA 4GNGA 4LLBA 2YW8A 4YATA 4W4UA 2Y1NA 2JMJA
chains in the Genus database with same CATH superfamily
2KWOA 5G05B 2YYRA 4FO9A 1CHCA 3LVRE 1HYJA 2MNZA 1V87A 2YURA 2YVRA 3MHHA 3PURA 3U5PA 2B0OE 4N3WA 4LJNA 3RTRB 3MDBC 2BAYA 2JUNA 4AVXA 2KWJA 3EB6A 4YABA 2G45A 2KREA 5TBNA 2M6MA 4F52B 3LVQE 2L43A 3HCTA 3U5NA 4BBQA 3LQJA 1FBVA 5JG6A 4YADA 2LGKA 2L0BA 2CONA 2YUCA 2LDRA 2L7PA 3N9LA 1RMDA 2M1RA 4B86C 5LKZA 1WFKA 2EA6A 4L7XA 2VJFB 4O62A 5TDRA 5G04B 2LGLA 4Z0OA 5FEYA 2KWNA 3FANA 2NAAA 4O64A 3LQHA 2ECVA 4FK5A 3O33A 2EGPA 5EYAF 3N9MA 1F62A 5I3LA 2M13A 5H9MA 2PNXA 2ECIA 3E2DA 2ECWA 3MHSA 4WZ3B 1LDKC 3ZVZB 2L80A 2VP7A 4V3KC 3ZPV1 5KH7A 2XP0A 2MD8C 4ZQLA 1X4JA 5KH3A 5D1KB 2LGVA 2YQMA 3SHBA 2YSMA 4CA1A 1N87A 3ZTGA 1WIMA 2LV9A 1VFYA 3C6WA 3U5OA 3O47A 4I7CA 4WZ2A 2YREA 3L1XA 2PUYA 3L11A 1X4IA 2CSYA 2HYED 4LK9A 3SUBA 3ZYQA 2QIZA 2F6NA 2MT5A 5TRBA 2D8UA 3N9PA 2FUIA 3FJUB 3FL2A 5K3QA 3LDYA 2M85A 3VK6A 5H1TA 3SOWA 4F1PA 4UI9B 2OWAA 1HYIA 4Q6FA 2E6SA 5LKXA 2RI7A 4QF2A 1JM7A 4A49A 4FIPA 5H1VA 1IYMA 1WEPA 1FP0A 1Z6UA 4OGEA 4FJCA 2LGGA 3SOXA 5B79A 1WEEA 4R2YA 4P5OB 3C5KA 4A4BA 2FUUA 2ECGA 2MUMA 3Q1DA 2LAUA 2KKYA 3H7HA 2FSAA 4V3LC 1ZBDB 2MD7B 2LRIC 4ZDTA 4YBSA 4TKPB 3V43A 2YSJA 4NN2A 1XWHA 2F42A 2YHOA 3HTKC 2XEUA 3PHDA 2LXHC 2L5UA 1Z2QA 2QICA 4AYCA 1WEQA 2QJ0A 2MIQA 4UP0A 2Y1MA 4N4FA 4GNDA 4YAXA 1VD4A 2VJEA 3IHPA 3O70A 4L58A 4IC3A 2MNYA 2VJEB 4BHWA 2CSVA 2ECJA 1K2FA 2DJAA 3QZVA 4UP5A 2CSZA 2KYUA 3EB5A 2JRJA 4B7YC 4AUQB 5DINA 5J3XA 3O7AA 4A0CD 1WEVA 2VPDA 4S3OC 1DVPA 3PLWA 2MA5A 2H0DA 5FB1A 2XB1A 4CCGX 1WEMA 4YC9A 3I2DA 2CT2A 2AN6A 3FEHA 5DKAA 5SVXA 3N9NA 5LKUA 3KDEC 3ZVYA 2G43A 2K16A 2K17A 1LDJB 1DCQA 2CKLA 2VPEA 3RPGC 3KV6A 2M3HA 3O35A 1E4UA 5B78A 3ASLA 5B8DA 2KE1A 2IQJA 3ZNIA 1G25A 3SOUA 2DSMA 3LQIA 1WILA 2ECNA 5SVYA 3JUEA 2Y43A 4C9ZA 4WA6A 4WZ0A 2EXUA 2L75A 1WEWA 4QF3A 5D1MB 2JMIA 2JM3A 2DX8A 1MBMA 4OGCA 3PUQA 2YHNA 3M99A 1WEOA 4MVTA 2G6QA 1U6GB 1Z60A 1BORA 2KKXA 2LN0A 2XOYA 1JM7B 3LRQA 3M62A 3KNVA 3LJUX 4I7BA 3DPLR 2KGGA 2JMDA 5B76A 3KV5A 2MA6A 4H9DA 2MKEA 2K1JA 5FERA 