1I9OA

Carbonic anhydrase ii (f131v) complexed with 4-(aminosulfonyl)-n-[(2,3,4-trifluorophenyl)methyl]-benzamide
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fluoroaromatic-fluoroaromatic interactions between inhibitors bound in the crystal lattice of human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords CARBONIC ANHYDRASE II
total genus 73
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1i9oA00
4Q87A 3RGEA 5FL4A 3B4FA 1TTMA 3ML2A 4JS6A 5A25A 2NWZA 2NNVA 3M2NA 4ZAOA 4Q7PA 3MYQA 4FVOA 4KUWA 1J9WA 4L5WA 2NNOA 3KWAA 4MLXA 5E2KA 1H9NA 2POUA 3F4XA 4QJWA 3ZP9A 1G4OA 4QSIA 4QSJA 1CVBA 1CCSA 2H15A 3D0NA 2NXRA 3DC3A 1CAHA 4QIYA 3U45X 3V2MA 2WEJA 3V3GB 1I9OA 3S72B 4ZWZA 1LG5A 4UOVA 5DSPA 1YDBA 1G4JA 1UGAA 3S77B 4MTYA 3RZ7A 3P5LA 4KUVA 1CIMA 3RZ0B 4ETQC 1CVEA 4M2VA 5JQ0A 2NNGA 1YDCA 5E2MA 3DV7A 4LP6A 4YWPA 5A6HA 4QY3A 1TH9A 3BETA 3M14A 3V3HB 3TVOX 1I9NA 4Z1NA 3Q31A 5BNLA 4Q81A 4XE1A 2AW1A 1G45A 1OKMA 3FE4A 3MWOA 1CNJA 5EKMA 2WEOA 3NJ9A 4Q06A 1IF9A 3LXEA 2F14A 4XZ5A 3DVCA 5FNJA 4ZWIA 1Z93A 3F8EA 1I9MA 3M96A 3BL1A 5DVXA 3DD0A 2NWOA 1TBTX 3RYYA 4E5QA 5JESB 1KWQA 5CLUA 3M1JA 3F7BA 3T83A 1RZAA 4C3TA 3D92A 4ITPA 2HNCA 3HKQA 1AVNA 1IF6A 5E2NA 1CAZA 3RJ7A 5SZ7A 3M40A 2FOSA 3U47A 3M67A 1BZMA 1CNBA 2FMGA 3DVDA 1V9IC 4KP8A 5DSNA 2Q1QA 4FL7A 1CILA 1UGDA 2FOVA 5L3OA 4RFCA 1BCDA 1LZVA 1ZFKA 4Q7SA 3W6HA 5EKJA 3HFPA 2HFWA 5IPZA 2AX2A 1CAJA 4TWLA 1ZSBA 5SZ1A 1CVAA 3DCWA 4JSAA 3TVNX 1KOPA 2NN7A 3V3FA 5CJFA 1CA3A 1UGGA 3P4VA 1BNMA 4RH2A 1TEUX 5EHVA 5FLTA 4YXIA 3MNAA 3U3AX 3SAXA 1RZCA 4HF3A 1G1DA 4L5UA 5SZ3A 2FMZA 4XIXA 2EU2A 3N3JA 1CCTA 4WL4A 1G46A 1MOOA 1CA2A 1RJ6A 1UGEA 5FDIA 3MHCA 1LUGA 4K0TA 4KV0A 2HOCA 4ILXA 3V3JA 4N0XB 5E5RA 3B1BA 4YXUA 1BNQA 1HEDA 2X7UA 3IBNA 3TMJA 1V9EA 3EFIA 5JDVB 4PYXA 4YGFA 3RYJB 1OKLA 1F2WA 2VVBX 3UYNA 2X7SA 1RZBA 1CNHA 3RZ8A 5EH7A 4ZWYA 5FNIA 4E9OX 4YYTA 4MDGA 1HUHA 3MHLA 4IWZA 1CAMA 4Q09A 3DAZA 3S76A 3CA2A 3M5SA 4PZHA 3SBIA 1TG3A 2Q1BA 2HD6A 4WW8A 3OYQA 1RZEA 2POWA 1CNXA 4QSAA 4CNRA 4RFDA 1I8ZA 3GZ0A 5EHWA 4MO8A 5FNGA 4ZX0A 5CACA 4X5SA 3HKTA 4Z1JA 3M98A 4KNNA 1FSRA 3JXFA 1RAYA 4BF1A 5FLOA 4QK2A 5G03A 3PJJA 4M2RA 1KEQA 4LHIA 1FQLA 1RAZA 3IAIA 1XEVA 2CBDA 5L6KA 4K13A 4E4AA 2FW4A 1I9LA 2OSFA 4FIKA 3S75B 5JGTB 1ZSCA 5FLQA 3VBDA 1UGCA 4QJMA 3KOIA 2FOUA 4HEYA 3V7XA 3M04A 4E3GA 1EOUA 5AMGA 3N0NA 3OKVA 2VVAX 3RZ5A 3T84A 3OILA 3KNEA 1I91A 4KNJA 4Q6DA 5SZ0A 3IBUA 4CNWA 1CALA 1BNUA 2WD2A 3OIKA 4QTLA 3MDZA 4WUPA 5FNKA 1BNWA 1FLJA 2ABEA 1IF8A 1G0FA 3MHMA 4KUYA 2CABA 3FFPX 4MLTA 3IGPA 5BRVA 4E3DA 5DSIA 3DCSA 3QYKA 4Q8ZA 2NMXA 4Y0JA 1A42A 2HL4A 2O4ZA 3MZCA 2H4NA 3N2PA 1UGBA 4Q8XA 4Q49A 3S8XA 3R16A 5DSMA 4ITOA 1CVCA 4QJXA 2FOYA 5FL6A 4L5VA 5DSLA 1ZGFA 2CBAA 1Z97A 3KIGA 4Q07A 5JEPB 1G48A 1CZMA 2NWYA 3M1KA 5BRWA 4QK3A 2CBEA 1AM6A 4HT0A 4HEZA 1G0EA 3ZNCA 1CCUA 5EH5A 3M3XA 3OYSA 2WEHA 1TG9A 4KNIA 3RYZA 8CA2A 3MNUA 4GL1X 3JXHC 4CNVA 4Q9YA 3P3JA 1UGFA 3SAPA 3T85A 5JG3B 3RYXB 2IT4A 1HCBA 3N4BA 1BN3A 4HBAA 2Q38A 5DSJA 4Q6EA 2GEHA 5JGSB 1G53A 4Q90A 4E49A 12CAA 1XQ0A 3MNIA 4R5BA 5DSQA 2NN1A 4G7AA 3T5ZA 1DCAA 1XPZA 1TB0X 4Z0QA 5BRUA 3P58A 4Q99A 1JCZA 1LGDA 4QIZA 5EZTX 5J8ZA 1G54A 5EKHA 3M1WA 4Z1KA 4RIUA 1OQ5A 1CANA 1IF5A 4Q08A 1G3ZA 1DMYA 2WD3A 