1I02A

Nmr structure of ctx a3 at neutral ph (20 structures)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic characterization of the water binding loop in the P-type cardiotoxin: implication for the role of the bound water molecule.
pubmed doi rcsb
molecule tags Toxin
molecule keywords CARDIOTOXIN-3
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1i02A00
1ZADA 4P7UA 4XJJA 1ABTA 1LJZA 3ERAA 1F94A 2H62D 2NBTA 4QTIU 2OFSA 1XT3A 1LSIA 4DO8A 1IDHA 1ONJA 1CCQA 1CHVS 2QJBC 1CDRA 2GOOB 1KS6A 2HLRA 2N99A 2JQPA 2JVEA 4BIKB 1LX5B 1IQ9A 1VB0A 2I9BE 2BHIA 5IMTD 1KBSA 1W6BA 2H5FA 1CVOA 2X8BB 4AEAA 3FEVA 4OM5A 2CDXA 2MJYA 2CTXA 2LCRA 1ERGA 4HQPF 1TXBA 2GOOC 2MJ4A 1NXBA 1NYUA 2MHYA 1JE9A 2L03A 1RL5A 3NDSA 2BTXA 1JGKA 1FSSB 2H62C 5DU1A 1CDSA 1CTXA 2UWRA 3NEQA 6EBXA 2H64C 3U73U 1RGJA 2CCXA 2MFAA 2PJYC 3KFDE 1IDLA 2H7ZB 1CREA 1DRSA 2QC1A 1QKDA 1NTNA 1HAAA 1KXIA 1YWHA 1IJCA 3QB4B 1LXHA 1QM7A 1MAHF 1REWC 2MUOA 1S4YA 1IKCA 4FAOE 2H64B 2VLWA 1KBAA 1NEAA 1FRAA 1UG4A 1IDGA 1CXOA 1I02A 1CRFA 3EBXA 1FASA 1HAJA 5IMYC 1BTEA 1JBDA 2H7ZA 4FAOC 1H0JA 4LFTA 1NYSA 1FFJA 2QJAC 1NORA 1HC9A 3KFDI 5DZ5A 1CODA 4ZQYA 4OM4A 5DO6A 1PLOA 2CRTA 1F8UB 4RUDA 4IYEA 2ERAA 1CDQA 2FD6U 2MJ0A 1HOYA 1NTXA 1KFHA 1L4WA 2PJYB 1ES7B 2ABXA 1CXNA 3LAQU 3U74U 1IDIA 3VTSA 1COEA 3EVSC 1HC9B 3HH7A 3NH7A 1KU6B 2UX2A 4UY2C 2K3GA 2L5SA 4EY8B 2J8BA 2CRSA 1LXGA 3BT2U 1TGXA 3PLCA 1V6PA 1TXAA 1KBTA 2H8UA 1B41B 1KC4A 2QJ9C 1M9ZA 1QKEA 1FF4A 1TFSA 3BT1U 5EBXA 1MR6A 1BXPA 1IK8A 1KTZB 2HLQA 2LA1A 1FSCA 4BDTB 2MUPA 1ERAA 1KL8A 1CDTA 1CB9A 1G6MA
chains in the Genus database with same CATH superfamily
1ZADA 4P7UA 4XJJA 1ABTA 1LJZA 3ERAA 1F94A 2H62D 2NBTA 4QTIU 2OFSA 1XT3A 1LSIA 4DO8A 1IDHA 1ONJA 1CCQA 1CHVS 2QJBC 1CDRA 2GOOB 1KS6A 2HLRA 2N99A 2JQPA 2JVEA 4BIKB 1LX5B 1IQ9A 1VB0A 2I9BE 2BHIA 5IMTD 1KBSA 1W6BA 2H5FA 1CVOA 2X8BB 4AEAA 3FEVA 4OM5A 2CDXA 2MJYA 2CTXA 2LCRA 1ERGA 4HQPF 1TXBA 