5TDWA 2HDPA 4X3GA 2KWKA 3FM8C 5B77A 5AITA 1VYXA 2FFWA 1T1HA 2F6JA 1WGMA 5FB0A 1WESA 2LQ6A 5SVIA 3N9OA 5SVIB 4LADB 2CRWA 2EGMA 1JOCA 2YQLA 2VPBA 4AYCB 2ECTA 2RSDA 3L1ZB 4ZUXU 5D1LB 2K4DA 3O34A 5C11A 5KH9A 3M63A 2KR4A 3DQVR 3M7KA 2XOZA 5G0FA 2ZETC 5AIUA 2RR4A 1X4UA 2C2LA 4IC2A 2VNFA 3KQIA 2VJFA 2YU4A 2E6RA 2OXQC 3GV4A 3T6RA 4PPEA 5C13A 5LCWB 2UZGA 2YT5A 3T9KA 3T7LA 2IDAA 5B75A 4AP4A 4I7DA 4XI1A 3DWDA 5H1UA 4GNFA 2H0DB 4R7EA 2CRRA 2LXPC 4YBMA 4S3OB 3NG2A 3O36A 4MSXA 2XOCA 5TABA 4GB0A 5LKTA 1WE9A 4LKAA 4A4CA 4R8PK 2KIZA 3ZPVE 2I50A 1WEUA 2CKLB 3HCUA 2KU3A 2FD4A 2KFTA 2KGIA 2C2VS 2VPGA 3O37A 2D8SA 3GL6A 2EODA 3U5MA 4PTBA 3RPGB 3HCSA 3N9QA 4GNEA 1MM2A 2P57A 4QQ4A 3DDTA 4Z0RA 1MM3A 3FAOA 1WENA 4YBTA 4GNGA 2E61A 4LLBA 2YW8A 4YATA 4W4UA 2Y1NA 2JMJA
chains in the Genus database with same CATH topology
2KWOA 5G05B 2YYRA 4FO9A 1CHCA 1HYJA 2MNZA 1V87A 2YURA 3MHHA 3PURA 3U5PA 4N3WA 4LJNA 3RTRB 2BAYA 4AVXA 2KWJA 3EB6A 4YABA 2G45A 2KREA 5TBNA 2M6MA 4F52B 2L43A 3HCTA 3U5NA 4BBQA 3LQJA 1FBVA 5JG6A 4YADA 2LGKA 2L0BA 2YUCA 2LDRA 3N9LA 1RMDA 2M1RA 4B86C 5LKZA 1WFKA 2EA6A 4L7XA 2VJFB 5TDRA 5G04B 2LGLA 5FEYA 2KWNA 2NAAA 4O64A 3LQHA 2ECVA 4FK5A 3O33A 2EGPA 5EYAF 3N9MA 1F62A 5I3LA 5H9MA 2PNXA 2ECIA 2ECWA 3MHSA 4WZ3B 1LDKC 3ZVZB 2L80A 2VP7A 4V3KC 3ZPV1 5KH7A 2MD8C 4ZQLA 1X4JA 5KH3A 5D1KB 2LGVA 2YQMA 3SHBA 2YSMA 4CA1A 1N87A 3ZTGA 1WIMA 2LV9A 1VFYA 3C6WA 3U5OA 4I7CA 4WZ2A 2YREA 3L1XA 2PUYA 3L11A 1X4IA 2CSYA 2HYED 4LK9A 3ZYQA 2QIZA 2F6NA 2MT5A 5TRBA 3N9PA 2FUIA 3FL2A 2M85A 3VK6A 5H1TA 3SOWA 4UI9B 1HYIA 4Q6FA 2E6SA 5LKXA 2RI7A 4QF2A 1JM7A 4A49A 4FIPA 5H1VA 1IYMA 1WEPA 1FP0A 1Z6UA 4FJCA 2LGGA 3SOXA 5B79A 1WEEA 4R2YA 4P5OB 3C5KA 4A4BA 2FUUA 2ECGA 2MUMA 2FSAA 4V3LC 1ZBDB 2MD7B 2LRIC 4ZDTA 4YBSA 4TKPB 3V43A 2YSJA 4NN2A 1XWHA 2F42A 2YHOA 3HTKC 2XEUA 3PHDA 2LXHC 2L5UA 1Z2QA 2QICA 4AYCA 1WEQA 2QJ0A 2MIQA 4UP0A 2Y1MA 4N4FA 4GNDA 4YAXA 1VD4A 2VJEA 3IHPA 3O70A 4L58A 4IC3A 2MNYA 2VJEB 4BHWA 2ECJA 1K2FA 3QZVA 4UP5A 2CSZA 2KYUA 3EB5A 2JRJA 4B7YC 4AUQB 5DINA 5J3XA 3O7AA 4A0CD 1WEVA 2VPDA 