1HYSA

Crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HIV-1 reverse transcriptase in complex with a polypurine tract RNA:DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-R(*UP*CP*AP*GP*CP*CP*AP*CP*UP*UP*UP*UP*UP*AP*AP*AP*AP*GP*
total genus 119
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hysA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hysA05
3BR9A 4M42A 5F8IA 4CF1A 4MIAA 2YNIA 2R8HA 3RB6A 3BQ0A 3T19A 1SKRA 5HLFA 1WNEA 3SFGA 2A1RA 2YKMA 4E0DA 3NE6A 4ECXA 2IC3B 1HJRA 1WSIA 4MK8A 2IAJB 2QK9A 4MH8A 4H4OB 3NGIA 2D0BA 2RKIA 5C42B 5CYMB 4KE5A 1S0MA 4KFBA 2VG5B 3KMSA 5J2QB 3HVAA 4CK3A 5KFEA 3VQSA 2KQ2A 5SWMA 2IS3A 3HYFA 1L3SA 1KRPA 3AO2A 4KBIA 4GC6A 4PA1A 4CJKA 3SI6A 4RW6A 4KKOB 3NCIA 4DTMA 4DL2A 3L2WA 1JLCA 2GUIA 4FM1A 4DSEA 1U47A 5C5JA 3IS9B 1A5VA 1BHLA 1S9GA 4KTQA 4PQUA 4FJ8A 4CEFA 2BDPA 5HRSA 2V9WA 3O4NA 1K6YA 2F8TA 1RA7A 3NFAA 4K8ZA 1LWEB 4OPJA 3SYZA 1LWFA 1SV5A 2JEFA 1KSPA 3ZCMA 2X6SA 4IH5A 3MECB 2G8HA 4FBTA 2XY8A 3L8BA 3K5MA 3IGVA 5HP1A 3V1RA 4FK2A 4CFBA 4KO0A 5KFAA 4AHCA 2WOMA 4FW1A 3V4IB 3BSNA 3KD5E 1WNSA 4RW6B 4RNNA 4EO6A 4M3TA 3AO5A 4N56A 4IH7A 4IR9A 4B9NA 4I2QA 3NGZA 5J1EB 4ED7A 4CEOA 2Z1GA 4CHPA 2ZE2B 1FKPB 4K4YA 3SPYA 4O0JA 3OSPA 1TV6A 3U3GA 5K14B 3SQ1A 4FJHA 4OKJA 1UA0A 4WXWA 3ALYA 5KTQA 3GYNA 5KFCA 5CYQB 4ZHRB 1CLQA 4DMNA 5K14A 4DQQA 3QGIA 4ED6A 4B08A 3PW0A 3BSCA 2FLPA 3PW5A 3D45A 4O3PA 3AVFA 3ZSZA 4IQXA 3SUNA 1TK8A 4FLUA 4FYDA 4OLBA 3LWLA 4TXSA 2OZSA 3V6DA 1MU2B 4FJGA 4GVMA 4HUEA 2UVRA 3PX4A 2OPQB 3H4BA 4ICLB 2R2TA 3T5LA 1NK0A 3D5MA 5KT3A 1VSHA 1VRUA 1C1AA 4ZVGA 4E7JA 3U3YA 5KFJA 3AVBA 4BDZA 1ASVA 1RBSA 3T5JA 2R2RA 4IG0B 3AA3A 1LWEA 2XGPA 4FLZA 3VQCA 3KK2B 1KVCA 4CEDA 3M8QB 4PWDB 1UWBA 1QE1A 3DLRA 4XPEA 4CJLA 4WYLA 3H4DA 1N56A 3OYIA 1HRHA 3C95A 1REVB 1S6PB 4BE0A 2W9AA 3D0PA 3MEDA 2XHBA 1S97A 1U48A 2YNGA 1QUVA 4NYFA 4FBUA 1HMVB 2E6MA 3T3FA 3QEXA 4Z4FA 4CHYA 1QSSA 3QLHB 4TN2A 4U6PA 3HP9A 2X78A 2IC3A 3SPZA 1RT3B 3NAHA 4M3RA 4CF8A 4F4KA 1B92A 4DG1B 4O3NA 1B9DA 4ECTA 4NYZA 4DEZA 4QPXA 1ASUA 2WTFA 5CZ2A 3KKRA 3KHHA 2G8VA 2YNIB 5F8JA 1HNIA 3L2UA 1HNVB 4KHQA 4RW8A 3CG7A 4RUCA 3H08A 5I42A 3DI6A 1HQUA 4CEZA 1JLAB 1GX5A 4G1QA 3SV4A 2HVHA 2FVRA 1C0UA 3IGNA 3OYLA 3WNFA 1RYSA 1W0HA 3HVRA 4CK1A 3BDPA 1NOYA 4EEYA 1NJYA 3PZPA 4HUGA 3E01B 1DTTA 4DS5A 2B5JA 3NH0A 4FK0A 1KHVA 5F8NA 2BE2A 3IG1B 1VSMA 3SV3A 3DM2A 4CK2A 3V9ZA 5L9XA 1RDRA 4E7KA 3MR5A 5KG1A 3CDUA 5JUMA 4KHSA 1RTIB 2O4GA 4CJPA 3M9MB 3KTQA 4TYAA 5HBMB 4CCHA 2EHGA 5JS2A 4DU1A 4KHWA 4EZ6A 4CJRA 1XHZA 4TQRA 4YQWA 2OYQA 1HQEB 4DL4A 3KJVA 1JX4A 5FDLB 5J2PB 3MFIA 1S4FA 4ZPCA 3OYJA 3LP0B 4DTOA 2HMIB 1X9MA 4ID5B 4JRPA 3VQ6A 1NK9A 4KHMA 4IH6A 4NCGB 1T03A 4JLHA 4YFUA 4RW9B 1IH7A 1RTHB 3QERA 3QYYA 4AHVA 2DPJA 4OGCA 2OPPA 3GIMA 3H5UA 4CEEA 5L1IA 3KK3A 1ZTTA 4Q0BB 4BWMA 4FZZA 3ZSXA 3I5BA 1Z4UA 1JLBA 3NDKA 4KB7A 4J9SA 3FSIA 3MEDB 3NF7A 2NUBA 3GIKA 2VG7A 3LZJA 2HHUA 1K1QA 2W42A 3OJUA 3HVWA 3RR8A 5DMRA 4CIFA 4RNMA 4NLVA 4Y34A 1LV5A 4FJNA 5C42A 3DRPB 4OL8A 3PV8A 1KFSA 1IKYA 1WN7A 1W25A 3DM2B 4CHQA 4M94A 5KG4A 4H54A 4CERA 4IKAA 4O3RA 3C6TB 5KFMA 3K5LA 1C0TB 1NK7A 1DTTB 5KT6A 5KFXA 2WRMA 1S9EB 4FS1A 1JKHA 2GV9A 3VN5A 1RDCA 2P5OA 2IMWP 1VSJA 3V9SA 2PZSA 2F96A 4E7HA 3O4QA 1D9DA 3PW4A 4Z0UA 2V0NA 4ECUA 5HBMA 3KMQA 4DLGA 2HHXA 1XI1A 5I42B 3BSAA 2I5JA 4MKBA 3I8DA 3G10A 2XC9A 2HAIA 1ASWA 2Y1IA 1FK9A 4OKEA 4F3TA 1ZYQA 1S1VA 5KFBA 2X74A 4QWEA 4DG1A 4XO0A 2DFEA 2XRIA 1JLEB 1S1WB 2AGQA 1TKTA 2B43A 2C28A 3LDSA 3NAEA 4TY8B 4ZTFA 3MEGB 3ICLA 3NKYA 5L1LA 4MK7A 3PO5A 3RB0A 1WSHA 4WZMA 5KG3A 1WSFA 3QEPA 3CM5A 3V9UA 3HVTB 3RAQA 2VA2A 2HHVA 3DYAA 5KG5A 2FBTA 3CDWA 4BDPA 5J1EA 1C0UB 3PW7A 4G1QB 3DMJA 4GW6A 3DI6B 3ISND 4XIUA 4O5BA 4LQ3A 3KLFB 2ITGA 4DTNA 3FFIB 1RBTA 3M8QA 3V1OA 1DLOA 3SZ2A 3FQKA 4I2PA 3SUQA 2EC0A 3DLEA 1LW2B 2AU0A 1BIUA 4Z4IA 3AV9A 3LALA 3U6FA 3AA2A 3FQLA 1NK6A 1IM4A 3NF6A 1JLGA 5DQGA 3LP0A 1S5JA 2HB5A 1DLOB 4O0IA 4W5QA 3HK2A 1C1CA 3FFIA 1ZBLA 3RRHA 1S9GB 1VK0A 5KFZA 5KFIA 4NLRA 2YNGB 2B6AA 4KI4A 1BQMA 3DMJB 1J54A 1S6PA 3T5HA 4QWCA 3HPHA 3AVNA 3OYGA 4KFBB 1QE1B 4NLPA 3TAEA 4NLTA 4ECRA 4J2DA 4LSLB 2F8SA 1EXQA 4FZXC 1UAXA 3QESA 1WSGA 3Q8RB 4J2EA 2XCPA 2YKNB 2YKNA 1TL3A 1BI4A 2W9BA 3JYTA 3KHGA 4OGEA 4FLYA 2DPIA 4N41A 1JXEA 4CJQA 3TQ1A 3AVMA 4MIBA 1R0AA 4Q8EA 2G8IA 4ED0A 1BL3A 4ZPAA 3NGDA 1UA1A 4X2BA 2DFFA 3QEVA 1J53A 1BGXT 4URQU 2ILZA 1RA6A 3DLHA 5JXSA 1VSLA 5L1KA 3MXMA 4NLUA 4O3SA 1X1PA 4Y1DA 4DQIA 1C1BB 4FJXA 3KLHA 3OHAA 5C25A 4FJLA 1S6QB 4EYHB 3V4IA 3DLKA 5I3UA 3N6LA 3PR5B 2VG6B 4CGDA 3QIOA 4YR0A 3RRGA 4JV2A 4ZP8A 5KT4A 4R8UB 1S9EA 1JLGB 4CJFA 1L3UA 3CDEA 3CJ5A 4KAIA 5KFWA 4J2AA 3UIQA 2HHQA 3G6YA 4QAGA 2D5RA 4M3WA 1RAJA 1Q8IA 3GQCA 1QTMA 4DF4A 4BACA 4NZ0A 4BDYA 1O1WA 5J2NB 2IGIA 4CEAA 2LSNA 4DTUA 2PYLA 3HKWA 2ZE2A 1XHXA 1RT7B 2R8GA 3ZT2A 1VRTB 5KFVA 4Y1CA 3RMCA 3QGHA 4J9RA 3K58A 4NRUA 3NF9A 3BGRB 4WE1B 4O44B 3TAFA 1IKVA 3DOKA 4Q43A 2B6AB 3MAQA 1KVBA 4QWBA 3OYFA 4FLVA 1Z25A 1RT7A 3RB3A 4FLWA 2VG5A 4FS2A 4E7LA 3KK3B 4KB1A 2VWKA 2RKIB 