3PYKA 1ZE8A 1CINA 3DC9A 2NNSA 3OY0A 1FQMA 5JEHB 4Q78A 3S73B 1G6VA 3JXGA 4DZ9A 3P55A 4JSZA 3RG3A 5DRSA 4YX4A 3DBUA 4WR7A 5AMLA 5DSOA 1ZFQA 3V2JA 4XIWA 2QOAA 3MNHA 4COQA 4QEFA 5HPJA 1HUGA 1KWRA 4Q83A 3MHIA 5G01A 9CA2A 3HLJA 2CBCA 1CAYA 3S78B 5LMDA 1FSNA 3P3HA 1CAKA 4HEWA 3MMFA 2NXSA 4CACA 3RG4A 5EIJA 2EZ7A 1YDAA 2NXTA 1HEAA 4FPTA 3M2XA 1FSQA 4MDMA 5G0BA 4K0SA 5FNLA 5BYIA 3DD8A 2FOQA 1RZDA 3W6IA 5JG5B 3DA2A 2GD8A 1CNCA 4JSSA 4FVNA 1CVFA 1LG6A 2X7TA 2OSMA 4YGLA 3S97A 3DCCA 3EFTA 3V5GA 3CZVA 4YGNA 4K0ZA 1CNIA 4DZ7A 3M2YA 3M2ZA 3RYVB 5C8IA 1HCAA 4XFWA 1KOQA 3S74B 5JQTA 3OIMA 4M2UA 4QJPA 4MDLA 1BV3A 3HS4A 4JSWA 4YVYA 3V3IB 1HVAA 1FQRA 5DSKA 1CNYA 1CAIA 3CYUA 2ZNCA 4LU3A 4R59A 1T9NA 1BN1A 3ML5A 3MHOA 4BF6A 3L14A 4Q0LA 2FNMA 4G0CA 2QO8A 5DOHA 4BCWA 4E3FA 1CNGA 3D8WA 4HT2A 4RUYA 5E2RA 1CNKA 1DCBA 3BL0A 1URTA 3K7KA 1CVHA 1CVDA 4ZX1A 4RUXA 4HU1A 4FRCA 4M2WA 1HECA 5CA2A 3M5EA 3S71B 1XEGA 4Q7WA 4RUZA 3P44A 1YO0A 2HKKA 1JV0A 3KLDB 5E5UA 5FLRA 3R17B 5EH8A 1BNNA 2WEGA 1RJ5A 4E3HA 1TEQX 5SZ2A 1CNWA 4RIVA 2NWPA 4WUQA 3HKNA 4CNXA 1I9PA 5FNMA 1ZSAA 3D93A 1FR7A 2FNNA 3M1QA 3KKXA 4YHAA 2CA2A 3IBIA 1I9QA 5G0CA 4QSBA 3MNKA 3K2FA 1AZMA 1ZNCA 4QK1A 5E28A 1BNVA 4YGJA 4ZWXA 3D9ZA 6CA2A 5SZ4A 4YXOA 1CAOA 3PO6A 3CAJA 1CRMA 1I90A 1IF7A 5JEGB 3T5UA 1IF4A 1YO2A 1Z9YA 4R5AA 1HEBA 3RZ1B 3K34A 4Q7VA 5FDCA 1BN4A 4KP5A 3KOKA 2W2JA 1FR4A 3SBHA 2FNKA 4QJ0A 1TE3X 3FW3A 3MNJA 4QJOA 1YO1A 5EHEA 5SZ6A 2EU3A 5DSRA 3F7UA 4RN4A 3P5AA 4WW6A 4N16A 2CBBA 4PYYA 2QP6A 1THKA 3NI5A 3UYQA 5SZ5A 1H9QA 1OKNA 5DOGA 3KS3A 4Q8YA 1JD0A 4IDRX 4FU5A 5FLSA 3U7CA 4KAPA 3DVBA 4PQ7A 7CA2A 4K1QA 2POVA 2ILIA 1YDDA 3S9TA 3M5TA 3NB5A 4KNMA 1G52A 4PXXA 4TWMA 1MUAA 5E2SA 4CQ0A 1BNTA 3IEOA 5AMDA 1DMXA 1ZH9A 4YGKA 5FLPA 3RLDA 3C7PA 1FQNA 3KONA 3OKUA 1CRAA 1ZGEA 1Y7WA 3IBLA 5FL5A 5EOIA 3T82A 3HKUA 1H4NA 4CA2A 4Z1EA 1BICA 5FNHA
chains in the Genus database with same CATH superfamily
4Q87A 3RGEA 5FL4A 3B4FA 1TTMA 3ML2A 4JS6A 5A25A 2NWZA 2NNVA 3M2NA 4ZAOA 4Q7PA 3MYQA 4FVOA 4KUWA 1J9WA 4L5WA 2NNOA 3KWAA 4MLXA 5E2KA 1H9NA 2POUA 3F4XA 4QJWA 3ZP9A 1G4OA 4QSIA 4QSJA 1CVBA 1CCSA 2H15A 3D0NA 2NXRA 3DC3A 1CAHA 4QIYA 3U45X 3V2MA 2WEJA 3V3GB 1I9OA 3S72B 4ZWZA 1LG5A 4UOVA 5DSPA 1YDBA 1G4JA 1UGAA 3S77B 4MTYA 3RZ7A 3P5LA 4KUVA 1CIMA 3RZ0B 4ETQC 1CVEA 4M2VA 5JQ0A 2NNGA 1YDCA 5E2MA 3DV7A 4LP6A 4YWPA 5A6HA 4QY3A 1TH9A 3BETA 3M14A 3V3HB 3TVOX 1I9NA 4Z1NA 3Q31A 5BNLA 4Q81A 4XE1A 2AW1A 1G45A 1OKMA 3FE4A 3MWOA 1CNJA 5EKMA 2WEOA 3NJ9A 4Q06A 1IF9A 3LXEA 2F14A 4XZ5A 3DVCA 5FNJA 4ZWIA 1Z93A 3F8EA 1I9MA 3M96A 3BL1A 5DVXA 3DD0A 2NWOA 1TBTX 3RYYA 4E5QA 5JESB 1KWQA 5CLUA 3M1JA 3F7BA 3T83A 1RZAA 4C3TA 3D92A 4ITPA 2HNCA 3HKQA 1AVNA 1IF6A 5E2NA 1CAZA 3RJ7A 5SZ7A 3M40A 2FOSA 3U47A 3M67A 1BZMA 1CNBA 2FMGA 3DVDA 1V9IC 4KP8A 5DSNA 2Q1QA 4FL7A 1CILA 1UGDA 2FOVA 5L3OA 4RFCA 1BCDA 1LZVA 1ZFKA 4Q7SA 3W6HA 5EKJA 3HFPA 2HFWA 5IPZA 2AX2A 1CAJA 4TWLA 1ZSBA 5SZ1A 1CVAA 3DCWA 4JSAA 3TVNX 1KOPA 2NN7A 3V3FA 5CJFA 1CA3A 1UGGA 3P4VA 1BNMA 4RH2A 1TEUX 5EHVA 5FLTA 4YXIA 3MNAA 3U3AX 3SAXA 1RZCA 4HF3A 1G1DA 4L5UA 5SZ3A 2FMZA 4XIXA 2EU2A 3N3JA 1CCTA 4WL4A 1G46A 1MOOA 1CA2A 1RJ6A 1UGEA 5FDIA 3MHCA 1LUGA 4K0TA 4KV0A 2HOCA 4ILXA 3V3JA 4N0XB 5E5RA 3B1BA 4YXUA 1BNQA 1HEDA 