4S3OC 1DVPA 2MA5A 2H0DA 5FB1A 2XB1A 4CCGX 1WEMA 4YC9A 3I2DA 2CT2A 2AN6A 5DKAA 3N9NA 5LKUA 3ZVYA 2G43A 2K16A 2K17A 1LDJB 2CKLA 2VPEA 3RPGC 3KV6A 2M3HA 3O35A 1E4UA 5B78A 3ASLA 5B8DA 2KE1A 3ZNIA 1G25A 3SOUA 3LQIA 1WILA 2ECNA 2Y43A 4C9ZA 4WA6A 4WZ0A 2L75A 1WEWA 4QF3A 5D1MB 2JMIA 2DX8A 3PUQA 2YHNA 3M99A 1WEOA 4MVTA 2G6QA 1U6GB 1Z60A 1BORA 2LN0A 1JM7B 3LRQA 3KNVA 3M62A 4I7BA 3DPLR 2KGGA 2JMDA 5B76A 3KV5A 2MA6A 2K1JA 5FERA 5TDWA 2HDPA 4X3GA 2KWKA 5B77A 5AITA 1VYXA 1T1HA 2F6JA 1WGMA 5FB0A 1WESA 2LQ6A 3N9OA 4LADB 1JOCA 2YQLA 2VPBA 4AYCB 2ECTA 2RSDA 3L1ZB 4ZUXU 5D1LB 2K4DA 3O34A 5C11A 5KH9A 3M63A 2KR4A 3DQVR 5G0FA 2ZETC 5AIUA 1X4UA 2C2LA 4IC2A 2VNFA 3KQIA 2VJFA 2YU4A 2E6RA 2OXQC 3GV4A 3T6RA 4PPEA 5C13A 5LCWB 2UZGA 2YT5A 3T7LA 2IDAA 5B75A 4AP4A 4I7DA 4XI1A 5H1UA 4GNFA 2H0DB 4R7EA 2LXPC 4YBMA 4S3OB 3NG2A 3O36A 4MSXA 5TABA 4GB0A 5LKTA 1WE9A 4LKAA 4A4CA 4R8PK 2KIZA 3ZPVE 2I50A 1WEUA 2CKLB 3HCUA 2KU3A 2KFTA 2KGIA 2C2VS 2VPGA 3O37A 2D8SA 3GL6A 2EODA 3U5MA 4PTBA 3RPGB 3HCSA 3N9QA 4GNEA 1MM2A 1MM3A 1WENA 4YBTA 4GNGA 4LLBA 2YW8A 4YATA 4W4UA 2Y1NA 2JMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWO A;  5G05 B;  2YYR A;  4FO9 A;  1CHC A;  1HYJ A;  2MNZ A;  1V87 A;  2YUR A;  3MHH A;  3PUR A;  3U5P A;  4N3W A;  4LJN A;  3RTR B;  2BAY A;  4AVX A;  2KWJ A;  3EB6 A;  4YAB A;  2G45 A;  2KRE A;  5TBN A;  2M6M A;  4F52 B;  2L43 A;  3HCT A;  3U5N A;  4BBQ A;  3LQJ A;  1FBV A;  5JG6 A;  4YAD A;  2LGK A;  2L0B A;  2YUC A;  2LDR A;  3N9L A;  1RMD A;  2M1R A;  4B86 C;  5LKZ A;  1WFK A;  2EA6 A;  4L7X A;  2VJF B;  5TDR A;  5G04 B;  2LGL A;  5FEY A;  2KWN A;  2NAA A;  4O64 A;  3LQH A;  2ECV A;  4FK5 A;  3O33 A;  2EGP A;  5EYA F;  3N9M A;  1F62 A;  5I3L A;  5H9M A;  2PNX A;  2ECI A;  2ECW A;  3MHS A;  4WZ3 B;  1LDK C;  3ZVZ B;  2L80 A;  2VP7 A;  4V3K C;  3ZPV 1;  5KH7 A;  2MD8 C;  4ZQL A;  1X4J A;  5KH3 A;  5D1K B;  2LGV A;  2YQM A;  3SHB A;  2YSM A;  4CA1 A;  1N87 A;  3ZTG A;  1WIM A;  2LV9 A;  1VFY A;  3C6W A;  3U5O A;  4I7C A;  4WZ2 A;  2YRE A;  3L1X A;  2PUY A;  3L11 A;  