2IBKA 1T05B 5EWGA 5KFDA 1TL1A 4O3QA 4KRFA 3KLIA 5DLFA 4ZP9A 4RNHA 1GOAA 2W9CB 1LW2A 1S1TA 4KSEB 4I7FB 4FJKA 4NLGA 1QAJA 4R0EA 3RBDA 1EETA 5DG9A 4F2SA 1RT1A 1HPZA 1QS4A 3KLVA 4EO8A 4ZVEA 1FK9B 1ZETA 3UQSA 3P83D 4J9MA 3OY9A 1BCMA 5EUHA 3DLKB 1LWCA 2R7YA 4O4GA 4BWJA 4IRKA 5KRSA 4KKOA 2D41A 1RTJB 1DTQA 5J2MA 3GV5B 1W9HA 3I5AA 2F8EX 5DLGA 4J9NA 4DFJA 4CHZA 3DLBA 1JIHA 3OS1A 4Z4GA 3RB4A 1TKZB 2ALZA 4HYKA 3ZT3A 2KW4A 4EYIB 3OYBA 3CM6A 3JYTB 2IJNA 4ZHRA 1C0TA 1NHUA 2PY5A 3K59A 5F9NA 2B5JB 2KFZA 4WYWA 1IG9A 4GMJB 4ECQA 3E01A 5FROA 2QKBA 3DRPA 1BCOA 4J9OA 1IKWA 4MKAA 4DFKA 4ED2A 3SQ4A 4CJVA 3DRRA 4HVJA 2JLEA 3LANA 3AVJA 3CYMA 1JLAA 2B4JA 4B8AB 4B9UA 1A5XA 3MFHA 2OPRA 4WFYA 2ZQBA 4M3YA 1RYRA 4KV8B 2QXFA 4DL3A 3OS2A 4CFDA 4HTUA 2KFNA 4E89A 1VSFA 4Q0BA 3OYCA 3RTVA 3TAPA 3PY8A 3SCXA 1EETB 3I0RA 4M3UA 4LD0A 3AA4A 2VA3A 2G8UA 4YP3A 3HPGA 1BQNA 1SUQA 4O3OA 3RMAA 4ID5A 2HMIA 3C6UB 3VQEA 3JSMA 3MEEA 4GC7A 1J9AA 5KG0A 4DL5A 1KCFA 5HRRA 3PUFA 4AHTA 3KNAA 1S0NA 3L3UA 5CY4A 3HSTB 3MF5A 1QHTA 2UUTA 5KFFA 2G8WA 3QIPA 4JS4A 1Z26A 4ECWA 1EX4A 3BGRA 4WE1A 4FZYA 4NLOA 4N5SA 2OPSA 5J2QA 4ELUA 1IKWB 3SI8A 5CYMA 4W5NA 4PY5A 3HPOA 3RMBA 1BISA 2QE5A 4CJUA 1RTHA 5T7BA 2VWJA 3CJ0A 2C2RA 2J6TA 2IA6A 4CESA 2BQUA 3LP2B 4ZTJA 4ZP7A 5KFOA 3KLGA 4LQ9A 3IN5A 4EBEA 4DSJA 2ASLA 2E6LA 1KLMB 3B6OA 2YNFB 3VQAA 3DLGA 3I0RB 4F4XA 4IFYB 5KRTA 3KJVB 3H98A 3KHLA 2JEGA 3PO4A 3QIDA 3RBEA 1I39A 3EYZA 3ZSVA 5KI6A 2XO7A 4CF9A 4MK9A 2R2SA 4IOBA 4OKKA 2ASDA 4QCLA 4O4GB 4ZPDA 1SL2A 3KK1B 3T1AA 4G3IA 1SH2A 3M8RA 3K57A 3OL6A 2Q3SA 2D3UA 3GIJA 5KFQA 1N5YB 1JKHB 1C0MA 1NJWA 4RG8A 2RDJA 3H40A 1TL3B 4ED8A 4TY9A 1RT3A 2XY5A 1S10A 2RF2A 2WONB 5KFGA 2I1RA 1NKEA 4Q45A 2HHTA 3OJSA 4FLTA 4RNFA 3V1QA 2V4RA 3LAKA 1TP7A 3DOKB 2BANA 3VQ7A 4KTWA 3L2VA 1U09A 5SZTA 3DOLB 4WFXA 5KFKA 4WZQA 5KFYA 1HYSB 1D5AA 4H8KA 3MEEB 4H4MB 1ZBIA 5DGAA 1TAUA 5F8HA 4CF2A 3VA0A 4DQSA 1YTAA 4JRQA 5KFTA 3TVKA 5KT2A 1TL1B 3N6NA 4R5PA 2E9RX 2A1SA 1CZ9A 4M45A 3S3MA 3AVKA 5DGBA 1HYSA 1U45A 4YNQA 3KLFA 1XC9A 2AX0A 3IS9A 1HYZA 5KFRA 3KD1E 3TARA 2HVIA 1RTDB 3PJXA 1REVA 4NCBA 3HM9A 1XR7A 2ZKUA 3PJWA 4B9TA 3A2FA 3OYHA 1D1UA 3SNNA 4CGGA 2FBXA 3FRZA 4ELVA 3OVNA 5J2NA 1KTQA 3G6VA 4CGFA 3QO9A 4F4YA 4TY8A 1L3TA 1B9FA 4IG0A 5DQIA 3M8SA 5KGXA 3ZT1A 1KLNA 1MMLA 1NKBA 3QO9B 2DY4A 2HWHA 2HWIA 3Q8SB 3LP1B 3KHRA 1JLQB 4K4WA 4JUZA 1YVUA 1DTQB 4FVMA 1RTDA 3LAMA 3VQ4A 3C94A 2X6NA 2QKKA 4B9SA 4DU4A 3UDLA 2UUWA 3H5YA 3VQ9A 3CQ8A 4KB0A 4FXDA 1HPZB 3BREA 3OHBA 4KREA 3MXIA 5EWEA 4CJWA 1FXXA 1R0AB 1CXQA 1KLMA 5F8MA 2W9BB 2W9CA 2AGOA 1QAIA 2C2EA 4DLEA 4LY7A 2IM2A 1NK4A 4IDKB 4Y2CA 3GV7B 4IBNA 4LSLA 1TV6B 5F9LA 4J2BA 2Z1JA 4QW9A 4DFPA 1RT6B 4IKFA 1QSLA 4F3OA 4K4XA 4B9LA 2XY7A 4E19A 1ITGA 2VG7B 2XY6A 1SH0A 3HP6A 4O44A 4IFVA 1RNHA 3SUPA 3TAQA 1TK0A 4YR3A 4F50A 1T3NA 3P1GA 4CJ3A 5FRMA 4B8CA 4KO0B 2PYJA 3OLAA 5DG7A 2YV0X 2CKWA 4ECYA 3EZ5A 1ZBUA 3OYAA 2RF2B 4IRCA 1RCHA 4DL6A 3PR4A 2FJWA 2YKMB 1S1WA 3S9HA 2HHWA 1LWFB 4CJSA 2FVCA 4KTZA 4C8MA 3NBPB 4I2PB 3OYEA 1Q9YA 4E1MA 3EPGA 3K2PA 3L2RA 4IRDA 3DRSB 3EPIA 1KVAA 1RT5B 1EKEA 1CXUA 2VG6A 3LZIA 4HCBA 4ICLA 3AO3A 3PW2A 3AO4A 1UOCA 5T14A 1S6QA 1N4LA 1JLCB 2YNHB 4K8XA 1SH3A 2HNYB 1I6JA 5EWFA 3VQQA 4NYNA 4ZVFA 5DK5A 3VQ5A 3CVKA 3AVHA 3RR7A 3V81A 4CE9A 2C22A 1T7PA 4XPCA 2HNZA 2YNFA 1S0OA 3MEGA 3DDKA 3QGGA 1XWLA 3CJ4A 3BSOA 2FBYA 1TQLA 4E3SA 4DFMA 3IAYA 3OYNA 4OJRA 4KHUA 5CZ1A 1S1VB 2JC1A 4Q5VA 1Y97A 4Z4EA 2BQRA 3OYMA 4RNOA 4C8LA 4NLYA 4W5OA 1TVRA 2OPSB 2DFHA 4FM0A 5J2MB 4QWAA 2IDOA 3OL7A 3NHGA 1JXBA 2XGQA 1RT4A 1NK8A 1RTJA 2HNYA 4DWIA 5KG2A 4CGJA 4J9KA 3AO1A 4CEBA 1D0EA 2FJVA 4LH4A 3T5KA 1QSYA 4RW8B 4NLDA 1JLBB 3OL9A 3O3FA 4PUOA 4K4UA 3E51A 2P1JA 1LW0A 4IFYA 3DRSA 4RW7B 4CJ4A 5HP1B 4URGA 2AWZA 2OPPB 1TKDA 1ZTWA 3MR3A 3G0ZA 4AHRA 1S1TB 4OVLA 5C24A 4ZP6A 3KLGB 4RW9A 1SL1A 3VQPA 1SV5B 3HT3A 4KHRA 3HJFA 1WSEA 2D0CA 3S3NA 1NOZA 2XCAA 1IKYB 4H4MA 4E1NA 4BE1A 1RDBA 4DL7A 3MR2A 4NCAA 4PQUB 4DSLA 1QQCA 1C6VA 3PX6A 1J5OA 2R8JA 5HRPA 1XR5A 4FK4A 2UVWA 1FKOB 3KLEA 3SUOA 3RWUA 2D7SA 1S1XA 4J9QA 1J5OB 4E7IA 3QEWA 2BRKA 2XI2A 4DS4A 2RN2A 1TAQA 4I9LA 4FJ7A 4ZPBA 4JV0A 5KFUA 4PWDA 1GOCA 4DF8A 2UVVA 3FDSA 3QNNA 2Z1HA 3KK2A 4DSFA 3KKSA 2WONA 1WSJA 5HROB 2JC0A 2IAJA 3L3VA 1RT2B 3CJ2A 2BE2B 3AVCA 1JLFA 1NK5A 4W5TA 3LPUA 1N6QA 4CFCA 4CHOA 4K4SA 2HNDA 3I5CA 1K1SA 4Y2AA 3LPTA 2C2DA 3K5OA 1NHVA 4ED3A 4ELTA 1NKCA 3ISNC 1HQEA 3V6KA 2Z1IA 5I3UB 2AQ4A 4ECZA 4U7CA 1IO2A 3V6DB 2W7PA 3TAMA 2IM0A 2W8KA 2YNHA 4KHNA 1LWCB 3TWHA 1TVRB 4CHNA 1HNIB 4CFAA 3AA5X 3OS0A 2R2UA 3DLGB 3SFUA 4NLXA 3IG1A 4RZRA 3RAXA 4RW4B 2EX3A 1ZBHA 2JGUA 4CJTA 3QNOA 1N6QB 1JL1A 5DQHA 3SQ0A 1IKXA 3NF8A 1RT2A 4UQGA 2HNZB 1VSEA 2GIRA 1RBUA 1T05A 3S3OA 3BJYA 2AGPA 3PX0A 3EZUA 4KHYA 4LH5A 3GILA 4NLSA 1SKSA 2R8IA 1Q9XA 1JXLA 3VQDA 4NRTA 4OPKA 1IKVB 1FKOA 3KLEB 3MXJA 1X9SA 4RUAA 3WNEA 4AILC 4ID1A 1BIZA 3AVIA 3TR8A 3H5XA 1S9FA 3QEIA 1HARA 4F4ZA 4ECSA 4O4RA 3F9KA 3AVGA 4B9MA 4FJMA 4J9PA 1RT1B 2QV6A 3N6MA 4R5PB 3ITHB 4M95A 3UR0A 3V6HA 4IDKA 4KI6A 1TKXA 1TKXB 