1I5HW

Solution structure of the rnedd4 wwiii domain-renal bp2 peptide complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
50
structure length
50
Chain Sequence
b'GSPVDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQNVAITG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN LIGASE NEDD4
publication title Solution structure of a Nedd4 WW domain-ENaC peptide complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
total genus 3
structure length 50
sequence length 50
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1i5hW00
3TC5A 2YSIA 3KAHA 2M8JA 3KAIA 2XP7A 2JV4A 1WR7A 2YSFA 1EG3A 1WMVA 4U85A 2XP4A 3CNGA 2DK7A 2YSBA 2M8IA 4E5RA 2F21A 2ZR4A 3OOBA 3KABA 1EG4A 3KCEA 4REXA 1F8AB 2YSGA 2XP5A 2JMFA 1NMVA 2ZR6A 2XPBA 3KAGA 3M85A 2KXQA 2ZAJA 2RE3A 2XP3A 2LAJA 2XP6A 2ZQVA 5AHTA 4U86A 3KADA 4U84A 3NTPA 1JMQA 2DK1A 2EZ5W 1O6WA 3L4HA 2MDIA 2ITKA 1PINA 5CQ2A 1ZCNA 1I5HW 2ZQUA 2JX8A 3KAFA 3M7NA 2XP9A 2YSHA 2DMVA 2ZQSA 2E45A 2JXWA 3TCZA 2ZR5A 2ZQTA 2DJYA 3ODKA 2DWVA 4QIBA 2L4JA 1K9QA 2M3OW 2XP8A 3WH0A 2BA1A 2Q5AA 1K9RA 1TK7A 1YW5A 3LE4A 3TDBA 2XPAA
chains in the Genus database with same CATH superfamily
3TC5A 2YSIA 3KAHA 2M8JA 3KAIA 2XP7A 2JV4A 1WR7A 2YSFA 1EG3A 2YAJB 5E64A 5U47A 1WMVA 4U85A 2XP4A 3CNGA 4A0TA 2DK7A 2YSBA 3FSCA 2WAEA 2M8IA 4E5RA 2F21A 2ZR4A 3FS8A 2OWOA 3OOBA 3KABA 1EG4A 3KCEA 4REXA 3MQGA 1F8AB 2YSGA 4A0UA 2XP5A 2JMFA 1NMVA 2ZR6A 2XPBA 3KAGA 3M85A 3PQHA 2KXQA 2ZAJA 2RE3A 2XP3A 2LAJA 2XP6A 1FLCA 2ZQVA 5AHTA 4GLXA 4U86A 3KADA 4U84A 3NTPA 2QRVA 3LKXB 1JMQA 2DK1A 2EZ5W 5E62A 1O6WA 5E65A 3L4HA 3MCBB 2MDIA 2ITKA 1PINA 5CQ2A 1ZCNA 3MQHA 1I5HW 2ZQUA 2JX8A 3KAFA 3M7NA 2XP9A 2YSHA 2DMVA 2ZQSA 2E45A 2JXWA 3TCZA 2ZR5A 2ZQTA 2DJYA 5E66A 3FSBA 3ODKA 2DWVA 4QIBA 2L4JA 3MCBA 1K9QA 2M3OW 2XP8A 2WADA 2BA1A 2Q5AA 3WH0A 1K9RA 1TK7A 1YW5A 1RP5A 3LE4A 5E5WA 1TR8A 3TDBA 2XPAA 2Y8NB 3LKXA
chains in the Genus database with same CATH topology
3TC5A 2YSIA 3KAHA 2M8JA 3KAIA 2XP7A 2JV4A 1WR7A 2YSFA 1EG3A 2YAJB 5E64A 5U47A 1WMVA 4U85A 2XP4A 3CNGA 4A0TA 2DK7A 2YSBA 3FSCA 2WAEA 2M8IA 4E5RA 2F21A 2ZR4A 3FS8A 2OWOA 3OOBA 3KABA 1EG4A 3KCEA 4REXA 3MQGA 1F8AB 2YSGA 4A0UA 2XP5A 2JMFA 1NMVA 2ZR6A 2XPBA 3KAGA 3M85A 3PQHA 2KXQA 2ZAJA 2RE3A 2XP3A 2LAJA 2XP6A 1FLCA 2ZQVA 5AHTA 4GLXA 4U86A 3KADA 4U84A 3NTPA 2QRVA 3LKXB 1JMQA 2DK1A 2EZ5W 5E62A 1O6WA 5E65A 3L4HA 3MCBB 2MDIA 2ITKA 1PINA 5CQ2A 1ZCNA 3MQHA 1I5HW 2ZQUA 2JX8A 3KAFA 3M7NA 2XP9A 2YSHA 2DMVA 2ZQSA 2E45A 2JXWA 3TCZA 2ZR5A 2ZQTA 2DJYA 5E66A 3FSBA 3ODKA 2DWVA 4QIBA 2L4JA 3MCBA 1K9QA 2M3OW 2XP8A 2WADA 2BA1A 2Q5AA 3WH0A 1K9RA 1TK7A 1YW5A 1RP5A 3LE4A 5E5WA 1TR8A 3TDBA 2XPAA 2Y8NB 3LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC5 A;  2YSI A;  3KAH A;  2M8J A;  3KAI A;  2XP7 A;  2JV4 A;  1WR7 A;  2YSF A;  1EG3 A;  1WMV A;  4U85 A;  2XP4 A;  3CNG A;  2DK7 A;  2YSB A;  2M8I A;  4E5R A;  2F21 A;  2ZR4 A;  3OOB A;  3KAB A;  1EG4 