1X4I A;  2CSY A;  2HYE D;  4LK9 A;  3ZYQ A;  2QIZ A;  2F6N A;  2MT5 A;  5TRB A;  3N9P A;  2FUI A;  3FL2 A;  2M85 A;  3VK6 A;  5H1T A;  3SOW A;  4UI9 B;  1HYI A;  4Q6F A;  2E6S A;  5LKX A;  2RI7 A;  4QF2 A;  1JM7 A;  4A49 A;  4FIP A;  5H1V A;  1IYM A;  1WEP A;  1FP0 A;  1Z6U A;  4FJC A;  2LGG A;  3SOX A;  5B79 A;  1WEE A;  4R2Y A;  4P5O B;  3C5K A;  4A4B A;  2FUU A;  2ECG A;  2MUM A;  2FSA A;  4V3L C;  1ZBD B;  2MD7 B;  2LRI C;  4ZDT A;  4YBS A;  4TKP B;  3V43 A;  2YSJ A;  4NN2 A;  1XWH A;  2F42 A;  2YHO A;  3HTK C;  2XEU A;  3PHD A;  2LXH C;  2L5U A;  1Z2Q A;  2QIC A;  4AYC A;  1WEQ A;  2QJ0 A;  2MIQ A;  4UP0 A;  2Y1M A;  4N4F A;  4GND A;  4YAX A;  1VD4 A;  2VJE A;  3IHP A;  3O70 A;  4L58 A;  4IC3 A;  2MNY A;  2VJE B;  4BHW A;  2ECJ A;  1K2F A;  3QZV A;  4UP5 A;  2CSZ A;  2KYU A;  3EB5 A;  2JRJ A;  4B7Y C;  4AUQ B;  5DIN A;  5J3X A;  3O7A A;  4A0C D;  1WEV A;  2VPD A;  4S3O C;  1DVP A;  2MA5 A;  2H0D A;  5FB1 A;  2XB1 A;  4CCG X;  1WEM A;  4YC9 A;  3I2D A;  2CT2 A;  2AN6 A;  5DKA A;  3N9N A;  5LKU A;  3ZVY A;  2G43 A;  2K16 A;  2K17 A;  1LDJ B;  2CKL A;  2VPE A;  3RPG C;  3KV6 A;  2M3H A;  3O35 A;  1E4U A;  5B78 A;  3ASL A;  5B8D A;  2KE1 A;  3ZNI A;  1G25 A;  3SOU A;  3LQI A;  1WIL A;  2ECN A;  2Y43 A;  4C9Z A;  4WA6 A;  4WZ0 A;  2L75 A;  1WEW A;  4QF3 A;  5D1M B;  2JMI A;  2DX8 A;  3PUQ A;  2YHN A;  3M99 A;  1WEO A;  4MVT A;  2G6Q A;  1U6G B;  1Z60 A;  1BOR A;  2LN0 A;  1JM7 B;  3LRQ A;  3KNV A;  3M62 A;  4I7B A;  3DPL R;  2KGG A;  2JMD A;  5B76 A;  3KV5 A;  2MA6 A;  2K1J A;  5FER A;  5TDW A;  2HDP A;  4X3G A;  2KWK A;  5B77 A;  5AIT A;  1VYX A;  1T1H A;  2F6J A;  1WGM A;  5FB0 A;  1WES A;  2LQ6 A;  3N9O A;  4LAD B;  1JOC A;  2YQL A;  2VPB A;  4AYC B;  2ECT A;  2RSD A;  3L1Z B;  4ZUX U;  5D1L B;  2K4D A;  3O34 A;  5C11 A;  5KH9 A;  3M63 A;  2KR4 A;  3DQV R;  5G0F A;  2ZET C;  5AIU A;  1X4U A;  2C2L A;  4IC2 A;  2VNF A;  3KQI A;  2VJF A;  2YU4 A;  2E6R A;  2OXQ C;  3GV4 A;  3T6R A;  4PPE A;  5C13 A;  5LCW B;  2UZG A;  2YT5 A;  3T7L A;  2IDA A;  