2HW3A 3V6JA 3PHEA 3NMAA 5C24B 4NLWA 4ZMMA 4O55A 3ZSWA 1KHWA 2RDIA 3G86A 4NLQA 4J9LA 3NGYA 2JEJA 3ZT0A 2FVQA 2P5GA 1HMVA 3ULDA 2J6SA 4IFVB 5C25B 1VSIA 3F73A 4DTJA 1SL0A 1LAWA 2BANB 3CFPA 1C1BA 3PVXA 5DG8A 2XI3A 1WLJA 2ZD1B 4IG3B 4B3OA 4DTRA 1X9WA 3ZSRA 1VRTA 2WB4A 1N48A 4ZVHA 4DTSA 1RT6A 4FJJA 1GOBA 2D0AA 4DU3A 3NH2A 2R8KA 2ATQA 1BI4B 4EP5A 3M9NB 5CYQA 4EP4A 1YVFA 2YHBA 4RW4A 3WNHA 4HKQA 3ZSYA 4BE2A 4CIGA 3V9XA 4R8UA 3OL8A 2J6UA 2DTUA 5KFLA 1N5YA 3V81B 3ASMA 1FKPA 1TKZA 3AVAA 2OZMA 3H2LA 5KGWA 3G6XA 3QZ8A 3HL8A 3ZT4A 2ZD1A 2I5JB 2FLLA 3VQBA 2HHSA 3Q8QB 1MU2A 3O3GA 4QW8A 3GIIA 4FJIA 2WOMB 1NNDA 2KZMA 1C1CB 1RT5A 1YT3A 3RMDA 3NL0A 4B9VA 1S49A 4I7FA 2ETJA 4CIEA 2IM3A 2IJFA 3SQ2A 5FRNA 4F8RA 3LP2A 1TGOA 4FW2A 3TABA 2OH2A 3WNGA 4FJ5A 3KLIB 5L1JA 1CSJA 2KZZA 4Q8FA 4C8OA 3QLHA 2JEIA 1EP4A 4LSNB 4EBCA 2YHAA 5EDWA 2BR0A 4RU9A 3HXMA 4F2RA 2ASJA 3DOLA 4Y3CA 2WHOA 4FCYA 2ATLA 3MR6A 1S1XB 4I2QB 4Z4HA 4DQPA 4K50A 3L2QA 5D3GB 1BQMB 1G15A 3CIZA 3OYKA 1L3VA 4ECVA 2G8FA 4DSKA 4C8KA 5KFNA 1XR6A 4FLXA 5KFPA 2O5DA 3IRXA 1S1UB 3NH1A 3O3HA 3CFRA 4LSNA 1EP4B 2FVSA 5JS1A 2W8LA 1L5UA 3V9WA 4H4OA 3VQ8A 3K5NA 3H5SA 3H59A 1TK5A 2V4QA 1BQNB 2P51A 4NCGA 4IR1A 1D9FA 4QWDA 4M3XA 5HLFB 4JV1A 3ITHA 4M41A 4CECA 3MTKA 4CJ5A 3EY1A 4RW7A 2IOCA 3LWMA 1LW0B 3TI0A 3SJJA 4EZ9A 3OLBA 1GX6A 3ZSOA 4DTPA 4KV8A 2KTQA 2FVPA 3CO9A 4C8NA 2WCXA 3B6PA 4TQSA 3M9OB 1RT4B 5KG7A 3OSNA 1JLQA 4HUFA 3NAIA 3LP1A 3AVLA 3KOAA 3ZSQA 2OA8A 2BQ3A 4FM2A 2FLNA 2GC8A 4M3ZA 1ZBFA 4DQRA 1F21A 2AX1A 3HO1A 3UPFA 2HNDB 2FBVA 1RILA 1NJZA 2GBZA 1JLEA 2BGGA 2UVUA 2XWYA 4N47A 4TSXA 2G8KA 3QETA 4W5RA 3BQ1A 4WXOA 1A5WA 4AH9A 5F8LA 4HHTA 1RBVA 1YTUA 1I3AA 3THVA 3VA3A 4CJEA 3KIOA 4B3OB 4IG3A 2E9ZA 3KK1A 1RBRA 2FC0A 3TAMB 3Q8PB 2ILYA 4MFBA 4CEQA 2FJXA 3CWJA 3I0SA 4K4TA 4DSIA 1RDDA 3D28A 2Y1JA 1SKWA 1HNVA 4YR2A 1WAJA 1RDAA 3BQ2A 1KFDA 4TLRA 2WK4A 4YMEA 3JSMB 1T8EA 4MQ3A 2GIQA 4OLAA 3M8PB 2W7OA 3NBPA 4AHUA 3MECA 1WAFA 1LAVA 1SUQB 4CF0A 1T03B 3C6TA 3QZ7A 1JLFB 1JL2A 3DLEB 1VSDA 3M8PA 1U49A 5HROA 4I9QA 4K4VA 4CGIA 1NJXA 3TANA 4KAZA 2BRLA 5J2PA 1S1UA 3IRXB 5F8GA 4EBDA 4ED1A 2RPIA 3OYDA 5HRNA 1C2PA 4CGHA 5KFSA 4FJ9A 5D3GA 2IM1A 5KG6A 5KFHA 4AHSA 3QIPB 1RTIA 3HHKA 1HYVA 3DYAB 2O4IA 1S48A 3DRRB 5KT7A 4K4ZA 3HVTA 1VSKA 4KPYA 1UWBB 3TAGA 4Q44A 4TYBA 3CFOA 2D3ZA 3LP3A 1OS5A 1CZBA 3C6UA 5EU7A 4HCCA 1IKXB 3QINA 2E4LA 1TKTB 3CJ3A 2CJQA 4N76A 1U04A 1D8YA 1VRUB 1T94A 4Z4CA 4F4WA 4L8RB 5FDLA 5E41A 4PUOB 4QOZB 4DTXA 4WFZA 2OPQA 3I0SB 3GV8B 2OPRB 3P5JA 4JS5A 4MFBB 1U4BA 3KLHB 5KT5A 2AJQA 4URSA 1HQUB 2E9TA
chains in the Genus database with same CATH superfamily
3NOCA 4CYUB 1EQMA 4TU8A 2VH7A 3NVMA 3A12A 4MIAA 1LXNA 2ZC4A 1U1NA 1I94K 3BQ0A 1FXDA 1SKRA 1D8ZA 3GIRA 1UTAA 1WNEA 5HJYA 1SI9A 3SFGA 3BO2A 1MA9B 3MHYA 1CG2A 4ECXA 1HJRA 3O5BA 4OI3A 1R8CA 1IBMF 3JXUA 1YJNS 3BP8A 2YBVA 2VG5B 2E1PA 3ZX3A 3W9IA 3QT5A 1N54B 2K7JA 5KFEA 3J7AN 2KQ2A 1V5IB 1RDUA 3US5A 1L3SA 4CJKA 1WG5A 3NVKA 1YG0A 3SI6A 3ATUA 1JLCA 1U47A 5EX3A 1GXUA 2B3TB 2MQ8A 2F3JA 1HWJA 2XMWA 1NLVA 2K8GA 5HRSA 1XC3A 1WC6A 5B7WA 3O4NA 4EFAC 3D6MB 5AQNA 1RA7A 2MLXA 4K8ZA 4OHYA 5F3TA 3DCAA 4OPJA 3PIPL 2JEFA 3I4HX 5IOLA 2LQ8A 4ES1A 3MECB 2QMWA 4LF2A 4YOYA 2E5LK 2G8HA 3PNIA 4LF9F 2XSJB 1F9HA 4F02A 4CFBA 2EPIA 2M8HA 5HAOA 1NU4A 4KO0A 3FGVA 4DV7J 4PAAA 3O9SA 3TQEA 3KD5E 4WIIA 4A48A 5B8HA 4BR9A 3P39A 5J1EB 1SB6A 1HQ2A 4ED7A 4CO5A 1JWWA 4CEOA 3HT0A 2Z1GA 4CHPA 4YHHF 3QAEA 2NXCA 1TL5A 2MQOA 4MTPA 5K14B 3SQ1A 5KFCA 5CD4A 1M0SA 5CYQB 3FUYA 2NRRA 3GJRB 2AMCB 9ATCB 4X4OA 3OBYA 3THYA 3PW0A 2E20A 3B8AX 2FLPA 4FOIA 4S0MA 4O3PA 3AVFA 3ZSZA 4PG7A 4LF4K 4FLUA 5LSRA 2P2CB 4JKGA 1LK5A 4FJGA 4GVMA 2VD3A 4UOFA 1NPRA 2V8DA 5AQGA 1Z05A 2R2TA 3UDEA 3DHWC 1IM6A 2O8DA 1VC5A 2B9YA 1N32K 1N33K 5KT3A 4UOCA 3R6GB 4ZVGA 1RBSA 1IR1A 2OD4A 5ETSA 1KEKA 2R2RA 3IXQA 1M5VC 6FDRA 3O1BA 2IVMA 2XGPA 2KH9A 1HUXA 3CCWA 1VQKS 1KVCA 4IQMA 3S7RA 3S8SA 1GQEA 4PWDB 1QE1A 4XPEA 4CJLA 4WYLA 5CH7B 1IBKK 1MN7A 1OQ3A 3C95A 1REVB 3OW2M 4DV1F 2W9AA 4B17A 4OI0A 3N5BA 1U48A 1KBRA 3CCUS 1FJCA 1GK8A 4NYFA 4HEA9 2KVIA 3EDQB 2VICA 4CHYA 3FSYA 5AXLA 3OVBA 1T9XA 3QLHB 2A1BA 5FPMA 2K7KA 4U6PA 4D3HA 2LQJA 4OHWA 2IRYA 3SPZA 3NAHA 1U0SA 3LTOA 1VCTA 4ECTA 4NYZA 2WTFA 3U4LA 2GAGC 1YGYA 2DNLA 3TR5A 3LGNA 1HNIA 3L2UA 3ZZRA 3OFEA 3H08A 3UCUP 1U1OA 1K9MT 1HQUA 4CEZA 1GX5A 3N01A 4G1QA 4WFBQ 2P9PB 3QT8A 2C2OB 2J9DE 5EX5A 1HNWJ 4JI7K 1X0PA 3IM8A 4I67A 2BE2A 2DNPA 4P7TA 3SV3A 3TSQA 2VGMA 1QQMA 2EVZA 3HSGA 3UKRA 1QVFM 2KFYA 2WVDA 2UUBJ 2YWFA 3F9MA 4E1JA 4GKJJ 3VTHA 5LJVA 2UUCF 4CJPA 3KTQA 3FZKA 2UXDK 4CCHA 2V4JA 1VQ9S 5E84A 4CBWA 4MDBA 5F0UA 1XHZA 5AQZA 4YQWA 3LQVA 1J2VA 4XH1A 3MFIA 5DRKA 4ZPCA 2HMIB 4B02A 4GKKJ 1BWVA 4ID5B 1NK9A 4NCGB 4JLHA 1NLKL 4CLZA 3QYYA 2DPJA 3M2UB 3CJ8A 4CEEA 2EXUA 2ZJPL 1YWXA 4Q0BB 3O6WA 3I5BA 1Z4UA 4J9SA 2H1YA 4X4UA 3FSIA 3MEDB 1PKUA 3NF7A 3T1YJ 3LZJA 1K1QA 3RR8A 5DMRA 2ZGZA 1DT9A 4RNMA 4C1NK 4Y34A 4FJNA 1X8DA 3I9ZA 1YAGA 4BS2A 4OL8A 1FWPA 1WN7A 3DM2B 2MLZA 3IFRA 3OHRA 4FP9A 4M94A 5KG4A 5MAOA 5LT5A 