2GOOC 2MJ4A 1NXBA 1NYUA 2MHYA 1JE9A 2L03A 1RL5A 3NDSA 2BTXA 1JGKA 1FSSB 2H62C 5DU1A 1CDSA 1CTXA 2UWRA 3NEQA 6EBXA 2H64C 3U73U 1RGJA 2CCXA 2MFAA 2PJYC 3KFDE 1IDLA 2H7ZB 1CREA 1DRSA 2QC1A 1QKDA 1NTNA 1HAAA 1KXIA 1YWHA 1IJCA 3QB4B 1LXHA 1QM7A 1MAHF 1REWC 2MUOA 1S4YA 1IKCA 4FAOE 2H64B 2VLWA 1KBAA 1NEAA 1FRAA 1UG4A 1IDGA 1CXOA 1I02A 1CRFA 3EBXA 1FASA 1HAJA 5IMYC 1BTEA 1JBDA 2H7ZA 4FAOC 1H0JA 4LFTA 1NYSA 1FFJA 2QJAC 1NORA 1HC9A 3KFDI 5DZ5A 1CODA 4ZQYA 4OM4A 5DO6A 1PLOA 2CRTA 1F8UB 4RUDA 4IYEA 2ERAA 1CDQA 2FD6U 2MJ0A 1HOYA 1NTXA 1KFHA 1L4WA 2PJYB 1ES7B 4KSNA 2ABXA 1CXNA 3LAQU 3U74U 1IDIA 3VTSA 1COEA 3EVSC 1HC9B 3HH7A 3NH7A 1KU6B 2UX2A 4UY2C 2K3GA 2L5SA 4EY8B 2J8BA 2CRSA 1LXGA 3BT2U 1TGXA 3PLCA 1V6PA 1TXAA 1KBTA 2H8UA 1B41B 1KC4A 2QJ9C 1M9ZA 1QKEA 1FF4A 1TFSA 3BT1U 5EBXA 1MR6A 1BXPA 1IK8A 1KTZB 2HLQA 2LA1A 1FSCA 4BDTB 2MUPA 1ERAA 1KL8A 1CDTA 1CB9A 1G6MA
chains in the Genus database with same CATH topology
1ZADA 4P7UA 4XJJA 1ABTA 1LJZA 3ERAA 1F94A 2H62D 2NBTA 4QTIU 2OFSA 1XT3A 1LSIA 4DO8A 1IDHA 1ONJA 1CCQA 1CHVS 2QJBC 1CDRA 2GOOB 1KS6A 2HLRA 2N99A 2JQPA 2JVEA 4BIKB 1LX5B 1IQ9A 1VB0A 2I9BE 2BHIA 5IMTD 1KBSA 1W6BA 2H5FA 1CVOA 2X8BB 4AEAA 3FEVA 4OM5A 2CDXA 2MJYA 2CTXA 2LCRA 1ERGA 4HQPF 1TXBA 2GOOC 2MJ4A 1NXBA 1NYUA 2MHYA 1JE9A 2L03A 1RL5A 3NDSA 2BTXA 1JGKA 1FSSB 2H62C 5DU1A 1CDSA 1CTXA 2UWRA 3NEQA 6EBXA 2H64C 3U73U 1RGJA 2CCXA 2MFAA 2PJYC 3KFDE 1IDLA 2H7ZB 1CREA 1DRSA 2QC1A 1QKDA 1NTNA 1HAAA 1KXIA 1YWHA 1IJCA 3QB4B 1LXHA 1QM7A 1MAHF 1REWC 2MUOA 1S4YA 1IKCA 4FAOE 2H64B 2VLWA 1KBAA 1NEAA 1FRAA 1UG4A 1IDGA 1CXOA 1I02A 1CRFA 3EBXA 1FASA 1HAJA 5IMYC 1BTEA 1JBDA 2H7ZA 4FAOC 1H0JA 4LFTA 1NYSA 1FFJA 2QJAC 1NORA 1HC9A 3KFDI 5DZ5A 1CODA 4ZQYA 4OM4A 5DO6A 1PLOA 2CRTA 1F8UB 4RUDA 4IYEA 2ERAA 1CDQA 2FD6U 2MJ0A 1HOYA 1NTXA 1KFHA 1L4WA 2PJYB 1ES7B 4KSNA 2ABXA 1CXNA 3LAQU 3U74U 1IDIA 3VTSA 1COEA 3EVSC 1HC9B 3HH7A 3NH7A 1KU6B 2UX2A 4UY2C 2K3GA 2L5SA 