5B75 A;  4AP4 A;  4I7D A;  4XI1 A;  5H1U A;  4GNF A;  2H0D B;  4R7E A;  2LXP C;  4YBM A;  4S3O B;  3NG2 A;  3O36 A;  4MSX A;  5TAB A;  4GB0 A;  5LKT A;  1WE9 A;  4LKA A;  4A4C A;  4R8P K;  2KIZ A;  3ZPV E;  2I50 A;  1WEU A;  2CKL B;  3HCU A;  2KU3 A;  2KFT A;  2KGI A;  2C2V S;  2VPG A;  3O37 A;  2D8S A;  3GL6 A;  2EOD A;  3U5M A;  4PTB A;  3RPG B;  3HCS A;  3N9Q A;  4GNE A;  1MM2 A;  1MM3 A;  1WEN A;  4YBT A;  4GNG A;  4LLB A;  2YW8 A;  4YAT A;  4W4U A;  2Y1N A;  2JMJ A; 
#chains in the Genus database with same CATH topology
 2KWO A;  5G05 B;  2YYR A;  4FO9 A;  1CHC A;  3LVR E;  1HYJ A;  2MNZ A;  1V87 A;  2YUR A;  2YVR A;  3MHH A;  3PUR A;  3U5P A;  2B0O E;  4N3W A;  4LJN A;  3RTR B;  3MDB C;  2BAY A;  2JUN A;  4AVX A;  2KWJ A;  3EB6 A;  4YAB A;  2G45 A;  2KRE A;  5TBN A;  2M6M A;  4F52 B;  3LVQ E;  2L43 A;  3HCT A;  3U5N A;  4BBQ A;  3LQJ A;  1FBV A;  5JG6 A;  4YAD A;  2LGK A;  2L0B A;  2CON A;  2YUC A;  2LDR A;  2L7P A;  3N9L A;  1RMD A;  2M1R A;  4B86 C;  5LKZ A;  1WFK A;  2EA6 A;  4L7X A;  2VJF B;  4O62 A;  5TDR A;  5G04 B;  2LGL A;  4Z0O A;  5FEY A;  2KWN A;  3FAN A;  2NAA A;  4O64 A;  3LQH A;  2ECV A;  4FK5 A;  3O33 A;  2EGP A;  5EYA F;  3N9M A;  1F62 A;  5I3L A;  2M13 A;  5H9M A;  2PNX A;  2ECI A;  3E2D A;  2ECW A;  3MHS A;  4WZ3 B;  1LDK C;  3ZVZ B;  2L80 A;  2VP7 A;  4V3K C;  3ZPV 1;  5KH7 A;  2XP0 A;  2MD8 C;  4ZQL A;  1X4J A;  5KH3 A;  5D1K B;  2LGV A;  2YQM A;  3SHB A;  2YSM A;  4CA1 A;  1N87 A;  3ZTG A;  1WIM A;  2LV9 A;  1VFY A;  3C6W A;  3U5O A;  3O47 A;  4I7C A;  4WZ2 A;  2YRE A;  3L1X A;  2PUY A;  3L11 A;  1X4I A;  2CSY A;  2HYE D;  4LK9 A;  3SUB A;  3ZYQ A;  2QIZ A;  2F6N A;  2MT5 A;  5TRB A;  2D8U A;  3N9P A;  2FUI A;  3FJU B;  3FL2 A;  5K3Q A;  3LDY A;  2M85 A;  3VK6 A;  5H1T A;  3SOW A;  4F1P A;  4UI9 B;  2OWA A;  1HYI A;  4Q6F A;  2E6S A;  5LKX A;  2RI7 A;  4QF2 A;  1JM7 A;  4A49 A;  4FIP A;  5H1V A;  1IYM A;  1WEP A;  1FP0 A;  1Z6U A;  4OGE A;  4FJC A;  2LGG A;  3SOX A;  5B79 A;  1WEE A;  4R2Y A;  4P5O B;  3C5K A;  4A4B A;  