2E7VA 2KRBA 4O3RA 5GAGP 2B7CB 2P9SA 1YLXA 3K5LA 4BRFA 4CZIA 3WX4A 3D6TB 1DTTB 5KT6A 5KFXA 1XMQK 1VK3A 4FS1A 2MKCA 1JKHA 1QAXA 5JLFA 3VN5A 2IMWP 3VAJA 4KRWA 3GSIA 3PW4A 2V0NA 3DHXA 4BC7A 4Z0UA 4NOHA 3VF2A 3SAGA 2I5JA 3UN2A 3PYEA 2HAFA 2HAIA 3EN9A 3H45C 4WKRA 4OKEA 4O0NA 4GV6A 3VV2B 4M8LA 4AD6A 5F0XA 3G6EN 1D9AA 3CCMS 4QWEA 4PXBA 1PSDA 1W2IA 1K73O 5EVZA 3IAS9 4CH0S 1NMNA 3SBTA 3NKYA 4XK8C 5L1LA 3BYPA 4WFAL 4YDXA 4QYZK 4MMOA 4LFAK 1UEUA 3CCEN 3VGSA 3A5LC 3MMJA 4CI6A 2QA4S 3SSRA 1U8WA 3VEXA 3PIPQ 4JKEA 4M5JA 4JI1J 1M5HA 4O5BA 4LQ3A 2ZJQQ 2ASPA 2K1RA 4LC9B 3FFIB 3FEXB 1RBTA 4LUBA 3M8QA 2QGFB 2WBMA 1GMUA 3CJSA 1DLOA 2VUGA 3SZ2A 3IBFB 3SUQA 2EC0A 2LA6A 3HZ6A 3O5TB 1BIUA 5LL6d 1KXPA 1IM4A 1M1GA 1RXOB 5BYRA 3LP0A 4PG8A 4K59A 1DLOB 5HL7Q 4W5QA 3HK2A 1LEOA 2YQ0A 2FZCB 1T6DA 2YNGB 2B6AA 5BR8F 3LW5C 4ILJA 3WEEB 3A8JA 3DKDA 3D54A 4ZVOB 3CCTA 1U1RA 4OHVA 3W0LA 2Q31A 2ZUGA 4QWCA 2FSKA 2XM3A 4NLPA 3TAEA 1SPBP 2HSTA 4YB5A 3A5OC 4JI4K 2F8SA 4F3MA 4FZXC 2IY5B 3U7JA 2YKNB 1TL3A 4JK9A 3R27A 2UUCJ 3KHGA 4FLYA 4B1WB 3TQ1A 3QMLA 2KHDA 3GE9A 3G6ES 2Y8YA 2EWHA 4HI2A 4X2BA 3QEVA 3PRBA 1S72S 1RA6A 4I68A 5IC4B 3QFPA 4NLUA 4DQIA 2DGVA 3OHAA 1N33J 5C25A 4EYHB 1EWRA 2KHOA 3DLKA 3N6LA 2RE2A 4WF9Q 3O6QA 4MO4A 4ZP8A 1H98A 2PI5A 2D74B 5EHHA 2ZH3A 1L3UA 2YHWA 3HULA 2ZBCA 4QAGA 5M1NA 4NXNK 3GQCA 1QTMA 4J37A 4BDYA 2QWQA 5J2NB 2IGIA 4CEAA 3CMAN 1WEZA 3R1HA 4DTUA 3HKWA 2R8GA 3ZT2A 3FVYA 5KFVA 3TP2A 1R7IA 4J9RA 4L76A 3NF9A 1SJQA 4O44B 1WUUA 4Q43A 3H25A 4OV6A 2V67A 3KG0A 3JQKA 1UP1A 4I6AA 4E7LA 4KB1A 1SQGA 4K0KJ 4Z37A 2AD9A 4JI3F 2IBKA 4ZJLA 5KFDA 5A0YB 1S22A 4KRFA 5DLFA 5D4OA 2FGCA 1FRLA 3A13A 4DR5F 1GOAA 4LF6K 2DR5A 1VBYA 4I7FB 3WIVA 4IO1A 4NLGA 2IVPA 4NYOA 2LU1A 1HPZA 4OX7A 3VGVA 3KLVA 4EO8A 2LVWA 4KH6A 2NPIA 3UQSA 1X5TA 3GB0A 1Y9OA 4ENOA 1LWCA 2XS5A 4O4GA 1H2VZ 4IRKA 1JJ4A 3WX8A 3OD2A 2ADCA 3B78A 3GV5B 2CGLA 1EZZB 4CHZA 1JIHA 3OS1A 4Z4GA 2Z2ZA 1ZAWA 1TKZB 2PC6A 3JYTB 4NEZA 2MZ1A 3D67A 2C3UA 2B5JB 4NI2A 2DR8A 1YKWA 1IG9A 2BJ9A 4ECQA 2M70A 2L48A 4RBVA 2QKBA 3D7SB 1RQ0A 5SUHA 1NUEA 1BCOA 1KONA 3QFWA 3HOTA 2COLA 2GEMA 1IKWA 4MKAA 1MROB 3SQ4A 4KGMA 4BC3A 4CJVA 2JLEA 3LANA 3AVJA 2XNQA 1GNKA 3CYMA 2B4JA 1ULRA 3ET6A 2OPRA 3SEOA 2OEJA 1RYRA 4DL3A 4JKCA 4RTFD 1WSRA 2Z57B 3M1VB 4IXCA 3TUPA 3VHQA 4DX7A 4YP3A 3LDNA 4O3OA 3RMAA 1Q4RA 1GTEA 1NXIA 1UFKA 5AXKA 3C6UB 5EGYA 4ILMA 1J9AA 1RAFB 4DL5A 1KCFA 4NA1A 2X1FA 4B3TF 1LFPA 3UB5A 2OEKA 4JOUA 2FF3B 5E7OB 4ECWA 4X65F 5JVHL 4XEIA 2DCUB 4N5SA 4ELUA 4F3QA 3SI8A 1U02A 3MMCA 4DCJB 1A9NB 3M5RA 3RMBA 3UD5A 1BISA 5AZJB 4C3LA 5D6GA 5BPMA 1P8GA 4M5IA 4WP9A 3CJ0A 2C2RA 2CH6A 4JKBA 3LP2B 1WG1A 3AY9A 2YH1A 5D0EA 4I1TA 2ASLA 1KLMB 3B6OA 1Q5YA 5LY3A 3O44A 4AE5A 1Q79A 5KRTA 5D0HA 3H98A 4LF8J 2IVYA 3ZSVA 4JHDA 1OYEA 2BE7D 1CJUA 2XO7A 4CF9A 2R2SA 1OVYA 3AH6A 3KNGA 1IN0A 4O4GB 1FERA 2QL7B 5LSLA 4G3IA 4YB7A 4NASA 2Z58B 2Q3SA 3GIJA 2D3UA 1RU2A 4ITSA 3TVYA 1YI2N 3OFHA 1NJWA 4RG8A 2WSCC 1LOUA 3P4UB 2GZOA 4KQZA 3VMFB 2W41A 1PYSB 3CCVS 2EK6A 1T0TV 3UVJA 1S10A 3TTCA 2HQCA 3CPWM 5KFGA 3PXGa 1NKEA 4A8KA 2DXFA 1BMQB 4LF5J 3OJSA 1N5TA 1XK8A 1HKGA 5KOXA 3L4IA 2MQMA 2YI1A 2F9DA 1X4EA 1U09A 2MYFA 3DOLB 3CQYA 4Z7YA 4WZQA 5C12A 1FE0A 5KFYA 1HYSB 2XMJA 2L9WA 4H8KA 3CC4N 7AT1B 3MEEB 3AXMA 1ZBIA 1QTNB 2E5LF 1NDPA 4IOAQ 1YTAA 2V8GA 5F1XA 4LF5F 3D7EO 3N6NA 3ZZZA 4B3TJ 4QIFA 3KLFA 3B54A 4DL0C 4LRCA 2Q6BA 4FXWA 4NO7A 3CCQS 2V4JB 1V3RA 1UETA 2ZKUA 3QJLA 4B9TA 1IG8A 4B1ZA 3A2FA 5ETOA 4CGGA 2W6LA 3WBZA 2GQCA 3ILIA 5J2NA 3VENA 2EK1A 2OTJN 1VLOA 3I55N 4NI2B 1B9FA 4IG0A 1X4HA 2E1YA 2WVCA 5KGXA 3ZZ0A 1KLNA 1MMLA 3ZT1A 3QO9B 1FDAA 4ZPWR 3FZFA 1HHSA 1HBUA 5A8RB 1GLCG 3OBIA 1X5SA 5K9FA 4JUZA 2KKZA 1JJ2R 3PFEA 3AJ1A 2HK2A 5DDPC 1RHUB 2EKYA 2X6NA 3KUGA 2ZBQA 2QKKA 2KU7A 3ID8A 3H5YA 2DKOB 1HPZB 4DR6J 4Q2LA 3OHBA 4RKUC 3MXIA 1CXQA 5LJWA 3D6RA 1F9EB 1HBMA 1KLMA 2W2NP 2NSCA 5BYSA 2AGOA 5EOYA 2C2EA 2AZ1A 1FCAA 1S99A 2QSWA 1NK4A 3GV7B 3MDQA 2L08A 4LSLA 2DNGA 1TV6B 4NYPA 3WQPA 4P74A 2OD6A 4OI1A 1QSLA 1ZAXA 2XYGB 4QQBA 3I9V9 2HPUA 2JX2A 4K5RA 1ITGA 3LL3A 4NZ7A 3L4BC 3I8BA 4BC9A 3WEEA 1RNHA 3SUPA 4K25A 3KWIA 2IRXA 1T3NA 3P1GA 3H1VX 4DUZK 1S79A 3R1XA 2CQ0A 2CKWA 2R7VA 3OA9A 1UZHA 5U47A 1S1WA 3S9HA 3W63A 4IOCQ 1RFQA 5AQIA 1Y5LB 3ULEA 1XQSC 2BX6A 1Q9YA 2FHKA 4E1MA 2J0XA 4PXCA 3DXKA 3DRSB 1U0HA 3EPIA 3IP0A 5DJBA 1KVAA 1EKEA 5A2QY 4KJIA 1NU0A 2A6OA 2O8EB 1UOCA 2MZQA 2YNHB 4BRHA 5BRFA 4K8XA 1BY9A 1RGIA 1I6JA 5EWFA 1DHMA 2ZM6J 3VQQA 1KTVA 4ZVFA 3JSBA 2Y0BB 3CVKA 4RJVA 2XSFA 3MD3A 2ZEJA 3PACA 4L6V3 1ZAVA 2YNFA 4HR2A 3MEGA 1XWLA 3QGGA 2X7IA 4WCEQ 4P6QA 3IAYA 5E3QA 2KHCA 4Z7CA 5CZ1A 4KHUA 4Z4EA 3U8XA 4DR2J 3W2WB 3K2YA 4NLYA 2GV1A 4NPOA 2F9WA 2W1BA 2W2PP 1Q1KA 1XJWB 3TZZA 5HATA 3RUBL 4FM0A 2PMWA 2FXUA 1TL7B 4H0VB 5KG2A 5B0BA 4DR1F 2EFOA 3WXIA 3VWSA 4CEBA 5AFUH 4BC4A 4LH4A 1N32J 2PN6A 1RLDA 2J76E 4HWIA 1FEEA 4PUOA 4YOTA 1FNMA 3DRSA 1U0HB 4CJ4A 5HP1B 3G0ZA 3PSFA 1S1TB 2Q36A 1VBZA 1IBMK 3KLGB 3FSXA 4RW9A 1X60A 1GLBG 5BPLA 3Q8UA 1AUSL 4YDDB 2IVFB 3UD3P 2HZVA 2XCAA 5AJ3K 4CLYA 