4EY8B 2J8BA 2CRSA 1LXGA 3BT2U 1TGXA 3PLCA 1V6PA 1TXAA 1KBTA 2H8UA 1B41B 1KC4A 2QJ9C 1M9ZA 1QKEA 1FF4A 1TFSA 3BT1U 5EBXA 1MR6A 1BXPA 1IK8A 1KTZB 2HLQA 2LA1A 1FSCA 4BDTB 2MUPA 1ERAA 1KL8A 1CDTA 1CB9A 1G6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAD A;  4P7U A;  4XJJ A;  1ABT A;  1LJZ A;  3ERA A;  1F94 A;  2H62 D;  2NBT A;  4QTI U;  2OFS A;  1XT3 A;  1LSI A;  4DO8 A;  1IDH A;  1ONJ A;  1CCQ A;  1CHV S;  2QJB C;  1CDR A;  2GOO B;  1KS6 A;  2HLR A;  2N99 A;  2JQP A;  2JVE A;  4BIK B;  1LX5 B;  1IQ9 A;  1VB0 A;  2I9B E;  2BHI A;  5IMT D;  1KBS A;  1W6B A;  2H5F A;  1CVO A;  2X8B B;  4AEA A;  3FEV A;  4OM5 A;  2CDX A;  2MJY A;  2CTX A;  2LCR A;  1ERG A;  4HQP F;  1TXB A;  2GOO C;  2MJ4 A;  1NXB A;  1NYU A;  2MHY A;  1JE9 A;  2L03 A;  1RL5 A;  3NDS A;  2BTX A;  1JGK A;  1FSS B;  2H62 C;  5DU1 A;  1CDS A;  1CTX A;  2UWR A;  3NEQ A;  6EBX A;  2H64 C;  3U73 U;  1RGJ A;  2CCX A;  2MFA A;  2PJY C;  3KFD E;  1IDL A;  2H7Z B;  1CRE A;  1DRS A;  2QC1 A;  1QKD A;  1NTN A;  1HAA A;  1KXI A;  1YWH A;  1IJC A;  3QB4 B;  1LXH A;  1QM7 A;  1MAH F;  1REW C;  2MUO A;  1S4Y A;  1IKC A;  4FAO E;  2H64 B;  2VLW A;  1KBA A;  1NEA A;  1FRA A;  1UG4 A;  1IDG A;  1CXO A;  1I02 A;  1CRF A;  3EBX A;  1FAS A;  1HAJ A;  5IMY C;  1BTE A;  1JBD A;  2H7Z A;  4FAO C;  1H0J A;  4LFT A;  1NYS A;  1FFJ A;  2QJA C;  1NOR A;  1HC9 A;  3KFD I;  5DZ5 A;  1COD A;  4ZQY A;  4OM4 A;  5DO6 A;  1PLO A;  2CRT A;  1F8U B;  4RUD A;  4IYE A;  2ERA A;  1CDQ A;  2FD6 U;  2MJ0 A;  1HOY A;  1NTX A;  1KFH A;  1L4W A;  2PJY B;  1ES7 B;  2ABX A;  1CXN A;  3LAQ U;  3U74 U;  1IDI A;  3VTS A;  1COE A;  3EVS C;  1HC9 B;  3HH7 A;  3NH7 A;  1KU6 B;  2UX2 A;  4UY2 C;  2K3G A;  2L5S A;  4EY8 B;  2J8B A;  2CRS A;  1LXG A;  3BT2 U;  1TGX A;  3PLC A;  1V6P A;  1TXA A;  1KBT A;  2H8U A;  1B41 B;  1KC4 A;  2QJ9 C;  1M9Z A;  1QKE A;  1FF4 A;  1TFS A;  3BT1 U;  5EBX A;  1MR6 A;  1BXP A;  1IK8 A;  1KTZ B;  2HLQ A;  2LA1 A;  1FSC A;  4BDT B;  2MUP A;  1ERA A;  1KL8 A;  1CDT A;  1CB9 A;  1G6M A; 