2FUU A;  2ECG A;  2MUM A;  3Q1D A;  2LAU A;  2KKY A;  3H7H A;  2FSA A;  4V3L C;  1ZBD B;  2MD7 B;  2LRI C;  4ZDT A;  4YBS A;  4TKP B;  3V43 A;  2YSJ A;  4NN2 A;  1XWH A;  2F42 A;  2YHO A;  3HTK C;  2XEU A;  3PHD A;  2LXH C;  2L5U A;  1Z2Q A;  2QIC A;  4AYC A;  1WEQ A;  2QJ0 A;  2MIQ A;  4UP0 A;  2Y1M A;  4N4F A;  4GND A;  4YAX A;  1VD4 A;  2VJE A;  3IHP A;  3O70 A;  4L58 A;  4IC3 A;  2MNY A;  2VJE B;  4BHW A;  2CSV A;  2ECJ A;  1K2F A;  2DJA A;  3QZV A;  4UP5 A;  2CSZ A;  2KYU A;  3EB5 A;  2JRJ A;  4B7Y C;  4AUQ B;  5DIN A;  5J3X A;  3O7A A;  4A0C D;  1WEV A;  2VPD A;  4S3O C;  1DVP A;  3PLW A;  2MA5 A;  2H0D A;  5FB1 A;  2XB1 A;  4CCG X;  1WEM A;  4YC9 A;  3I2D A;  2CT2 A;  2AN6 A;  3FEH A;  5DKA A;  5SVX A;  3N9N A;  5LKU A;  3KDE C;  3ZVY A;  2G43 A;  2K16 A;  2K17 A;  1LDJ B;  1DCQ A;  2CKL A;  2VPE A;  3RPG C;  3KV6 A;  2M3H A;  3O35 A;  1E4U A;  5B78 A;  3ASL A;  5B8D A;  2KE1 A;  2IQJ A;  3ZNI A;  1G25 A;  3SOU A;  2DSM A;  3LQI A;  1WIL A;  2ECN A;  5SVY A;  3JUE A;  2Y43 A;  4C9Z A;  4WA6 A;  4WZ0 A;  2EXU A;  2L75 A;  1WEW A;  4QF3 A;  5D1M B;  2JMI A;  2JM3 A;  2DX8 A;  1MBM A;  4OGC A;  3PUQ A;  2YHN A;  3M99 A;  1WEO A;  4MVT A;  2G6Q A;  1U6G B;  1Z60 A;  1BOR A;  2KKX A;  2LN0 A;  2XOY A;  1JM7 B;  3LRQ A;  3M62 A;  3KNV A;  3LJU X;  4I7B A;  3DPL R;  2KGG A;  2JMD A;  5B76 A;  3KV5 A;  2MA6 A;  4H9D A;  2MKE A;  2K1J A;  5FER A;  5TDW A;  2HDP A;  4X3G A;  2KWK A;  3FM8 C;  5B77 A;  5AIT A;  1VYX A;  2FFW A;  1T1H A;  2F6J A;  1WGM A;  5FB0 A;  1WES A;  2LQ6 A;  5SVI A;  3N9O A;  5SVI B;  4LAD B;  2CRW A;  2EGM A;  1JOC A;  2YQL A;  2VPB A;  4AYC B;  2ECT A;  2RSD A;  3L1Z B;  4ZUX U;  5D1L B;  2K4D A;  3O34 A;  5C11 A;  5KH9 A;  3M63 A;  2KR4 A;  3DQV R;  3M7K A;  2XOZ A;  5G0F A;  2ZET C;  5AIU A;  2RR4 A;  1X4U A;  2C2L A;  4IC2 A;  2VNF A;  3KQI A;  2VJF A;  2YU4 A;  2E6R A;  2OXQ C;  3GV4 A;  3T6R A;  4PPE A;  5C13 A;  5LCW B;  2UZG A;  2YT5 A;  3T9K A;  3T7L A;  2IDA A;  5B75 A;  4AP4 A;  4I7D A;  4XI1 A;  3DWD A;  5H1U A;  