3AGKA 1T95A 1RDBA 2ZDOA 2ASYA 4PQUB 4FSVA 1Y5IB 4GY2B 4CZFA 4BRPA 3QPIA 4FK4A 4HI1A 3JTOA 1FKOB 1S1XA 4BY9C 4QR1A 1J5OB 2YX4A 1EO1A 4MJKA 1RP5A 4FJ7A 3UNGC 4JV0A 5KFUA 1GOCA 1PAUB 2UVVA 2Z1HA 4DSFA 1I94J 2WONA 4M5HA 5HROB 4M5NA 2CVIA 1JLFA 5IT9Y 3CCJS 1HW9A 2C2ZB 4A8WA 3EKSA 2OMLA 1FI4A 2K3KA 4B3RJ 4ED3A 2A5XA 4CJ7A 2Z1IA 1H73A 1LXJA 2MLYA 1XMQF 3O3LA 2RUSA 4PKIA 3AARA 3GJTB 4U7CA 1APSA 3V6DB 2E5JA 2W8KA 2YNHA 4KHNA 2UXBF 1LWCB 1F2HA 3NCRA 3CB4A 3CTRA 1NZAA 3TWHA 1TVRB 1NBWA 1S0VA 3O1WA 3BO4A 1N5QA 5FLXU 4TU9A 3L4QA 2PA8D 2VOPA 3RAXA 1K9MO 4RW4B 1X5OA 2JGUA 4DUZJ 3JS9A 2C3YA 3QNOA 5DQHA 2XHCA 1RT2A 2RNEA 2DNMA 4UQGA 1NGAA 3J7YU 4USWA 4FVCA 2XYPB 1WC0A 3EZUA 3GILA 2CAJA 1ZXOA 1SKSA 2XTJP 3FKBA 2G2ZA 4NRTA 4DV0F 2YTCA 4OPKA 4ALZA 3CJTA 1FKOA 3MXJA 3LOUA 3MMBA 1VQ7S 2PIIA 3R5GA 4EI2A 3AVIA 3TR8A 5GAGI 2AHOB 2GVZB 4O4RA 3F9KA 4JBCA 4FJMA 3J81j 4X65K 2XEXA 3SCLE 3ITHB 3FZBA 3VGUA 4CLPA 3UR0A 5HJXA 4Y2KA 2VQFF 2WTUA 1VQ5S 1TKXB 2UU9K 5C24B 2ALYB 3RBZA 4NLWA 3BN4A 3TJ8A 1GT8A 5CD4H 5BR8J 4OQJA 2RU3A 2DHHA 5ADXH 2LQ9A 2JEJA 4BG8A 3CSKA 1MW7A 2P5GA 1RHMB 2J6SA 4IFVB 2NRXA 1VSIA 4L3NA 2VBZA 1C1BA 3PVXA 4KGZB 5LSOA 2MB0B 2EFQA 4IG3B 4H4KC 4DTRA 3B6BA 3ZSRA 1VRTA 1MROA 2WB4A 1N48A 4FJJA 3O8MA 1NCLA 3JTPA 2D0AA 4DU3A 4LF1A 3MWTA 3MM6B 2XMMA 2NSBA 4H0OA 2YX6A 4EP5A 5CYQA 2H54B 2YHBA 2DEJA 4LBPA 1OIAA 3OL8A 2KB2A 2LU2A 4LFAJ 2DTUA 4DUYK 1B70B 3ASMA 3ETOA 3AVAA 2FIUA 2MPUA 2OZMA 3G6XA 1N52B 2I5JB 3VQBA 5D4NA 4CDIA 1JNZB 4BRQA 2MKHA 2E2PA 4GV9A 3O3GA 2FHOB 3GIIA 4ZS6A 2WOMB 1NNDA 4DOZA 3PRVA 3POTA 4R79A 4I7FA 5M1KA 1VHFA 4CIEA 2IJFA 4CH1A 5FRNA 3LP2A 1TGOA 2OH2A 3K7RA 3QWUA 2HF4A 1CSJA 3JAMY 2KZZA 3QLHA 4LSNB 4EBCA 4IEIA 3D0HE 3IUCA 2BR0A 2XZTB 4LF5K 3DOLA 2CZ4A 1IVZA 2B4UA 5JVGQ 4JYAF 3ILLA 3MR6A 1S1XB 4I2QB 1FFGB 4ETXA 3OTEA 4BHQA 4K50A 4F26A 2R7WA 1RABB 3OYKA 1L3VA 2GQQA 1YVNA 3IRXA 1S1UB 1CBKA 2MJNA 2V50A 2IIRA 2FVSA 5GAHI 4WTOB 4KGVB 2JJ4D 5JJBA 2W4CA 1BQNB 1SJRA 3IA0A 4RX6A 3RVCA 1E6YA 2MGZB 3WHIA 3BO3A 4QWDA 3TTDA 4YDUC 2UXDJ 4M41A 4CJ5A 3UN5A 3LWMA 3NCQA 5KAKA 4LRBA 4EZ9A 3MM5B 3OLBA 4DTPA 3NS7B 2FVPA 3CO9A 1E3MA 5E26A 4K0KF 1NGDA 3MMBB 5BYQA 2J9CA 3M9OB 2GJFA 1RT4B 3EZOA 3BGOP 3OSNA 2D69A 2KYXA 3NAIA 3LP1A 3AVLA 4L73A 3CCLN 2FSNA 2DNHA 2OA8A 3J7ZT 3U02A 4H5TA 1ZBFA 1F21A 1SBRA 2CJAA 2X51A 4AM6A 2HNDB 1RWXB 3SBMA 3M32A 2GBZA 2J7KA 2YJEA 3G71N 4C1NI 4I6WA 5DM6Q 4W5RA 4WXOA 2Z30B 4JV5K 4AH9A 2UUCK 2BM1A 3TX8A 1OJ4A 4AL5A 3THVA 4B3OB 4IG3A 3KK1A 2LLZA 2FC0A 2ZKTA 2DGQA 3IKMA 2ILYA 4JI7J 1HNWK 3HHDA 1BWEA 3A5MC 2KDOA 2EBEA 1RBOB 3D28A 2AYBA 1SKWA 3W7BA 3CMAS 1GTHA 4DR6K 4YMEA 1T8EA 1GLJO 2GIQA 2MQNA 2B9EA 3IBWA 2RRNA 2W7OA 1LAVA 4CF0A 3ISZA 3C6TA 2H5JB 2SXLA 3VAGA 5HROA 1SIZA 2OFHX 2QC3A 3CDAA 3IRXB 5F8GA 1WHWA 3OYDA 2V34A 5HRNA 2YJFA 1H72C 4F67A 2HQDA 2IM1A 5KFHA 2I8EA 4Y6IA 1AFJA 4K4ZA 2QWOA 4DHVA 1UWBB 2KXNB 3TAGA 4Q44A 3CFOA 3LP3A 1OS5A 2PI4A 5EU7A 4PL7A 4X62K 2YPYA 2E4LA 3FZLA 3AOBA 5LMUF 1IJFB 2D1CA 1VRUB 4BBYA 3R5JB 4F4WA 1OSCA 5FDLA 2R4FA 4ETZA 4LF4J 4PUOB 3DGVA 4WFZA 2F4VF 3T9ZA 3I0SB 1Q0NA 3P5JA 2P9PA 4JS5A 3GZ7A 1U4BA 5KT5A 2HHHK 2E9TA 1AUDA 3BR9A 2B9XA 4M42A 2ZWOA 5F8IA 2R7TA 4CF1A 2YNIA 4WFNQ 1RWMB 5LM7E 3VEZA 2MKJA 3H8YA 3ULEB 2PFUA 1U1PA 4ED4A 3D2EA 2A1RA 2YKMA 1RB0A 3VZHA 1WSIA 2UZAA 1KAZA 2DTJA 4MK8A 2IAJB 2QK9A 3Q89A 1R8AA 1MN9A 3MM8B 2GJIA 2BOAA 3F2KA 1X4GA 1M5SA 5K20B 5CE3A 2QYGA 2F65A 3VQSA 2JHEA 2QA4N 3AO2A 3QATA 3EJMA 1K8KA 1K73T 4RW6A 1EX8A 1GFWB 2GUIA 4FM1A 5HVFA 2UUAJ 3HOSA 4HL9A 1LCUA 3VCDA 3C6AA 4ZLJA 1OH8A 2XBPA 2V9WA 4WK3A 4NXNF 2YVSA 3EGNA 3WDOA 2F8TA 2R3VA 2W4DA 2HBZB 5JMNA 3IR5B 3SYZA 4XAKA 2HURA 2X6SA 5D77A 5AE1A 2C2NA 4RR5A 3K5MA 5BRHA 4WQ4A 4LF8K 4AHCA 2HGLA 5L39A 1KAYA 3BSNA 5AQUA 3P5BP 3THPA 2F4VJ 2E5GA 4EO6A 4M3TA 1HX1A 4N56A 4FKXA 4IH7A 4IR9A 4I2QA 1YBTA 3OTOF 4BRIA 2FSJA 4PQAA 1FKPB 1VQNS 1AROP 4JI4J 4K4YA 3SPYA 2CIMA 4AL7A 2HRUA 1TV6A 3F41A 4QBUA 4FJHA 1Y0HA 4DI6A 3TUJC 1FW6A 3CC2S 4JKFA 3QGIA 3BN7A 2KVQE 3P5TL 1YI2S 3TZXA 3RSEA 3SUNA 2RJZA 1TK8A 3LWLA 1CULB 2E2QA 4TXSA 5F41A 2OZSA 2QWPA 3CMEN 4YDUA 3KJQB 1JK9B 5GAHU 4RWWA 1VQSA 2OPQB 3H4BA 4ICLB 2GHWA 3RSEB 1ZM4A 2DNZA 3BS9A 5IWAJ 2ZOGA 4J9UE 1NK0A 3CCSS 2A0FB 2MY8A 5D15A 3D5MA 4X4TA 2DGSA 1KNZA 1D4XA 1VRUA 1BE4A 2KJWA 2CQPA 1K8AO 4FL9A 5ADXA 3CD6N 2BABA 1DAXA 1LWEA 1U2RA 3CD6S 4JI6J 5GAHP 4MLEA 3LPYA 5HSPA 1IJJA 3BF4A 2NZCA 3KK2B 2D9OA 5D0GA 2UUAF 3EE8A 3H4DA 1FJ7A 2XULA 3RJMB 4BRNA 1S6PB 2F8HA 4OJGA 1LFWA 4PEOA 1CJVB 3SCKE 2NRWA 2YNGA 1QUVA 5H1SV 4WU2A 4FBUA 1N36K 3HHLC 2V2VA 1NDLA 4CH7A 2E6MA 4H5RA 3QDKA 5IT9O 1Y3KA 4OZ0A 2XZDB 5M2PA 2MDAA 3OR1B 2X78A 3RAMA 2GW8A 4F4KA 4DG1B 4FNIA 3U1NA 1WC3A 2JZ5A 4QPXA 1ASUA 1T9UA 3A3PB 4PYDA 3KKRA 3KHHA 2G8VA 2DT9A 4DX5A 1RSCA 2QSFA 3VEVA 1VQ7N 1HNVB 4KHQA 4OZJA 3DI6A 1SZ2A 1X4FA 1JLAB 2FVRA 1KN6A 2RQKA 2PSZA 1GLFO 1E6VA 3OYLA 3M8WA 2CZVC 1SQEA 4CLWA 1MWQA 4CK1A 3BDPA 2BUPA 3QQCD 2XWXA 1ZBSA 1HKAA 4KPCA 1NJYA 3PZPA 4KHPF 3CXCR 3LPEA 3L95X 4E98A 3QSYB 3VOVA 5JMVA 4FK0A 4Y2IA 