2X7UA 3IBNA 3TMJA 1V9EA 3EFIA 5JDVB 4PYXA 4YGFA 3RYJB 1OKLA 1F2WA 2VVBX 3UYNA 2X7SA 1RZBA 1CNHA 3RZ8A 5EH7A 4ZWYA 5FNIA 4E9OX 4YYTA 4MDGA 1HUHA 3MHLA 4IWZA 1CAMA 4Q09A 3DAZA 3S76A 3CA2A 3M5SA 4PZHA 3SBIA 1TG3A 2Q1BA 2HD6A 4WW8A 3OYQA 1RZEA 2POWA 1CNXA 4QSAA 4CNRA 4RFDA 1I8ZA 3GZ0A 5EHWA 4MO8A 5FNGA 4ZX0A 5CACA 4X5SA 3HKTA 4Z1JA 3M98A 4KNNA 1FSRA 3JXFA 1RAYA 4BF1A 5FLOA 4QK2A 5G03A 3PJJA 4M2RA 1KEQA 4LHIA 1FQLA 1RAZA 3IAIA 1XEVA 2CBDA 5L6KA 4K13A 4E4AA 2FW4A 1I9LA 2OSFA 4FIKA 3S75B 5JGTB 1ZSCA 5FLQA 3VBDA 1UGCA 4QJMA 3KOIA 2FOUA 4HEYA 3V7XA 3M04A 4E3GA 1EOUA 5AMGA 3N0NA 3OKVA 2VVAX 3RZ5A 3T84A 3OILA 3KNEA 1I91A 4KNJA 4Q6DA 5SZ0A 3IBUA 4CNWA 1CALA 1BNUA 2WD2A 3OIKA 4QTLA 3MDZA 4WUPA 5FNKA 1BNWA 1FLJA 2ABEA 1IF8A 1G0FA 3MHMA 4KUYA 2CABA 3FFPX 4MLTA 3IGPA 5BRVA 4E3DA 5DSIA 3DCSA 3QYKA 4Q8ZA 2NMXA 4Y0JA 1A42A 2HL4A 2O4ZA 3MZCA 2H4NA 3N2PA 1UGBA 4Q8XA 4Q49A 3S8XA 3R16A 5DSMA 4ITOA 1CVCA 4QJXA 2FOYA 5FL6A 4L5VA 5DSLA 1ZGFA 2CBAA 1Z97A 3KIGA 4Q07A 5JEPB 1G48A 1CZMA 2NWYA 3M1KA 5BRWA 4QK3A 2CBEA 1AM6A 4HT0A 4HEZA 1G0EA 3ZNCA 1CCUA 5EH5A 3M3XA 3OYSA 2WEHA 1TG9A 4KNIA 3RYZA 8CA2A 3MNUA 4GL1X 3JXHC 4CNVA 4Q9YA 3P3JA 1UGFA 3SAPA 3T85A 5JG3B 3RYXB 2IT4A 1HCBA 3N4BA 1BN3A 4HBAA 2Q38A 5DSJA 4Q6EA 2GEHA 5JGSB 1G53A 4Q90A 4E49A 12CAA 1XQ0A 3MNIA 4R5BA 5DSQA 2NN1A 4G7AA 3T5ZA 1DCAA 1XPZA 1TB0X 4Z0QA 5BRUA 3P58A 4Q99A 1JCZA 1LGDA 4QIZA 5EZTX 5J8ZA 1G54A 5EKHA 3M1WA 4Z1KA 4RIUA 1OQ5A 1CANA 1IF5A 4Q08A 1G3ZA 1DMYA 2WD3A 3PYKA 1ZE8A 1CINA 3DC9A 2NNSA 3OY0A 1FQMA 5JEHB 4Q78A 3S73B 1G6VA 3JXGA 4DZ9A 3P55A 4JSZA 3RG3A 5DRSA 4YX4A 3DBUA 4WR7A 5AMLA 5DSOA 1ZFQA 3V2JA 4XIWA 2QOAA 3MNHA 4COQA 4QEFA 5HPJA 1HUGA 1KWRA 4Q83A 3MHIA 5G01A 9CA2A 3HLJA 2CBCA 1CAYA 3S78B 5LMDA 1FSNA 3P3HA 1CAKA 4HEWA 3MMFA 2NXSA 4CACA 3RG4A 5EIJA 2EZ7A 1YDAA 2NXTA 1HEAA 4FPTA 3M2XA 1FSQA 4MDMA 5G0BA 4K0SA 5FNLA 5BYIA 3DD8A 2FOQA 1RZDA 3W6IA 5JG5B 3DA2A 2GD8A 1CNCA 4JSSA 4FVNA 1CVFA 1LG6A 2X7TA 2OSMA 4YGLA 3S97A 3DCCA 3EFTA 3V5GA 3CZVA 4YGNA 4K0ZA 1CNIA 4DZ7A 3M2YA 3M2ZA 3RYVB 5C8IA 1HCAA 4XFWA 1KOQA 3S74B 5JQTA 3OIMA 4M2UA 4QJPA 4MDLA 1BV3A 3HS4A 4JSWA 4YVYA 3V3IB 1HVAA 1FQRA 5DSKA 1CNYA 1CAIA 3CYUA 2ZNCA 4LU3A 4R59A 1T9NA 1BN1A 3ML5A 3MHOA 4BF6A 3L14A 4Q0LA 2FNMA 4G0CA 2QO8A 5DOHA 4BCWA 4E3FA 1CNGA 3D8WA 4HT2A 4RUYA 5E2RA 1CNKA 1DCBA 3BL0A 1URTA 3K7KA 1CVHA 1CVDA 4ZX1A 4RUXA 4HU1A 4FRCA 4M2WA 1HECA 5CA2A 3M5EA 3S71B 1XEGA 4Q7WA 4RUZA 3P44A 1YO0A 2HKKA 1JV0A 3KLDB 5E5UA 5FLRA 3R17B 5EH8A 1BNNA 2WEGA 1RJ5A 4E3HA 1TEQX 5SZ2A 1CNWA 4RIVA 2NWPA 4WUQA 3HKNA 4CNXA 1I9PA 5FNMA 1ZSAA 3D93A 1FR7A 2FNNA 3M1QA 3KKXA 4YHAA 2CA2A 3IBIA 1I9QA 5G0CA 4QSBA 3MNKA 3K2FA 1AZMA 1ZNCA 4QK1A 5E28A 1BNVA 4YGJA 4ZWXA 3D9ZA 6CA2A 5SZ4A 4YXOA 1CAOA 3PO6A 3CAJA 1CRMA 1I90A 1IF7A 5JEGB 3T5UA 1IF4A 1YO2A 1Z9YA 4R5AA 1HEBA 3RZ1B 3K34A 4Q7VA 5FDCA 1BN4A 4KP5A 3KOKA 2W2JA 1FR4A 3SBHA 2FNKA 4QJ0A 1TE3X 3FW3A 3MNJA 4QJOA 1YO1A 5EHEA 5SZ6A 2EU3A 5DSRA 3F7UA 4RN4A 3P5AA 4WW6A 4N16A 2CBBA 4PYYA 2QP6A 1THKA 3NI5A 3UYQA 5SZ5A 1H9QA 1OKNA 5DOGA 3KS3A 4Q8YA 1JD0A 4IDRX 4FU5A 5FLSA 3U7CA 4KAPA 3DVBA 4PQ7A 7CA2A 4K1QA 2POVA 2ILIA 1YDDA 3S9TA 3M5TA 3NB5A 4KNMA 1G52A 4PXXA 4TWMA 1MUAA 5E2SA 4CQ0A 1BNTA 3IEOA 5AMDA 1DMXA 1ZH9A 4YGKA 5FLPA 3RLDA 3C7PA 1FQNA 3KONA 3OKUA 1CRAA 1ZGEA 1Y7WA 3IBLA 5FL5A 5EOIA 3T82A 3HKUA 1H4NA 4CA2A 4Z1EA 1BICA 5FNHA