4GNF A;  2H0D B;  4R7E A;  2CRR A;  2LXP C;  4YBM A;  4S3O B;  3NG2 A;  3O36 A;  4MSX A;  2XOC A;  5TAB A;  4GB0 A;  5LKT A;  1WE9 A;  4LKA A;  4A4C A;  4R8P K;  2KIZ A;  3ZPV E;  2I50 A;  1WEU A;  2CKL B;  3HCU A;  2KU3 A;  2FD4 A;  2KFT A;  2KGI A;  2C2V S;  2VPG A;  3O37 A;  2D8S A;  3GL6 A;  2EOD A;  3U5M A;  4PTB A;  3RPG B;  3HCS A;  3N9Q A;  4GNE A;  1MM2 A;  2P57 A;  4QQ4 A;  3DDT A;  4Z0R A;  1MM3 A;  3FAO A;  1WEN A;  4YBT A;  4GNG A;  2E61 A;  4LLB A;  2YW8 A;  4YAT A;  4W4U A;  2Y1N A;  2JMJ A; 
#chains in the Genus database with same CATH homology
 2KWO A;  5G05 B;  2YYR A;  4FO9 A;  1CHC A;  1HYJ A;  2MNZ A;  1V87 A;  2YUR A;  3MHH A;  3PUR A;  3U5P A;  4N3W A;  4LJN A;  3RTR B;  2BAY A;  4AVX A;  2KWJ A;  3EB6 A;  4YAB A;  2G45 A;  2KRE A;  5TBN A;  2M6M A;  4F52 B;  2L43 A;  3HCT A;  3U5N A;  4BBQ A;  3LQJ A;  1FBV A;  5JG6 A;  4YAD A;  2LGK A;  2L0B A;  2YUC A;  2LDR A;  3N9L A;  1RMD A;  2M1R A;  4B86 C;  5LKZ A;  1WFK A;  2EA6 A;  4L7X A;  2VJF B;  5TDR A;  5G04 B;  2LGL A;  5FEY A;  2KWN A;  2NAA A;  4O64 A;  3LQH A;  2ECV A;  4FK5 A;  3O33 A;  2EGP A;  5EYA F;  3N9M A;  1F62 A;  5I3L A;  5H9M A;  2PNX A;  2ECI A;  2ECW A;  3MHS A;  4WZ3 B;  1LDK C;  3ZVZ B;  2L80 A;  2VP7 A;  4V3K C;  3ZPV 1;  5KH7 A;  2MD8 C;  4ZQL A;  1X4J A;  5KH3 A;  5D1K B;  2LGV A;  2YQM A;  3SHB A;  2YSM A;  4CA1 A;  1N87 A;  3ZTG A;  1WIM A;  2LV9 A;  1VFY A;  3C6W A;  3U5O A;  4I7C A;  4WZ2 A;  2YRE A;  3L1X A;  2PUY A;  3L11 A;  1X4I A;  2CSY A;  2HYE D;  4LK9 A;  3ZYQ A;  2QIZ A;  2F6N A;  2MT5 A;  5TRB A;  3N9P A;  2FUI A;  3FL2 A;  2M85 A;  3VK6 A;  5H1T A;  3SOW A;  4UI9 B;  1HYI A;  4Q6F A;  2E6S A;  5LKX A;  2RI7 A;  4QF2 A;  1JM7 A;  4A49 A;  4FIP A;  5H1V A;  1IYM A;  1WEP A;  1FP0 A;  1Z6U A;  4FJC A;  2LGG A;  3SOX A;  5B79 A;  1WEE A;  4R2Y A;  4P5O B;  3C5K A;  4A4B A;  2FUU A;  2ECG A;  2MUM A;  2FSA A;  4V3L C;  1ZBD B;  2MD7 B;  2LRI C;  4ZDT A;  4YBS A;  4TKP B;  3V43 A;  2YSJ A;  4NN2 A;  1XWH A;  2F42 A;  2YHO A;  3HTK C;  2XEU