#chains in the Genus database with same CATH topology
 1ZAD A;  4P7U A;  4XJJ A;  1ABT A;  1LJZ A;  3ERA A;  1F94 A;  2H62 D;  2NBT A;  4QTI U;  2OFS A;  1XT3 A;  1LSI A;  4DO8 A;  1IDH A;  1ONJ A;  1CCQ A;  1CHV S;  2QJB C;  1CDR A;  2GOO B;  1KS6 A;  2HLR A;  2N99 A;  2JQP A;  2JVE A;  4BIK B;  1LX5 B;  1IQ9 A;  1VB0 A;  2I9B E;  2BHI A;  5IMT D;  1KBS A;  1W6B A;  2H5F A;  1CVO A;  2X8B B;  4AEA A;  3FEV A;  4OM5 A;  2CDX A;  2MJY A;  2CTX A;  2LCR A;  1ERG A;  4HQP F;  1TXB A;  2GOO C;  2MJ4 A;  1NXB A;  1NYU A;  2MHY A;  1JE9 A;  2L03 A;  1RL5 A;  3NDS A;  2BTX A;  1JGK A;  1FSS B;  2H62 C;  5DU1 A;  1CDS A;  1CTX A;  2UWR A;  3NEQ A;  6EBX A;  2H64 C;  3U73 U;  1RGJ A;  2CCX A;  2MFA A;  2PJY C;  3KFD E;  1IDL A;  2H7Z B;  1CRE A;  1DRS A;  2QC1 A;  1QKD A;  1NTN A;  1HAA A;  1KXI A;  1YWH A;  1IJC A;  3QB4 B;  1LXH A;  1QM7 A;  1MAH F;  1REW C;  2MUO A;  1S4Y A;  1IKC A;  4FAO E;  2H64 B;  2VLW A;  1KBA A;  1NEA A;  1FRA A;  1UG4 A;  1IDG A;  1CXO A;  1I02 A;  1CRF A;  3EBX A;  1FAS A;  1HAJ A;  5IMY C;  1BTE A;  1JBD A;  2H7Z A;  4FAO C;  1H0J A;  4LFT A;  1NYS A;  1FFJ A;  2QJA C;  1NOR A;  1HC9 A;  3KFD I;  5DZ5 A;  1COD A;  4ZQY A;  4OM4 A;  5DO6 A;  1PLO A;  2CRT A;  1F8U B;  4RUD A;  4IYE A;  2ERA A;  1CDQ A;  2FD6 U;  2MJ0 A;  1HOY A;  1NTX A;  1KFH A;  1L4W A;  2PJY B;  1ES7 B;  4KSN A;  2ABX A;  1CXN A;  3LAQ U;  3U74 U;  1IDI A;  3VTS A;  1COE A;  3EVS C;  1HC9 B;  3HH7 A;  3NH7 A;  1KU6 B;  2UX2 A;  4UY2 C;  2K3G A;  2L5S A;  4EY8 B;  2J8B A;  2CRS A;  1LXG A;  3BT2 U;  1TGX A;  3PLC A;  1V6P A;  1TXA A;  1KBT A;  2H8U A;  1B41 B;  1KC4 A;  2QJ9 C;  1M9Z A;  1QKE A;  1FF4 A;  1TFS A;  3BT1 U;  5EBX A;  1MR6 A;  1BXP A;  1IK8 A;  1KTZ B;  2HLQ A;  2LA1 A;  1FSC A;  4BDT B;  2MUP A;  1ERA A;  1KL8 A;  1CDT A;  1CB9 A;  1G6M A; 