chains in the Genus database with same CATH topology
4Q87A 3RGEA 5FL4A 3B4FA 1TTMA 3ML2A 4JS6A 5A25A 2NWZA 2NNVA 3M2NA 4ZAOA 4Q7PA 3MYQA 4FVOA 4KUWA 1J9WA 4L5WA 2NNOA 3KWAA 4MLXA 5E2KA 1H9NA 2POUA 3F4XA 4QJWA 3ZP9A 1G4OA 4QSIA 4QSJA 1CVBA 1CCSA 2H15A 3D0NA 2NXRA 3DC3A 1CAHA 4QIYA 3U45X 3V2MA 2WEJA 3V3GB 1I9OA 3S72B 4ZWZA 1LG5A 4UOVA 5DSPA 1YDBA 1G4JA 1UGAA 3S77B 4MTYA 3RZ7A 3P5LA 4KUVA 1CIMA 3RZ0B 4ETQC 1CVEA 4M2VA 5JQ0A 2NNGA 1YDCA 5E2MA 3DV7A 4LP6A 4YWPA 5A6HA 4QY3A 1TH9A 3BETA 3M14A 3V3HB 3TVOX 1I9NA 4Z1NA 3Q31A 5BNLA 4Q81A 4XE1A 2AW1A 1G45A 1OKMA 3FE4A 3MWOA 1CNJA 5EKMA 2WEOA 3NJ9A 4Q06A 1IF9A 3LXEA 2F14A 4XZ5A 3DVCA 5FNJA 4ZWIA 1Z93A 3F8EA 1I9MA 3M96A 3BL1A 5DVXA 3DD0A 2NWOA 1TBTX 3RYYA 4E5QA 5JESB 1KWQA 5CLUA 3M1JA 3F7BA 3T83A 1RZAA 4C3TA 3D92A 4ITPA 2HNCA 3HKQA 1AVNA 1IF6A 5E2NA 1CAZA 3RJ7A 5SZ7A 3M40A 2FOSA 3U47A 3M67A 1BZMA 1CNBA 2FMGA 3DVDA 1V9IC 4KP8A 5DSNA 2Q1QA 4FL7A 1CILA 1UGDA 2FOVA 5L3OA 4RFCA 1BCDA 1LZVA 1ZFKA 4Q7SA 3W6HA 5EKJA 3HFPA 2HFWA 5IPZA 2AX2A 1CAJA 4TWLA 1ZSBA 5SZ1A 1CVAA 3DCWA 4JSAA 3TVNX 1KOPA 2NN7A 3V3FA 5CJFA 1CA3A 1UGGA 3P4VA 1BNMA 4RH2A 1TEUX 5EHVA 5FLTA 4YXIA 3MNAA 3U3AX 3SAXA 1RZCA 4HF3A 1G1DA 4L5UA 5SZ3A 2FMZA 4XIXA 2EU2A 3N3JA 1CCTA 4WL4A 1G46A 1MOOA 1CA2A 1RJ6A 1UGEA 5FDIA 3MHCA 1LUGA 4K0TA 4KV0A 2HOCA 4ILXA 3V3JA 4N0XB 5E5RA 3B1BA 4YXUA 1BNQA 1HEDA 2X7UA 3IBNA 3TMJA 1V9EA 3EFIA 5JDVB 4PYXA 4YGFA 3RYJB 1OKLA 1F2WA 2VVBX 3UYNA 2X7SA 1RZBA 1CNHA 3RZ8A 5EH7A 4ZWYA 5FNIA 4E9OX 4YYTA 4MDGA 1HUHA 3MHLA 4IWZA 1CAMA 4Q09A 3DAZA 3S76A 3CA2A 3M5SA 4PZHA 3SBIA 1TG3A 2Q1BA 2HD6A 4WW8A 3OYQA 1RZEA 2POWA 1CNXA 4QSAA 4CNRA 4RFDA 1I8ZA 3GZ0A 5EHWA 4MO8A 5FNGA 4ZX0A 5CACA 4X5SA 3HKTA 4Z1JA 3M98A 4KNNA 1FSRA 3JXFA 1RAYA 4BF1A 5FLOA 4QK2A 5G03A 3PJJA 4M2RA 1KEQA 4LHIA 1FQLA 1RAZA 3IAIA 1XEVA 2CBDA 5L6KA 4K13A 4E4AA 2FW4A 1I9LA 2OSFA 4FIKA 3S75B 5JGTB 1ZSCA 5FLQA 3VBDA 1UGCA 4QJMA 3KOIA 2FOUA 4HEYA 3V7XA 3M04A 4E3GA 1EOUA 5AMGA 3N0NA 3OKVA 2VVAX 3RZ5A 3T84A 3OILA 3KNEA 1I91A 4KNJA 4Q6DA 5SZ0A 3IBUA 4CNWA 1CALA 1BNUA 2WD2A 3OIKA 4QTLA 3MDZA 4WUPA 5FNKA 1BNWA 1FLJA 2ABEA 1IF8A 1G0FA 3MHMA 4KUYA 2CABA 3FFPX 4MLTA 3IGPA 5BRVA 4E3DA 5DSIA 3DCSA 3QYKA 4Q8ZA 2NMXA 4Y0JA 1A42A 2HL4A 2O4ZA 3MZCA 2H4NA 3N2PA 1UGBA 4Q8XA 4Q49A 3S8XA 3R16A 5DSMA 4ITOA 1CVCA 4QJXA 2FOYA 5FL6A 4L5VA 5DSLA 1ZGFA 2CBAA 1Z97A 3KIGA 4Q07A 5JEPB 1G48A 1CZMA 2NWYA 3M1KA 5BRWA 4QK3A 2CBEA 1AM6A 4HT0A 4HEZA 1G0EA 3ZNCA 1CCUA 5EH5A 3M3XA 3OYSA 2WEHA 1TG9A 4KNIA 3RYZA 8CA2A 3MNUA 4GL1X 3JXHC 4CNVA 4Q9YA 3P3JA 1UGFA 3SAPA 3T85A 5JG3B 3RYXB 2IT4A 1HCBA 3N4BA 1BN3A 4HBAA 2Q38A 5DSJA 4Q6EA 2GEHA 5JGSB 1G53A 4Q90A 4E49A 12CAA 1XQ0A 3MNIA 4R5BA 5DSQA 2NN1A 4G7AA 3T5ZA 1DCAA 1XPZA 1TB0X 4Z0QA 5BRUA 3P58A 4Q99A 1JCZA 1LGDA 4QIZA 5EZTX 5J8ZA 1G54A 5EKHA 3M1WA 4Z1KA 4RIUA 1OQ5A 1CANA 1IF5A 4Q08A 1G3ZA 1DMYA 2WD3A 3PYKA 1ZE8A 1CINA 3DC9A 2NNSA 3OY0A 1FQMA 5JEHB 4Q78A 3S73B 1G6VA 3JXGA 4DZ9A 3P55A 4JSZA 3RG3A 5DRSA 4YX4A 3DBUA 4WR7A 5AMLA 5DSOA 1ZFQA 3V2JA 4XIWA 2QOAA 3MNHA 4COQA 4QEFA 5HPJA 1HUGA 1KWRA 4Q83A 3MHIA 5G01A 9CA2A 3HLJA 2CBCA 1CAYA 3S78B 5LMDA 1FSNA 3P3HA 