A;  3PHD A;  2LXH C;  2L5U A;  1Z2Q A;  2QIC A;  4AYC A;  1WEQ A;  2QJ0 A;  2MIQ A;  4UP0 A;  2Y1M A;  4N4F A;  4GND A;  4YAX A;  1VD4 A;  2VJE A;  3IHP A;  3O70 A;  4L58 A;  4IC3 A;  2MNY A;  2VJE B;  4BHW A;  2ECJ A;  1K2F A;  3QZV A;  4UP5 A;  2CSZ A;  2KYU A;  3EB5 A;  2JRJ A;  4B7Y C;  4AUQ B;  5DIN A;  5J3X A;  3O7A A;  4A0C D;  1WEV A;  2VPD A;  4S3O C;  1DVP A;  2MA5 A;  2H0D A;  5FB1 A;  2XB1 A;  4CCG X;  1WEM A;  4YC9 A;  3I2D A;  2CT2 A;  2AN6 A;  5DKA A;  3N9N A;  5LKU A;  3ZVY A;  2G43 A;  2K16 A;  2K17 A;  1LDJ B;  2CKL A;  2VPE A;  3RPG C;  3KV6 A;  2M3H A;  3O35 A;  1E4U A;  5B78 A;  3ASL A;  5B8D A;  2KE1 A;  3ZNI A;  1G25 A;  3SOU A;  3LQI A;  1WIL A;  2ECN A;  2Y43 A;  4C9Z A;  4WA6 A;  4WZ0 A;  2L75 A;  1WEW A;  4QF3 A;  5D1M B;  2JMI A;  2DX8 A;  3PUQ A;  2YHN A;  3M99 A;  1WEO A;  4MVT A;  2G6Q A;  1U6G B;  1Z60 A;  1BOR A;  2LN0 A;  1JM7 B;  3LRQ A;  3KNV A;  3M62 A;  4I7B A;  3DPL R;  2KGG A;  2JMD A;  5B76 A;  3KV5 A;  2MA6 A;  2K1J A;  5FER A;  5TDW A;  2HDP A;  4X3G A;  2KWK A;  5B77 A;  5AIT A;  1VYX A;  1T1H A;  2F6J A;  1WGM A;  5FB0 A;  1WES A;  2LQ6 A;  3N9O A;  4LAD B;  1JOC A;  2YQL A;  2VPB A;  4AYC B;  2ECT A;  2RSD A;  3L1Z B;  4ZUX U;  5D1L B;  2K4D A;  3O34 A;  5C11 A;  5KH9 A;  3M63 A;  2KR4 A;  3DQV R;  5G0F A;  2ZET C;  5AIU A;  1X4U A;  2C2L A;  4IC2 A;  2VNF A;  3KQI A;  2VJF A;  2YU4 A;  2E6R A;  2OXQ C;  3GV4 A;  3T6R A;  4PPE A;  5C13 A;  5LCW B;  2UZG A;  2YT5 A;  3T7L A;  2IDA A;  5B75 A;  4AP4 A;  4I7D A;  4XI1 A;  5H1U A;  4GNF A;  2H0D B;  4R7E A;  2LXP C;  4YBM A;  4S3O B;  3NG2 A;  3O36 A;  4MSX A;  5TAB A;  4GB0 A;  5LKT A;  1WE9 A;  4LKA A;  4A4C A;  4R8P K;  2KIZ A;  3ZPV E;  2I50 A;  1WEU A;  2CKL B;  3HCU A;  2KU3 A;  2KFT A;  2KGI A;  2C2V S;  2VPG A;  3O37 A;  2D8S A;  3GL6 A;  2EOD A;  3U5M A;  4PTB A;  3RPG B;  3HCS A;  3N9Q A;  4GNE A;  1MM2 A;  1MM3 A;  1WEN A;  4YBT A;  4GNG A;  4LLB A;  2YW8 A;  4YAT A;  4W4U A;  2Y1N A;  2JMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...