#chains in the Genus database with same CATH homology
 1ZAD A;  4P7U A;  4XJJ A;  1ABT A;  1LJZ A;  3ERA A;  1F94 A;  2H62 D;  2NBT A;  4QTI U;  2OFS A;  1XT3 A;  1LSI A;  4DO8 A;  1IDH A;  1ONJ A;  1CCQ A;  1CHV S;  2QJB C;  1CDR A;  2GOO B;  1KS6 A;  2HLR A;  2N99 A;  2JQP A;  2JVE A;  4BIK B;  1LX5 B;  1IQ9 A;  1VB0 A;  2I9B E;  2BHI A;  5IMT D;  1KBS A;  1W6B A;  2H5F A;  1CVO A;  2X8B B;  4AEA A;  3FEV A;  4OM5 A;  2CDX A;  2MJY A;  2CTX A;  2LCR A;  1ERG A;  4HQP F;  1TXB A;  2GOO C;  2MJ4 A;  1NXB A;  1NYU A;  2MHY A;  1JE9 A;  2L03 A;  1RL5 A;  3NDS A;  2BTX A;  1JGK A;  1FSS B;  2H62 C;  5DU1 A;  1CDS A;  1CTX A;  2UWR A;  3NEQ A;  6EBX A;  2H64 C;  3U73 U;  1RGJ A;  2CCX A;  2MFA A;  2PJY C;  3KFD E;  1IDL A;  2H7Z B;  1CRE A;  1DRS A;  2QC1 A;  1QKD A;  1NTN A;  1HAA A;  1KXI A;  1YWH A;  1IJC A;  3QB4 B;  1LXH A;  1QM7 A;  1MAH F;  1REW C;  2MUO A;  1S4Y A;  1IKC A;  4FAO E;  2H64 B;  2VLW A;  1KBA A;  1NEA A;  1FRA A;  1UG4 A;  1IDG A;  1CXO A;  1I02 A;  1CRF A;  3EBX A;  1FAS A;  1HAJ A;  5IMY C;  1BTE A;  1JBD A;  2H7Z A;  4FAO C;  1H0J A;  4LFT A;  1NYS A;  1FFJ A;  2QJA C;  1NOR A;  1HC9 A;  3KFD I;  5DZ5 A;  1COD A;  4ZQY A;  4OM4 A;  5DO6 A;  1PLO A;  2CRT A;  1F8U B;  4RUD A;  4IYE A;  2ERA A;  1CDQ A;  2FD6 U;  2MJ0 A;  1HOY A;  1NTX A;  1KFH A;  1L4W A;  2PJY B;  1ES7 B;  4KSN A;  2ABX A;  1CXN A;  3LAQ U;  3U74 U;  1IDI A;  3VTS A;  1COE A;  3EVS C;  1HC9 B;  3HH7 A;  3NH7 A;  1KU6 B;  2UX2 A;  4UY2 C;  2K3G A;  2L5S A;  4EY8 B;  2J8B A;  2CRS A;  1LXG A;  3BT2 U;  1TGX A;  3PLC A;  1V6P A;  1TXA A;  1KBT A;  2H8U A;  1B41 B;  1KC4 A;  2QJ9 C;  1M9Z A;  1QKE A;  1FF4 A;  1TFS A;  3BT1 U;  5EBX A;  1MR6 A;  1BXP A;  1IK8 A;  1KTZ B;  2HLQ A;  2LA1 A;  1FSC A;  4BDT B;  2MUP A;  1ERA A;  1KL8 A;  1CDT A;  1CB9 A;  1G6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...