1CAKA 4HEWA 3MMFA 2NXSA 4CACA 3RG4A 5EIJA 2EZ7A 1YDAA 2NXTA 1HEAA 4FPTA 3M2XA 1FSQA 4MDMA 5G0BA 4K0SA 5FNLA 5BYIA 3DD8A 2FOQA 1RZDA 3W6IA 5JG5B 3DA2A 2GD8A 1CNCA 4JSSA 4FVNA 1CVFA 1LG6A 2X7TA 2OSMA 4YGLA 3S97A 3DCCA 3EFTA 3V5GA 3CZVA 4YGNA 4K0ZA 1CNIA 4DZ7A 3M2YA 3M2ZA 3RYVB 5C8IA 1HCAA 4XFWA 1KOQA 3S74B 5JQTA 3OIMA 4M2UA 4QJPA 4MDLA 1BV3A 3HS4A 4JSWA 4YVYA 3V3IB 1HVAA 1FQRA 5DSKA 1CNYA 1CAIA 3CYUA 2ZNCA 4LU3A 4R59A 1T9NA 1BN1A 3ML5A 3MHOA 4BF6A 3L14A 4Q0LA 2FNMA 4G0CA 2QO8A 5DOHA 4BCWA 4E3FA 1CNGA 3D8WA 4HT2A 4RUYA 5E2RA 1CNKA 1DCBA 3BL0A 1URTA 3K7KA 1CVHA 1CVDA 4ZX1A 4RUXA 4HU1A 4FRCA 4M2WA 1HECA 5CA2A 3M5EA 3S71B 1XEGA 4Q7WA 4RUZA 3P44A 1YO0A 2HKKA 1JV0A 3KLDB 5E5UA 5FLRA 3R17B 5EH8A 1BNNA 2WEGA 1RJ5A 4E3HA 1TEQX 5SZ2A 1CNWA 4RIVA 2NWPA 4WUQA 3HKNA 4CNXA 1I9PA 5FNMA 1ZSAA 3D93A 1FR7A 2FNNA 3M1QA 3KKXA 4YHAA 2CA2A 3IBIA 1I9QA 5G0CA 4QSBA 3MNKA 3K2FA 1AZMA 1ZNCA 4QK1A 5E28A 1BNVA 4YGJA 4ZWXA 3D9ZA 6CA2A 5SZ4A 4YXOA 1CAOA 3PO6A 3CAJA 1CRMA 1I90A 1IF7A 5JEGB 3T5UA 1IF4A 1YO2A 1Z9YA 4R5AA 1HEBA 3RZ1B 3K34A 4Q7VA 5FDCA 1BN4A 4KP5A 3KOKA 2W2JA 1FR4A 3SBHA 2FNKA 4QJ0A 1TE3X 3FW3A 3MNJA 4QJOA 1YO1A 5EHEA 5SZ6A 2EU3A 5DSRA 3F7UA 4RN4A 3P5AA 4WW6A 4N16A 2CBBA 4PYYA 2QP6A 1THKA 3NI5A 3UYQA 5SZ5A 1H9QA 1OKNA 5DOGA 3KS3A 4Q8YA 1JD0A 4IDRX 4FU5A 5FLSA 3U7CA 4KAPA 3DVBA 4PQ7A 7CA2A 4K1QA 2POVA 2ILIA 1YDDA 3S9TA 3M5TA 3NB5A 4KNMA 1G52A 4PXXA 4TWMA 1MUAA 5E2SA 4CQ0A 1BNTA 3IEOA 5AMDA 1DMXA 1ZH9A 4YGKA 5FLPA 3RLDA 3C7PA 1FQNA 3KONA 3OKUA 1CRAA 1ZGEA 1Y7WA 3IBLA 5FL5A 5EOIA 3T82A 3HKUA 1H4NA 4CA2A 4Z1EA 1BICA 5FNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q87 A;  3RGE A;  5FL4 A;  3B4F A;  1TTM A;  3ML2 A;  4JS6 A;  5A25 A;  2NWZ A;  2NNV A;  3M2N A;  4ZAO A;  4Q7P A;  3MYQ A;  4FVO A;  4KUW A;  1J9W A;  4L5W A;  2NNO A;  3KWA A;  4MLX A;  5E2K A;  1H9N A;  2POU A;  3F4X A;  4QJW A;  3ZP9 A;  1G4O A;  4QSI A;  4QSJ A;  1CVB A;  1CCS A;  2H15 A;  3D0N A;  2NXR A;  3DC3 A;  1CAH A;  4QIY A;  3U45 X;  3V2M A;  2WEJ A;  3V3G B;  1I9O A;  3S72 B;  4ZWZ A;  1LG5 A;  4UOV A;  5DSP A;  1YDB A;  1G4J A;  1UGA A;  3S77 B;  4MTY A;  3RZ7 A;  3P5L A;  4KUV A;  1CIM A;  3RZ0 B;  4ETQ C;  1CVE A;  4M2V A;  5JQ0 A;  2NNG A;  1YDC A;  5E2M A;  3DV7 A;  4LP6 A;  4YWP A;  5A6H A;  4QY3 A;  1TH9 A;  3BET A;  3M14 A;  3V3H B;  3TVO X;  1I9N A;  4Z1N A;  3Q31 A;  5BNL A;  4Q81 A;  4XE1 A;  2AW1 A;  1G45 A;  1OKM A;  3FE4 A;  3MWO A;  1CNJ A;  5EKM A;  2WEO A;  3NJ9 A;  4Q06 A;  1IF9 A;  3LXE A;  2F14 A;  4XZ5 A;  3DVC A;  5FNJ A;  4ZWI A;  1Z93 A;  3F8E A;  1I9M A;  3M96 A;  3BL1 A;  5DVX A;  3DD0 A;  2NWO A;  1TBT X;  3RYY A;  4E5Q A;  5JES B;  1KWQ A;  5CLU A;  3M1J A;  3F7B A;  3T83 A;  1RZA A;  4C3T A;  3D92 A;  4ITP A;  2HNC A;  3HKQ A;  1AVN A;  1IF6 A;  5E2N A;  1CAZ A;  3RJ7 A;  5SZ7 A;  3M40 A;  2FOS A;  3U47 A;  3M67 A;  1BZM A;  1CNB A;  2FMG A;  3DVD A;  1V9I C;  4KP8 A;  5DSN A;  2Q1Q A;  4FL7 A;  1CIL A;  1UGD A;  2FOV A;  5L3O A;  4RFC A;  1BCD A;  1LZV A;  1ZFK A;  4Q7S A;  3W6H A;  5EKJ A;  3HFP A;  2HFW A;  5IPZ A;  2AX2 A;  1CAJ A;  4TWL A;  1ZSB A;  5SZ1 A;  1CVA A;  3DCW A;  4JSA A;  3TVN X;  1KOP A;  2NN7 A;  3V3F A;  5CJF A;  1CA3 A;  1UGG A;  3P4V