1IR0A 3I4PA 2H3EB 3IG1B 3M2VA 4CK2A 4E7KA 2CPEA 2CQDA 5KG1A 3VR1A 1VQOS 3CCUN 1YJWN 1HPMA 2AA4A 3CDUA 3BZQA 3OTCA 5DM7L 5JUMA 2OTLS 4KHSA 4N7TA 2O4GA 3M9MB 4NXNJ 3RGIA 1RGVA 2EHGA 5JS2A 4DU1A 3DAWA 4KHWA 4CJRA 2CJ9A 2NYIA 2OYQA 4DL4A 3KJVA 1K47A 5J2PB 1SC3B 1IWGA 1HD0A 3P45B 2YY3A 1TUWA 1CC8A 3VQ6A 2BKOA 2DCLA 1QVGR 4IH6A 1T03A 2QFIA 3TU5A 4LFCF 1IH7A 1RTHB 2QZ8A 4WBFA 1DKGD 4P71A 4AHVA 2NZTA 1F3FA 4FXVA 5M1FA 2A42A 1UZDA 3H5UA 4DHYA 4BWMA 1DQAA 1JLBA 3SXLA 4KB7A 3ZYYX 2KT2A 2AJ1A 1NM2A 2NUBA 4ZVTB 1NRKA 2VG7A 5H1SQ 2HFNA 2W42A 2N7CA 5LL6Z 2DXEA 2I2YA 3Q24A 4NLVA 4I6YA 3C15A 4M5MA 4FWKA 1RKJA 3DRPB 2M0GB 3PV8A 2OUGA 4DV7F 1W25A 4CHQA 1IV0A 2MKKA 3ZNJ1 3AJ2A 4IKAA 1OVQA 3C7NA 5KFMA 2AJFE 2CG4A 2NUHA 3D3BJ 2RRAA 3Q8YA 4UUXA 5DDQC 1S9EB 1Y4ZB 1YDLA 5HN0A 1HI1A 1XNQK 1XIQA 3R8YA 3F0NA 3PKMA 2F96A 4LRAA 2K06A 1VRQC 2CNLB 4DUYJ 1RCOB 3KMQA 4ECUA 1UVMA 1XI1A 1TL7A 3D2FA 3BSAA 1PBAA 4MKBA 2KXHA 3I8DA 1WWHA 1ASWA 2DNYA 4YOXA 2FJEB 3MXHP 1K0TA 1MWMA 4DR5J 1ZYQA 2X74A 4DG1A 1V3ZA 1CZAN 2ZGYA 1E6YB 2XRIA 5HMWA 1JLEB 1S1WB 4OYBA 1TKTA 2ABYA 4DJBA 3H20A 3LDSA 3NAEA 4TY8B 3MEGB 3ICLA 5AQWA 4JI0K 3PO5A 4HHUA 2G0CA 4JEPA 3QEPA 3CM5A 2M3DA 5IT4A 3Q86A 3RAQA 1JCEA 3OFGA 3DYAA 5KG5A 4BDPA 3CDWA 5J1EA 4H0TB 3E1YA 2ZVIA 3PW7A 4GKKF 2VDIA 3DMJA 4GW6A 2BJEA 3ISND 1DBDA 2UXBJ 3FR0A 4WP8A 2Q2RA 1YJNN 3NMUA 3KLFB 2J7UA 1G4CA 2RILA 1WSVA 5THWA 3KUHA 3V1OA 1DFDA 4PABA 3NEKA 1PC4A 4OMFG 1RDWX 2YQ3A 3DLEA 1LW2B 2AU0A 3CUNA 1O51A 2P6SA 1A0OB 3LALA 1XQIA 3U6FA 3FQLA 4FWSA 2AYMA 2ZNZA 5CCMA 3R5CA 3J81U 2VQEK 5DQGA 1S5JA 2GVDA 1ITPA 1R0CB 2UXCF 3J7ZO 5KFZA 3CCZA 1ZC6A 4DX8H 4NLRA 3AB2B 4KI4A 4DPTA 1BQMA 4QPTA 3ZZPA 2ZHAA 2RB7A 2LFVA 1J54A 5E3CA 1V9OA 4CI0B 2QLBB 3AVNA 2H5EA 3UI3A 4KFBB 1QE1B 4ZN1A 4RBTA 4CT9A 4UZBA 4DR5K 1NAQA 2HBMA 1F5CA 3BB5A 1EXQA 1KOOA 1UAXA 5CQGA 2XCPA 3B4MA 4ZCKA 3CC2N 1X4DA 1Q8KA 5LXYA 3D1QA 3JYTA 2DPIA 1PYTA 3TO8A 3T69A 3P3DA 1HNZK 2DFFA 4YN3B 1BGXT 4X66F 5JXSA 2GWKA 3ZX2A 1XNQJ 2QM1A 1TYQA 1X1PA 4Y1DA 1C1BB 1VQPS 3KLHA 4FVUA 3EGVA 2CQ2A 1S6QB 3V4IA 3PR5B 4GKKK 2VG6B 3CO0P 4CGDA 2EFGA 3FBBA 4YR0A 4FWNA 4FWQA 3K8WA 1KC8O 3TPQA 2VBXA 1S9EA 4KAIA 5KFWA 2PMHA 3MN9A 3G6YA 3TUZC 4GO5X 4M3WA 3DDNA 4DF4A 3MAAA 1NNEA 1O1WA 3HDSA 2V51B 1RHQB 2I9SA 2C1EB 1GXLA 3NG8A 2BJDA 1XHXA 5C0YA 1RT7B 1VRTB 2HBRB 2G0IA 2MSTA 3ZTPA 3SSQA 1ZA1B 5LXRA 2UXCK 1IKVA 5HOOA 4OYMA 3TTFA 4DV3F 3LDPA 4QWBA 3R5AA 4H0YB 3OYFA 4FLVA 1Z25A 1RT7A 2VG5A 3KK3B 3HMJG 4ZIVA 2VWKA 2RKIB 2RD5C 3I33A 1TMMA 2CJKA 3TJAA 1LK7A 1AZSB 1N0UA 1TL1A 2LDYA 5JICA 4O3QA 4RUBA 3BBBA 4AF1A 2DISA 4KH1B 4X66J 2W9CB 1LW2A 3THTA 1UFLA 4FJKA 4ILLA 4R0EA 3Q83A 3GDQA 5DG9A 4F2SA 1RT1A 4DUTA 5ETLA 1ZETA 3DXMB 3P83D 4J9MA 2G4BA 3F5TA 2R7YA 4P52A 2D41A 1RTJB 2GAHC 2QO3A 2OANA 3IWNC 5DLGA 4J9NA 4K0KK 2CPHA 3DLBA 2ASMA 3PG9A 1RWKB 3M3ZA 5AQJA 1C0TA 4N8OA 1R0BG 3K59A 1XBWA 4P2FA 1U1MA 1N33F 3E01A 4U9RA 1BQXA 1RACB 4J9OA 4MYUA 2DH9A 5KPZA 4LRDA 4ED2A 1TU0B 2MKYA 3NOGA 1URNA 4JD2B 1HNXJ 3HHLA 3CJCA 4K41A 2DR9A 4ANDA 3Q7BA 2CQBA 2G2YA 3MFHA 5DZ7A 3QJPA 1VQMN 2ZQBA 4M3YA 3CGIA 3FZHA 4HTUA 2KFNA 1VSFA 2M52A 4KH5A 3TAPA 2QFJA 4XDCA 4M3UA 1YIJN 4HTLA 1GLEG 4LD0A 3HPGA 4DR6F 1BQNA 2QWLA 4JP8A 1NSAA 2VKZG 4UY8T 3VQEA 3FCWA 4CWBA 2GMJA 4I56A 1Y11A 3TSPA 4G1PA 3PSIA 2GVZA 4Y65A 2UU9J 3SDEA 2QXLA 2XS7A 4U8VA 3L3UA 3J8AA 3L7PA 3HSTB 2PFFB 2UUTA 4DN0A 1IQZA 2XZWA 3GBTA 1IQTA 1Z26A 4R0JA 1TZ0A 3BPSP 4X65J 3LM9A 2YH0A 4FF2A 4FZYA 3T1YF 2VQFJ 5EXWA 5J2QA 1NEEA 5AE2A 1VBXA 4W5NA 3M2UA 4FPIA 3WC2A 3HPOA 3I32A 1RTHA 1DEJA 2J6TA 4F4AA 2IA6A 4CESA 1XERA 5KFOA 4KHPK 5ITHA 3IN5A 2F4VK 3J7Z5 3I0RB 2QA1A 5A6PA 2AJ4A 4F4XA 4IFYB 3KJVB 2O1PA 3EEQA 1M5KC 3RBEA 3EYZA 3THXB 2E1MC 4IUFA 2DY1A 1NBEB 4K7QA 2ZF5O 4IOBA 2MQPA 2DNRA 2ASDA 4FF3A 3W8GA 4QCLA 3PEJA 4ZPDA 2QEXS 2N3LA 4AFFA 3M8RA 3K57A 4B3MF 3OL6A 4X4SA 4C8ZA 5KFQA 1Q18A 1N5YB 1JKHB 4IZ9A 4Q7AA 4OHZA 2RDJA 3HTVA 1OPIA 1MWZA 1REGX 3H40A 5IWAF 4JNEA 4TY9A 1RT3A 1QY7A 4Y28C 4OX6A 1ILYA 3HKZD 3HD2A 4IO8A 4DV3J 4Q45A 1Q53A 4RNFA 2CQ3A 1YXQA 1HKCA 2V4RA 1TP7A 1J5EK 4OX9F 1T9VA 2VZ9A 4KTWA 3L2VA 3QB0A 2UYTA 2YWKA 3NGSA 3QAUA 1U24A 4KIAA 1EKSA 5DGAA 2Q1LA 4O5FA 2Q1NA 4DQSA 3R6MA 1U2CA 4L74A 5KFTA 4OIXA 1IBLF 1KD1O 2E9RX 2CPDA 4C2MA 5DGBA 2QWNA 1XC9A 4BRKA 4CO3A 2W01A 2KM8C 5KFRA 1OY8A 3TARA 2RQCA 5AXMA 2HQ3A 3PJXA 2CQHA 3WT0A 2D4WA 4NCBA 3FMWA 3D1OA 1XR7A 2N4CA 2QT7A 1VI7A 3SNNA 3OYHA 3OUYB 3AOCA 5A2QU 1HR0F 4TVAB 4HLBA 1VQLN 3MD1A 4F4YA 4JI5K 1HW8A 2KKHA 4ZOSA 3D2EB 1G1XA 1SJ4P 2H48B 5ETPA 4DR2K 2DY4A 2EI5A 1FRMA 4B3RF 2DHSA 2E29A 3R2CJ 2HWIA 2HOEA 2VBYA 2BUNA 3LP1B 1R43A 1Z1ZA 1ZM2A 5BRDA 3KK7A 4K4WA 1YVUA 4HH0A 4FVMA 1RTDA 3GCXP 2CNKB 3CJQA 2RHQB 4IDHA 4U8YA 3BREA 1R0AB 3LUYA 1QAIA 1JB0C 3G25A 1P6TA 5FJ4A 3WQTA 3OW2R 1JMTA 1YJUA 2WFBA 1NZ8A 3BPDA 4JYAK 1GMWD 3U9DA 3VGMA 3OUYA 1RT6B 1OSDA 4A8MP 3BBCA 4B9LA 2XY7A 1N36F 4OJ1A 1FKAF 9RUBA 1KP6A 4WQ5C 2XY6A 1SH0A 3HP6A 2GQ2A 3TAQA 1GLDG 5LMUJ 1U8SA 2IA0A 1G99A 3SDEB 5BREA 3N9UC 4PPZA 4B8CA 4KO0B 1FRHA 2CH5A 