A;  3KCE A;  4REX A;  1F8A B;  2YSG A;  2XP5 A;  2JMF A;  1NMV A;  2ZR6 A;  2XPB A;  3KAG A;  3M85 A;  2KXQ A;  2ZAJ A;  2RE3 A;  2XP3 A;  2LAJ A;  2XP6 A;  2ZQV A;  5AHT A;  4U86 A;  3KAD A;  4U84 A;  3NTP A;  1JMQ A;  2DK1 A;  2EZ5 W;  1O6W A;  3L4H A;  2MDI A;  2ITK A;  1PIN A;  5CQ2 A;  1ZCN A;  1I5H W;  2ZQU A;  2JX8 A;  3KAF A;  3M7N A;  2XP9 A;  2YSH A;  2DMV A;  2ZQS A;  2E45 A;  2JXW A;  3TCZ A;  2ZR5 A;  2ZQT A;  2DJY A;  3ODK A;  2DWV A;  4QIB A;  2L4J A;  1K9Q A;  2M3O W;  2XP8 A;  3WH0 A;  2BA1 A;  2Q5A A;  1K9R A;  1TK7 A;  1YW5 A;  3LE4 A;  3TDB A;  2XPA A; 
#chains in the Genus database with same CATH topology
 3TC5 A;  2YSI A;  3KAH A;  2M8J A;  3KAI A;  2XP7 A;  2JV4 A;  1WR7 A;  2YSF A;  1EG3 A;  2YAJ B;  5E64 A;  5U47 A;  1WMV A;  4U85 A;  2XP4 A;  3CNG A;  4A0T A;  2DK7 A;  2YSB A;  3FSC A;  2WAE A;  2M8I A;  4E5R A;  2F21 A;  2ZR4 A;  3FS8 A;  2OWO A;  3OOB A;  3KAB A;  1EG4 A;  3KCE A;  4REX A;  3MQG A;  1F8A B;  2YSG A;  4A0U A;  2XP5 A;  2JMF A;  1NMV A;  2ZR6 A;  2XPB A;  3KAG A;  3M85 A;  3PQH A;  2KXQ A;  2ZAJ A;  2RE3 A;  2XP3 A;  2LAJ A;  2XP6 A;  1FLC A;  2ZQV A;  5AHT A;  4GLX A;  4U86 A;  3KAD A;  4U84 A;  3NTP A;  2QRV A;  3LKX B;  1JMQ A;  2DK1 A;  2EZ5 W;  5E62 A;  1O6W A;  5E65 A;  3L4H A;  3MCB B;  2MDI A;  2ITK A;  1PIN A;  5CQ2 A;  1ZCN A;  3MQH A;  1I5H W;  2ZQU A;  2JX8 A;  3KAF A;  3M7N A;  2XP9 A;  2YSH A;  2DMV A;  2ZQS A;  2E45 A;  2JXW A;  3TCZ A;  2ZR5 A;  2ZQT A;  2DJY A;  5E66 A;  3FSB A;  3ODK A;  2DWV A;  4QIB A;  2L4J A;  3MCB A;  1K9Q A;  2M3O W;  2XP8 A;  2WAD A;  2BA1 A;  2Q5A A;  3WH0 A;  1K9R A;  1TK7 A;  1YW5 A;  1RP5 A;  3LE4 A;  5E5W A;  1TR8 A;  3TDB A;  2XPA A;  2Y8N B;  3LKX A; 
#chains in the Genus database with same CATH homology
 3TC5 A;  2YSI A;  3KAH A;  2M8J A;  3KAI A;  2XP7 A;  2JV4 A;  1WR7 A;  2YSF A;  1EG3 A;  2YAJ B;  5E64 A;  5U47 A;  1WMV A;  4U85 A;  2XP4 A;  3CNG A;  4A0T A;  2DK7 A;  2YSB A;  3FSC A;  2WAE A;  2M8I A;  4E5R A;  2F21 A;  2ZR4 A;  3FS8 A;  2OWO A;  3OOB A;  3KAB A;  1EG4 A;  3KCE A;  4REX A;  3MQG A;  1F8A B;  2YSG A;  4A0U A;  2XP5 A;  2JMF A;  1NMV A;  2ZR6 A;  2XPB A;  3KAG A;  3M85 A;  3PQH A;  2KXQ A;  2ZAJ A;  2RE3 A;  2XP3 A;  2LAJ A;  2XP6 A;  1FLC A;  2ZQV A;  5AHT A;  4GLX A;  4U86 A;  3KAD A;  4U84 A;  3NTP A;  2QRV A;  3LKX B;  1JMQ A;  2DK1 A;  2EZ5 W;  5E62 A;  1O6W A;  5E65 A;  3L4H A;  3MCB B;  2MDI A;  2ITK A;  1PIN A;  5CQ2 A;  1ZCN A;  3MQH A;  1I5H W;  2ZQU A;  2JX8 A;  3KAF A;  3M7N A;  2XP9 A;  2YSH A;  2DMV A;  2ZQS A;  2E45 A;  2JXW A;  3TCZ A;  2ZR5 A;  2ZQT A;  2DJY A;  5E66 A;  3FSB A;  3ODK A;  2DWV A;  4QIB A;  2L4J A;  3MCB A;  1K9Q A;  2M3O W;  2XP8 A;  2WAD A;  2BA1 A;  2Q5A A;  3WH0 A;  1K9R A;  1TK7 A;  1YW5 A;  1RP5 A;  3LE4 A;  5E5W A;  1TR8 A;  3TDB A;  2XPA A;  2Y8N B;  3LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...