A;  1BNM A;  4RH2 A;  1TEU X;  5EHV A;  5FLT A;  4YXI A;  3MNA A;  3U3A X;  3SAX A;  1RZC A;  4HF3 A;  1G1D A;  4L5U A;  5SZ3 A;  2FMZ A;  4XIX A;  2EU2 A;  3N3J A;  1CCT A;  4WL4 A;  1G46 A;  1MOO A;  1CA2 A;  1RJ6 A;  1UGE A;  5FDI A;  3MHC A;  1LUG A;  4K0T A;  4KV0 A;  2HOC A;  4ILX A;  3V3J A;  4N0X B;  5E5R A;  3B1B A;  4YXU A;  1BNQ A;  1HED A;  2X7U A;  3IBN A;  3TMJ A;  1V9E A;  3EFI A;  5JDV B;  4PYX A;  4YGF A;  3RYJ B;  1OKL A;  1F2W A;  2VVB X;  3UYN A;  2X7S A;  1RZB A;  1CNH A;  3RZ8 A;  5EH7 A;  4ZWY A;  5FNI A;  4E9O X;  4YYT A;  4MDG A;  1HUH A;  3MHL A;  4IWZ A;  1CAM A;  4Q09 A;  3DAZ A;  3S76 A;  3CA2 A;  3M5S A;  4PZH A;  3SBI A;  1TG3 A;  2Q1B A;  2HD6 A;  4WW8 A;  3OYQ A;  1RZE A;  2POW A;  1CNX A;  4QSA A;  4CNR A;  4RFD A;  1I8Z A;  3GZ0 A;  5EHW A;  4MO8 A;  5FNG A;  4ZX0 A;  5CAC A;  4X5S A;  3HKT A;  4Z1J A;  3M98 A;  4KNN A;  1FSR A;  3JXF A;  1RAY A;  4BF1 A;  5FLO A;  4QK2 A;  5G03 A;  3PJJ A;  4M2R A;  1KEQ A;  4LHI A;  1FQL A;  1RAZ A;  3IAI A;  1XEV A;  2CBD A;  5L6K A;  4K13 A;  4E4A A;  2FW4 A;  1I9L A;  2OSF A;  4FIK A;  3S75 B;  5JGT B;  1ZSC A;  5FLQ A;  3VBD A;  1UGC A;  4QJM A;  3KOI A;  2FOU A;  4HEY A;  3V7X A;  3M04 A;  4E3G A;  1EOU A;  5AMG A;  3N0N A;  3OKV A;  2VVA X;  3RZ5 A;  3T84 A;  3OIL A;  3KNE A;  1I91 A;  4KNJ A;  4Q6D A;  5SZ0 A;  3IBU A;  4CNW A;  1CAL A;  1BNU A;  2WD2 A;  3OIK A;  4QTL A;  3MDZ A;  4WUP A;  5FNK A;  1BNW A;  1FLJ A;  2ABE A;  1IF8 A;  1G0F A;  3MHM A;  4KUY A;  2CAB A;  3FFP X;  4MLT A;  3IGP A;  5BRV A;  4E3D A;  5DSI A;  3DCS A;  3QYK A;  4Q8Z A;  2NMX A;  4Y0J A;  1A42 A;  2HL4 A;  2O4Z A;  3MZC A;  2H4N A;  3N2P A;  1UGB A;  4Q8X A;  4Q49 A;  3S8X A;  3R16 A;  5DSM A;  4ITO A;  1CVC A;  4QJX A;  2FOY A;  5FL6 A;  4L5V A;  5DSL A;  1ZGF A;  2CBA A;  1Z97 A;  3KIG A;  4Q07 A;  5JEP B;  1G48 A;  1CZM A;  2NWY A;  3M1K A;  5BRW A;  4QK3 A;  2CBE A;  1AM6 A;  4HT0 A;  4HEZ A;  1G0E A;  3ZNC A;  1CCU A;  5EH5 A;  3M3X A;  3OYS A;  2WEH A;  1TG9 A;  4KNI A;  3RYZ A;  8CA2 A;  3MNU A;  4GL1 X;  3JXH C;  4CNV A;  4Q9Y A;  3P3J A;  1UGF A;  3SAP A;  3T85 A;  5JG3 B;  3RYX B;  2IT4 A;  1HCB A;  3N4B A;  1BN3 A;  4HBA A;  2Q38 A;  5DSJ A;  4Q6E A;  2GEH A;  5JGS B;  1G53 A;  4Q90 A;  4E49 A;  12CA A;  1XQ0 A;  3MNI A;  4R5B A;  5DSQ A;  2NN1 A;  4G7A A;  3T5Z A;  1DCA A;  1XPZ A;  1TB0 X;  4Z0Q A;  5BRU A;  3P58 A;  4Q99 A;  1JCZ A;  1LGD A;  4QIZ A;  5EZT X;  5J8Z A;  1G54 A;  5EKH A;  3M1W A;  4Z1K A;  4RIU A;  1OQ5 A;  1CAN A;  1IF5 A;  4Q08 A;  1G3Z A;  1DMY A;  2WD3 A;  3PYK A;  1ZE8 A;  1CIN A;  3DC9 A;  2NNS A;  3OY0 A;  1FQM A;  5JEH B;  4Q78 A;  3S73 B;  1G6V A;  3JXG A;  4DZ9 A;  3P55 A;  4JSZ A;  3RG3 A;  5DRS A;  4YX4 A;  3DBU A;  4WR7 A;  5AML A;  5DSO A;  1ZFQ A;  3V2J A;  4XIW A;  2QOA A;  3MNH A;  4COQ A;  4QEF A;  5HPJ A;  1HUG A;  1KWR A;  4Q83 A;  3MHI A;  5G01 A;  9CA2 A;  3HLJ A;  2CBC A;  1CAY A;  3S78 B;  5LMD A;  1FSN A;  3P3H A;  1CAK A;  4HEW A;  3MMF A;  2NXS A;  4CAC A;  3RG4 A;  5EIJ A;  2EZ7 A;  1YDA A;  2NXT A;  1HEA A;  4FPT A;  3M2X A;  1FSQ A;  4MDM A;  5G0B A;  4K0S A;  5FNL A;  5BYI A;  3DD8 A;  2FOQ A;  1RZD A;  3W6I A;  5JG5 B;  3DA2 