2QWRA 3OLAA 4ECYA 4LFBJ 2QWMA 2G9OA 4CLTA 1FD2A 5LMNF 2FJWA 1VBKA 2YKMB 2DNNA 3H46O 3M8ZA 4KTZA 2GFFA 1X4BA 3HM8A 1BDGA 3I82A 3EPGA 3L2RA 4A8SA 3MUMP 1RT5B 3OQ2A 4OPHA 3K9JA 2VG6A 5M2RA 4ICLA 3PW2A 3O9RA 1CEZA 4USIA 1SH3A 3A3OB 2RH3A 2HNYB 3WXKA 2DBBA 5IQ6A 4GRSA 2Q0RA 2N3OA 2DGXA 1S5ZA 5FPEA 3TYTA 4CE9A 4D3GA 3EGWB 1FHTA 2C22A 3N28A 1T7PA 1EB0A 5LMUK 1WOPA 3DDKA 3BSOA 3OT9A 2LECA 2FBYA 1HJOA 3U1MA 3R2DJ 4OJRA 2JC1A 3W61A 3CCJN 1YZ6A 3L09A 3QSIA 4W5OA 1TVRA 2OPSB 2CPYA 3W65A 2KT3A 2CQCA 4WP3A 2IDOA 4I64A 1JXBA 2XGQA 1RT4A 4LBHA 4DWIA 1FJGF 4J9KA 4C8YA 2HS3A 3T5KA 4ZITA 2HBQB 7FD1A 1LW0A 4IFYA 3W66A 2AWZA 1ZH5A 3VTIA 1VIOA 4AHRA 2I6WA 2GMLA 2FGOA 3VQTA 3EVMA 4IO9L 4YOUA 2GWJA 2QX0A 4K5SA 2JLGA 5LMNK 2FJAB 3MMCB 2IJRA 3BH6B 3ZLJA 4DV6J 3M6VA 3MR2A 4P2MA 4BR2A 4DSLA 5GVQA 3M4XA 3PX6A 1X4AA 5HRPA 1U2FA 3NS6A 2UVWA 3KLEA 3RWUA 3KFWX 5CXTA 1SJ1A 4ZCIA 3QEWA 2XI2A 3JXOA 1TAQA 4I9LA 1VISA 3CPEA 2ADBA 4PWDA 4DF8A 3FDSA 2VFVA 4LFBF 1WSJA 4AQYK 2IAJA 1RT2B 1BA0A 2BE2B 3AVCA 1N6QA 4CFCA 1P9YA 2WW4A 4K4SA 2HNDA 3EE9A 2OKQA 2C2DA 3E9OA 3ZEUA 3F56A 1UJ5A 3MPDA 5GMDA 1VQ9N 2FC8A 1E6VB 3GMGA 5CZVA 3TA1A 1IO2A 4BR5A 1HBOA 2AYEA 1BUPA 3DRXA 2MY7A 2ZH5A 1Y7PA 3S41A 3EVWA 4CHNA 3UR3C 4CFAA 1ELOA 1VQ8S 3DLGB 4Y00A 3HSZA 4NLXA 2MZSA 3PFOA 3IG1A 2EX3A 2L9DA 1ZBHA 5GMEA 1RJJA 1JXVA 4OLOA 1IKXA 4ZVSB 2VYPA 2ROPA 2HNZB 3THWB 1RADB 3PX0A 4WK1A 4UT4A 5C2FA 4LH5A 4FN5A 5DM6L 2C2KB 1JXLA 2ZHBA 1OH7A 2GGPA 3KLEB 3AODA 4AILC 1WOSA 2VV5A 2U1AA 4ID1A 2X3GA 2ZC3A 3WUHA 3QEIA 1HARA 4K43A 4F4ZA 3M2RB 1HL6A 1J5EF 3VAHA 4B9MA 3EICA 4K42A 3MX5A 1J27A 3ENHA 4BC5A 4JKAA 4M95A 1RAOA 5C2DA 2H4WB 4IDKA 3QNWB 4YEAA 4KI6A 1TKXA 2HW3A 3PHEA 4KBOA 3TX0A 4DV2F 3S6EA 4ATNA 3G82B 5AQFA 1HHQA 3IMXA 4ZMMA 4O55A 4O23A 4F25A 2JL9A 5AQXA 3ZSWA 4NLQA 4GMKA 3I31A 5CCLA 5B0AA 2RVJA 3J7AP 2VFRA 3ZT0A 1HMVA 3L0QA 5C25B 1M1KT 3F73A 1T02A 1SL0A 4I6MB 4DTJA 2BANB 3IMQJ 3R5DA 2OGUA 2XI3A 3FE1A 4CO1A 1CQNA 3DU5A 3T1HJ 3OFFA 3VGLA 1A7GE 2FD2A 3GLJA 4ERDA 4EK2A 4C97A 1MNEA 3Q0AA 3PCOB 3MM8A 2R8KA 3BGLA 4DPOA 4LREA 3M9NB 1G7CB 1HIYA 3CE8A 3WNHA 5B0DA 4HKQA 1XTZA 3V9XA 4R8UA 2J6UA 5BJRA 5KFLA 1FKPA 3P4IA 2RHSB 4FOEA 4X4VA 3UFCX 4DR2F 3BGUA 3ZT4A 4FWMA 1X5PA 2B8QA 3NXZA 4J5OA 1FX2A 2FLLA 5A8KA 2X1BA 3Q8QB 2RQMA 1MU2A 4H4KA 4WJBA 4QW8A 3CCES 4FJIA 3ZETB 2QL5B 1ZM9A 1WF0A 2LMIA 2ATCB 3BF3A 4GKJF 1TTHB 1W2BR 1RWUA 1Q82T 3LDLA 2CUYA 3SQ2A 2GX8A 5RUBA 4AUKA 4JI2F 3AQOA 1ATRA 3KLIB 3C16B 3KWGA 1NH8A 1YJRA 1AZSA 1UPMB 3MURP 4ZVUB 1G6BA 4OJ3A 1RAAB 5EDWA 1YJVA 5B08A 2ZJPQ 3KWMA 1KC8T 4Y3CA 2WHOA 3AHPA 4FCYA 4C0HA 4H0PA 3AJDA 1PC5A 4Z4HA 1FNXH 3L2QA 3MMAA 1M90O 5D3GB 1BQMB 1G15A 5BN9A 5KFNA 4FLXA 4B1YB 2VONA 3NH1A 2CPXA 1J6ZA 3O3HA 5JS1A 2W8LA 1BO5O 4WKYA 3H5SA 3H59A 2WC9A 4NLBA 2M88A 2B7BB 4IR1A 2LEBA 2F9TA 5HLFB 3MCAB 3M6XA 3L7OA 1LW0B 3E3XA 3D6HB 3TI0A 4OZNA 4N8NA 1GX6A 2K1RB 3ZSOA 3P31A 4KV8A 2XYHB 3A3NB 2WCXA 2BJ8A 3B6PA 3G4SN 2EC2A 2I0XA 4B3SF 1NGFA 5AQRA 4HTJA 4EAHD 4OI2A 4YHHJ 2A10A 4A57A 2BACA 4X62F 2HQGA 4FM2A 4KC5A 3HHLD 4DQRA 4WCEL 2AX1A 4DR3F 5GIPA 1VQKN 2L3MA 1NJZA 1DQ9A 2XWYA 5DO2A 1AFIA 4A4JA 1UJ6A 2Q0UA 2A2CA 3BQ1A 1A5WA 1X3MA 5F8LA 1Q81T 1KQSM 1I3AA 1ZPVA 2E7XA 4GVBA 4CJEA 4RLEA 2AJ0A 2DY9A 3TAMB 1NMEB 4BRGA 4CEQA 2N4DA 3THXA 3MEKA 2FJXA 1RDDA 2U2FA 4YR2A 1RDAA 3BQ2A 4TLRA 2ZJQL 1Q86T 1CS4B 4MQ3A 3L6QA 4F0KA 1X31C 1VQ5N 4BROA 3NBPA 3AGRA 4JI0F 3MECA 1WAFA 2NXJA 1M1KO 1WC5A 3QZ7A 2BYCA 3DLEB 3M8PA 2F7VA 1RAGB 4K4VA 3FJ2A 4CGIA 4OX8A 5B09A 4KAZA 3CHWA 4EBDA 4JI6F 4ED1A 2RPIA 4Y0FA 1C2PA 4CGHA 5KFSA 2BOPA 2J0WA 6FD1A 2HHPA 4LF7F 1OKJA 5KG6A 1H2UX 1RTIA 3HHKA 1NGIA 4EUVA 3DYAB 4WQ4C 2O4IA 1S48A 2CZ9A 2X1GA 3M30B 2HQIA 3HVTA 5HQMA 1VSKA 1U6FA 3Q8VA 4PYAA 2W24A 3F44A 4HCCA 2DGTA 2VDHA 2DO4A 5GAEP 2P9UA 2ROEA 2CJQA 5GADU 2AIRB 1D8YA 4DR3K 5HMYA 1WACA 2O01C 3KYLA 1T94A 4Z4CA 4XDDA 3ULHA 3OR2A 3QT6A 3PHTA 4CYUA 3MWBA 2FTRA 2XMTA 3ET6B 4DPYA 2D0PA 3KLHB 2AJQA 1HQUB 4JHDB 2F63A 4BG9A 4JI4F 2Q43A 1VIXA 3OR2B 3M6UA 2R8HA 3RB6A 3C14A 2QA2A 5AQQA 2NRVA 1WUAA 5H9EJ 5HMXA 1FRJA 5HLFA 5AQPA 2OFGX 3A8EA 4NXMF 3NE6A 1M90T 1NSQA 2UV8A 3DXBA 4BCAA 4MH8A 4H4OB 5EN1A 3NGIA 2OTJS 2RKIA 1B4SA 4KE5A 5CYMB 4KYZA 1MSWD 5J2QB 1ZOTA 4CK3A 2PEBA 3ILJA 2N7YA 1AYEA 2IS3A 2Z0GA 5HANA 3HYFA 3KG4A 4PA1A 4OYWA 4KKOB 3W5ZA 3NCIA 3QRQA 3GOIA 3EUNA 4DSEA 1BHLA 1S9GA 5ETVA 4PQUA 3ZTOA 4AM7A 3OXLA 3HZGA 3CNQP 1NMDA 1VQON 3UCGA 1PIEA 2ZBRA 1YITS 4PPDA 1LWFA 1SV5A 1YUWA 1T9TA 3ZCMA 3V2UC 1LKZA 3M05A 2V9KA 4FBTA 4FDFA 3IGVA 3S01A 2FY1A 4DV5F 1DRZA 2RMLA 1QZ5A 3BY5A 2OJ3A 2EW9A 2IDEA 1RUSA 2QL9B 3HF5A 3V4IB 4USUA 4FWOA 4RNNA 3AO5A 3EL2A 1VK8A 4Y2MA 2HRYA 4MKVA 2CXEA 4DV2J 4PR6A 2IDLA 4X84A 3PYDA 1VQPN 4UY8O 1KQGB 2ZE2B 3UCZP 2HIQA 2XMUA 3MOZA 2CWKA 3OSPA 3U3GA 3N4QA 1YK9A 3I6PA 1UA0A 4WXWA 1XNRJ 1UW4A 2G13A 1OYDA 2VASA 1VLYA 2MMYA 1YJTA 5IFMA 4DMNA 5K14A 4DQQA 4ED6A 4B08A 1Y3JA 4CLKA 5AQHA 1BD6A 2NREA 3D45A 2NXNA 1KVKA 3TW0A 4P10A 2CJYB 4UTGA 3BEGB 1YBAA 1Q7YT 3M6GA 2A3JA 5GIOA 4OLBA 1H3DA 1RAHB 3V6DA 