A;  2GD8 A;  1CNC A;  4JSS A;  4FVN A;  1CVF A;  1LG6 A;  2X7T A;  2OSM A;  4YGL A;  3S97 A;  3DCC A;  3EFT A;  3V5G A;  3CZV A;  4YGN A;  4K0Z A;  1CNI A;  4DZ7 A;  3M2Y A;  3M2Z A;  3RYV B;  5C8I A;  1HCA A;  4XFW A;  1KOQ A;  3S74 B;  5JQT A;  3OIM A;  4M2U A;  4QJP A;  4MDL A;  1BV3 A;  3HS4 A;  4JSW A;  4YVY A;  3V3I B;  1HVA A;  1FQR A;  5DSK A;  1CNY A;  1CAI A;  3CYU A;  2ZNC A;  4LU3 A;  4R59 A;  1T9N A;  1BN1 A;  3ML5 A;  3MHO A;  4BF6 A;  3L14 A;  4Q0L A;  2FNM A;  4G0C A;  2QO8 A;  5DOH A;  4BCW A;  4E3F A;  1CNG A;  3D8W A;  4HT2 A;  4RUY A;  5E2R A;  1CNK A;  1DCB A;  3BL0 A;  1URT A;  3K7K A;  1CVH A;  1CVD A;  4ZX1 A;  4RUX A;  4HU1 A;  4FRC A;  4M2W A;  1HEC A;  5CA2 A;  3M5E A;  3S71 B;  1XEG A;  4Q7W A;  4RUZ A;  3P44 A;  1YO0 A;  2HKK A;  1JV0 A;  3KLD B;  5E5U A;  5FLR A;  3R17 B;  5EH8 A;  1BNN A;  2WEG A;  1RJ5 A;  4E3H A;  1TEQ X;  5SZ2 A;  1CNW A;  4RIV A;  2NWP A;  4WUQ A;  3HKN A;  4CNX A;  1I9P A;  5FNM A;  1ZSA A;  3D93 A;  1FR7 A;  2FNN A;  3M1Q A;  3KKX A;  4YHA A;  2CA2 A;  3IBI A;  1I9Q A;  5G0C A;  4QSB A;  3MNK A;  3K2F A;  1AZM A;  1ZNC A;  4QK1 A;  5E28 A;  1BNV A;  4YGJ A;  4ZWX A;  3D9Z A;  6CA2 A;  5SZ4 A;  4YXO A;  1CAO A;  3PO6 A;  3CAJ A;  1CRM A;  1I90 A;  1IF7 A;  5JEG B;  3T5U A;  1IF4 A;  1YO2 A;  1Z9Y A;  4R5A A;  1HEB A;  3RZ1 B;  3K34 A;  4Q7V A;  5FDC A;  1BN4 A;  4KP5 A;  3KOK A;  2W2J A;  1FR4 A;  3SBH A;  2FNK A;  4QJ0 A;  1TE3 X;  3FW3 A;  3MNJ A;  4QJO A;  1YO1 A;  5EHE A;  5SZ6 A;  2EU3 A;  5DSR A;  3F7U A;  4RN4 A;  3P5A A;  4WW6 A;  4N16 A;  2CBB A;  4PYY A;  2QP6 A;  1THK A;  3NI5 A;  3UYQ A;  5SZ5 A;  1H9Q A;  1OKN A;  5DOG A;  3KS3 A;  4Q8Y A;  1JD0 A;  4IDR X;  4FU5 A;  5FLS A;  3U7C A;  4KAP A;  3DVB A;  4PQ7 A;  7CA2 A;  4K1Q A;  2POV A;  2ILI A;  1YDD A;  3S9T A;  3M5T A;  3NB5 A;  4KNM A;  1G52 A;  4PXX A;  4TWM A;  1MUA A;  5E2S A;  4CQ0 A;  1BNT A;  3IEO A;  5AMD A;  1DMX A;  1ZH9 A;  4YGK A;  5FLP A;  3RLD A;  3C7P A;  1FQN A;  3KON A;  3OKU A;  1CRA A;  1ZGE A;  1Y7W A;  3IBL A;  5FL5 A;  5EOI A;  3T82 A;  3HKU A;  1H4N A;  4CA2 A;  4Z1E A;  1BIC A;  5FNH A; 
#chains in the Genus database with same CATH topology
 4Q87 A;  3RGE A;  5FL4 A;  3B4F A;  1TTM A;  3ML2 A;  4JS6 A;  5A25 A;  2NWZ A;  2NNV A;  3M2N A;  4ZAO A;  4Q7P A;  3MYQ A;  4FVO A;  4KUW A;  1J9W A;  4L5W A;  2NNO A;  3KWA A;  4MLX A;  5E2K A;  1H9N A;  2POU A;  3F4X A;  4QJW A;  3ZP9 A;  1G4O A;  4QSI A;  4QSJ A;  1CVB A;  1CCS A;  2H15 A;  3D0N A;  2NXR A;  3DC3 A;  1CAH A;  4QIY A;  3U45 X;  3V2M A;  2WEJ A;  3V3G B;  1I9O A;  3S72 B;  4ZWZ A;  1LG5 A;  4UOV A;  5DSP A;  1YDB A;  1G4J A;  1UGA A;  3S77 B;  4MTY A;  3RZ7 A;  3P5L A;  4KUV A;  1CIM A;  3RZ0 B;  4ETQ C;  1CVE A;  4M2V A;  5JQ0 A;  2NNG A;  1YDC A;  5E2M A;  3DV7 A;  4LP6 A;  4YWP A;  5A6H A;  4QY3 A;  1TH9 A;  3BET A;  3M14 A;  3V3H B;  3TVO X;  1I9N A;  4Z1N A;  3Q31 A;  5BNL A;  4Q81 A;  4XE1 A;  2AW1 A;  1G45 A;  1OKM A;  3FE4 A;  3MWO A;  1CNJ A;  5EKM A;  2WEO A;  3NJ9 A;  4Q06 A;  1IF9 A;  3LXE A;  2F14 A;  4XZ5 A;  3DVC A;  5FNJ A;  4ZWI A;  1Z93 A;  3F8E A;  1I9M A;  3M96 A;  3BL1 A;  5DVX A;  3DD0 A;  2NWO A;  1TBT X;  3RYY A;  