5HO4A 3PKYA 2RDDA 1XMBA 2MSSA 2UVRA 3DOMB 1NJIO 1A6LA 2RS2A 4UF4A 2H9ZA 2BJ3A 1HD1A 2HBJA 2F40A 1C1AA 5KFJA 1ASVA 3E2EA 2LYVA 4GKJK 2R7XA 3T5JA 1TUYA 3W8PA 3AA3A 2LDIA 2CPJA 4I0WA 4FLZA 2Q79A 3TNVA 3HZEA 4JI2K 3M8QB 3HLUA 4CZJA 1UWBA 3BV8A 5IT9U 4FPAA 1RHRB 4DR3J 2NLXA 5T41A 4IJAA 5BXIA 3VF6A 1HRHA 4BE0A 1VC6A 3D0PA 2XHBA 1S97A 1BA1A 4X64F 4Z94A 5DDOC 3IC1A 1UPPA 3GTYX 3AFGA 3T3FA 3WIUA 2PDAA 3QEXA 1IWAA 3FZMA 4QZVB 2DNOA 3IBCB 3O8WA 1RT3B 4CF8A 4O3NA 3GJSB 3SJHA 1HBMB 4FO0A 5CZ2A 5HQ8A 4GO7X 1WC1A 2YNIB 5GAGU 4M63C 3C2PA 4RW8A 1HWUA 3SK3A 3HI0A 6AT1B 5I42A 1OH5A 2XB2D 4JK8A 2OLWA 3GWCA 1WOQA 3SV4A 4TU7A 2HVHA 1PO6A 3G8QA 3CF5L 2E44A 4GV3A 1CULA 3WNFA 3VF0B 1UVIA 4UOHA 3HVRA 4O8KA 5A8RA 4LR9A 4OI4A 3QFHA 4BC2A 4EEYA 2HWTA 2ZH4A 2J9EA 4HUGA 2ZH1A 3E01B 2AEFA 3I55S 1NSPA 4DS5A 3QBXA 3VAIA 3C65A 1IBKJ 3Q2SC 1VSMA 3PM9A 4M1KA 4FYWB 4XTTA 4L72B 1VHIA 3MR5A 4JKHA 4NX9A 3M30A 4B3MJ 4BQLA 4ZDNA 4JI5J 4FZVA 1S76D 2IIHA 5HBMB 2VKRA 3TEGA 4W4MA 3CXCM 2J5AA 4LMZA 3UN3A 1HQEB 2LQBA 1FF2A 2AKWB 1DY3A 2BKPA 5FDLB 1S4FA 3G71S 3OYJA 3LP0B 4DTOA 1X9MA 3C46A 1O13A 4BREA 1FRKA 1NHKL 3I96A 4IOAL 4RW9B 2FY8A 4OGCA 2OPPA 3GIMA 3DLLL 3QMQA 2V7YA 2B4PA 5L1IA 1ZTTA 4PHTX 2KI2A 1YHQS 3NDKA 2RU9A 2F5GA 4CNYA 3NLCA 5AJ3F 3DWLA 4U67L 3T7ZA 1FO1A 1D09B 1CJVA 4A5AA 1IUJA 3V4MA 4W92B 2HHUA 3ZTSA 2CPZA 4Z2XA 3OJUA 3VVUA 3G87A 4MIWA 1S6OA 3FC9A 1IKYA 4GNIA 3MPUB 5IT0A 4FPRA 1TMJA 1NPKA 4H54A 1WDDA 1VDHA 3RZAA 4FWLA 5AQLA 3GR1A 3JSRA 1C0TB 1NK7A 2W2OP 3K17A 3RRKA 2NRHA 2L9NA 3GU0A 2GV9A 3O80A 1FD8A 2QTDA 3V9SA 2PZSA 4A59A 4E7HA 3JQMA 3O4QA 2NNWA 1HBNB 1NGCA 2HG4A 5FLXY 1K8AT 1VR6A 2OIHA 5HBMA 3HFVA 5HMZA 4DLGA 1NGBA 5I42B 1R59O 1VQ6S 1LWXA 3AD9C 3G10A 4C11B 2ZWHA 3MM5A 1FK9A 2JWNA 1SS6A 1KAXA 1QUPA 4LF7J 2DK2A 4OFZA 2P9UB 3CEDA 2GHPA 4XO0A 4DN9A 1HNZF 4JI1K 2C28A 4ZTFA 5IC6B 5A0YA 3LO3A 3GL1A 3RB0A 2MZJA 4WZMA 3N4PA 1WSFA 1NGHA 3HVTB 1SC6A 4ZK7M 5DETA 5BPNA 4AXIA 1WOOA 3NMRA 3R7NB 3DRYA 1MWKA 3MMAB 4PG5A 4UZCA 2B56A 3R7SB 4DR4K 1HI0P 5L46A 3DI6B 3J7A1 3O08A 1V5VA 3MM9B 2MEWA 1SQFA 1H1VA 3GFXA 4I2PA 3EDRB 1BLUA 1H2TZ 5ETNA 5E3AA 1TL4A 3AA2A 3NF6A 2I7PA 1JLGA 3MUTP 2O66A 3OTBA 1ZBLA 2ZBPA 1VK0A 4HVZA 4ZCLA 3MWPA 1TELA 1QLNA 4DUZF 1XNQF 3DMJB 3IWLA 3EX7B 4YOWA 1UVJA 1LQ9A 1KD1T 1TUVA 3HSJA 1SQKA 4AQYJ 3OYGA 4NLTA 4YB1P 2YKAA 2JLFA 4J2DA 2W40A 1Q7YO 4G6VB 2QW9A 4DV6F 3UVJB 4DUYF 5K8PA 1U1QA 3GSDA 4WFAQ 2CYYA 2W9BA 1FESA 4N41A 1JXEA 4PKHA 4CJQA 2ZH6A 5C7PA 5JVHQ 3AVMA 1R0AA 2G8IA 3BBFA 2P9LB 1BL3A 4ZPAA 3NGDA 4KGKA 2GCFA 3ZZYA 1J53A 4YB6A 1OY9A 1H6KX 2M5YA 3VEOA 2BKNA 4URQU 3U27A 2ILZA 4K2XA 3FZ2A 5L1KA 3MXMA 1I1GA 2D0OA 4FJLA 3WXLA 4AT1B 4JV2A 2FB0A 2PD1A 2ZITA 2DVIA 3MN5A 1NSKL 3CDEA 2EFPA 3ILOA 3UIQA 4QIEA 2HHQA 2D5RA 1Q8IA 3MZIA 4BACA 2WAQD 4NZ0A 2LSNA 4F04B 2PYLA 2ZE2A 4Y1CA 3RMCA 3QGHA 3K58A 4WE1B 5J1NA 2QLXA 3GJQB 3DOKA 2DR6A 1QVGM 2B6AB 5GAEU 1NDKA 3PEHA 3MAQA 1CQMA 3GCWP 2ASOA 1W2BM 5DS7A 3AAPA 1T05B 2BEFA 3GG4A 3KLIA 5E2QA 4ZP9A 1IBLJ 2VJVA 4B3TK 1OY6A 5E33A 5F3ZA 4KSEB 3M8YA 5B0EA 1IBCB 1B7FA 5B0CA 4DV6K 1QAJA 3RBDA 1Y00A 5LMNJ 1QS4A 4ZVEA 2NYHA 3OY9A 1MDUB 2ZZMA 5EUHA 5CHIA 2CA9A 1NPPA 3C3LA 3QWPA 4KKOA 3PIOL 5J2MA 3I56N 3MTJA 2F8EX 4DFJA 4OO1J 4GVBB 4AQYF 2LXIA 3N4WA 5CZXA 1DQ8A 2NRTA 2ALZA 4HYKA 2WVBA 4EYIB 3CM6A 2BZ2A 2IRUA 4LIRA 5AFUA 2IJNA 2E2NA 4ZHRA 4ES3A 5TKYA 4C23A 3BDEA 4GMJB 4WTYA 5C15A 5FROA 1YQHA 2GS8A 1EJ7L 1UMJA 1HWKA 3M6WA 3DRPA 3BYRA 4DR1K 4V1Ak 3DRRA 4HVJA 3D6FB 2X1AA 4B8AB 4QJVA 3EE3A 2PFDA 4P75A 2PE8A 3OYCA 3PY8A 1EETB 1P9QC 3IDHA 2Y0SD 2QJ3A 4DB3A 3NGKA 4V19S 2AF6A 2GA7A 1Q8LA 2VA3A 4CLLA 2M8DB 1YJ7A 2HMIA 3JSMA 3NP5A 2DHXA 3QBWA 2E7WA 3MEEA 5KG0A 1YJ9S 5HRRA 4CBXA 4LF6F 2VL1A 3CULA 1S0NA 5CY4A 2DIVA 1KS2A 2B4VA 2G0JA 2DRAA 1RWWB 5KFFA 2Y9HA 3TA2A 1EX4A 2P6TA 4WE1A 4ZN3A 4LFBK 3ZXWA 4NLOA 2VOOA 1IKWB 2VF3A 1P1LA 4PY5A 2UU9F 1HLWA 1XNRF 2IYIA 2QE5A 2QG9B 1U1KA 4CJUA 5CYJA 3MOJB 3MK6A 3NNCA 4ZTJA 3P38A 4LQ9A 1U6ZA 4EBEA 4USKA 2E6LA 3VQAA 2JH3A 4ANEA 3DLGA 1NB7A 3K5PA 2Z56B 4CZKA 5CR4A 3KHLA 1YF5L 2BJ7A 2JEGA 3PO4A 4PXDA 1I39A 1NB2A 3SMPA 3FCVA 4MK9A 2EG1A 4P7VA 3ELHA 1R3NA 4OKKA 2XMAA 2N82B 1SL2A 5H9FK 2OHDA 3QRRA 2QI2A 2YX1A 1HR0K 1SH2A 4BQZA 5FIIA 2UXDF 3W2WA 4CTAA 1P90A 3E8OA 1CLFA 5ETRA 5HVHA 4YOEA 2HS0A 2HS4A 2WW8A 1GH8A 5DM7Q 3CCRN 1TL3B 2V94A 4Q2MA 2VHGA 3AY0A 2P9SB 2XY5A 4P2SA 4ID8A 4JI3J 5IQQA 2HFUA 2WONB 4JI1F 4JAXA 2I1RA 1O0PA 4FLTA 4LSZB 5I3PA 3V1QA 1L3KA 1FWLA 3J81O 3BGFA 3DOKB 4ZKAA 3CJBA 1JJHA 5SZTA 3L3CA 5M1OA 4WFXA 5KFKA 1VQ4N 1RLCL 2DNKA 2QLFB 1PYOB 1D5AA 1Q81O 1F9FA 3KUEA 4EFHA 1TAUA 1HNXF 4CF2A 2DRBA 3VA0A 4R25A 2YKPA 4H5WA 4JRQA 3TVKA 1EIYB 4DV7K 1ATNA 3IFEA 2E1AA 3NS5A 4OZ1A 5KT2A 1TL1B 4R5PA 2RQ4A 2P9NB 3KXDA 5T7LA 1Q16B 1URRA 3UO0A 4DZDA 4M45A 4LF6J 4YNQA 3IS9A 3IM9A 2A2DA 1HNZJ 2DIUA 1U2VA 2BW2A 4DCOB 2E5IA 1REVA 3H2VE 1FTRA 3HM9A 5AE3A 3P49B 3PJWA 2CQGA 3E66A 2PA3A 3MCNA 2NUUG 2FBXA 3UKRB 3OVNA 1MG7A 1KTQA 1PJ6A 3NGTA 2XMKA 4CLSA 3QO9A 4TY8A 4B3MK 4B9QA 3D9BA 2DEIA 2H5IB 3M8SA