4E5Q A;  5JES B;  1KWQ A;  5CLU A;  3M1J A;  3F7B A;  3T83 A;  1RZA A;  4C3T A;  3D92 A;  4ITP A;  2HNC A;  3HKQ A;  1AVN A;  1IF6 A;  5E2N A;  1CAZ A;  3RJ7 A;  5SZ7 A;  3M40 A;  2FOS A;  3U47 A;  3M67 A;  1BZM A;  1CNB A;  2FMG A;  3DVD A;  1V9I C;  4KP8 A;  5DSN A;  2Q1Q A;  4FL7 A;  1CIL A;  1UGD A;  2FOV A;  5L3O A;  4RFC A;  1BCD A;  1LZV A;  1ZFK A;  4Q7S A;  3W6H A;  5EKJ A;  3HFP A;  2HFW A;  5IPZ A;  2AX2 A;  1CAJ A;  4TWL A;  1ZSB A;  5SZ1 A;  1CVA A;  3DCW A;  4JSA A;  3TVN X;  1KOP A;  2NN7 A;  3V3F A;  5CJF A;  1CA3 A;  1UGG A;  3P4V A;  1BNM A;  4RH2 A;  1TEU X;  5EHV A;  5FLT A;  4YXI A;  3MNA A;  3U3A X;  3SAX A;  1RZC A;  4HF3 A;  1G1D A;  4L5U A;  5SZ3 A;  2FMZ A;  4XIX A;  2EU2 A;  3N3J A;  1CCT A;  4WL4 A;  1G46 A;  1MOO A;  1CA2 A;  1RJ6 A;  1UGE A;  5FDI A;  3MHC A;  1LUG A;  4K0T A;  4KV0 A;  2HOC A;  4ILX A;  3V3J A;  4N0X B;  5E5R A;  3B1B A;  4YXU A;  1BNQ A;  1HED A;  2X7U A;  3IBN A;  3TMJ A;  1V9E A;  3EFI A;  5JDV B;  4PYX A;  4YGF A;  3RYJ B;  1OKL A;  1F2W A;  2VVB X;  3UYN A;  2X7S A;  1RZB A;  1CNH A;  3RZ8 A;  5EH7 A;  4ZWY A;  5FNI A;  4E9O X;  4YYT A;  4MDG A;  1HUH A;  3MHL A;  4IWZ A;  1CAM A;  4Q09 A;  3DAZ A;  3S76 A;  3CA2 A;  3M5S A;  4PZH A;  3SBI A;  1TG3 A;  2Q1B A;  2HD6 A;  4WW8 A;  3OYQ A;  1RZE A;  2POW A;  1CNX A;  4QSA A;  4CNR A;  4RFD A;  1I8Z A;  3GZ0 A;  5EHW A;  4MO8 A;  5FNG A;  4ZX0 A;  5CAC A;  4X5S A;  3HKT A;  4Z1J A;  3M98 A;  4KNN A;  1FSR A;  3JXF A;  1RAY A;  4BF1 A;  5FLO A;  4QK2 A;  5G03 A;  3PJJ A;  4M2R A;  1KEQ A;  4LHI A;  1FQL A;  1RAZ A;  3IAI A;  1XEV A;  2CBD A;  5L6K A;  4K13 A;  4E4A A;  2FW4 A;  1I9L A;  2OSF A;  4FIK A;  3S75 B;  5JGT B;  1ZSC A;  5FLQ A;  3VBD A;  1UGC A;  4QJM A;  3KOI A;  2FOU A;  4HEY A;  3V7X A;  3M04 A;  4E3G A;  1EOU A;  5AMG A;  3N0N A;  3OKV A;  2VVA X;  3RZ5 A;  3T84 A;  3OIL A;  3KNE A;  1I91 A;  4KNJ A;  4Q6D A;  5SZ0 A;  3IBU A;  4CNW A;  1CAL A;  1BNU A;  2WD2 A;  3OIK A;  4QTL A;  3MDZ A;  4WUP A;  5FNK A;  1BNW A;  1FLJ A;  2ABE A;  1IF8 A;  1G0F A;  3MHM A;  4KUY A;  2CAB A;  3FFP X;  4MLT A;  3IGP A;  5BRV A;  4E3D A;  5DSI A;  3DCS A;  3QYK A;  4Q8Z A;  2NMX A;  4Y0J A;  1A42 A;  2HL4 A;  2O4Z A;  3MZC A;  2H4N A;  3N2P A;  1UGB A;  4Q8X A;  4Q49 A;  3S8X A;  3R16 A;  5DSM A;  4ITO A;  1CVC A;  4QJX A;  2FOY A;  5FL6 A;  4L5V A;  5DSL A;  1ZGF A;  2CBA A;  1Z97 A;  3KIG A;  4Q07 A;  5JEP B;  1G48 A;  1CZM A;  2NWY A;  3M1K A;  5BRW A;  4QK3 A;  2CBE A;  1AM6 A;  4HT0 A;  4HEZ A;  1G0E A;  3ZNC A;  1CCU A;  5EH5 A;  3M3X A;  3OYS A;  2WEH A;  1TG9 A;  4KNI A;  3RYZ A;  8CA2 A;  3MNU A;  4GL1 X;  3JXH C;  4CNV A;  4Q9Y A;  3P3J A;  1UGF A;  3SAP A;  3T85 A;  5JG3 B;  3RYX B;  2IT4 A;  1HCB A;  3N4B A;  1BN3 A;  4HBA A;  2Q38 A;  5DSJ A;  4Q6E A;  2GEH A;  5JGS B;  1G53 A;  4Q90 A;  4E49 A;  12CA A;  1XQ0 A;  3MNI A;  4R5B A;  5DSQ A;  2NN1 A;  4G7A A;  3T5Z A;  1DCA A;  1XPZ A;  1TB0 X;  4Z0Q A;  5BRU A;  3P58 A;  4Q99 A;  1JCZ A;  1LGD A;  4QIZ A;  5EZT X;  5J8Z A;  1G54 A;  5EKH A;  3M1W A;  4Z1K A;  4RIU A;  1OQ5 A;  1CAN A;  1IF5 A;  4Q08 A;  1G3Z A;  1DMY A;  2WD3 A;  3PYK A;  1ZE8 A;  1CIN A;  3DC9 A;  2NNS A;  3OY0 A;  1FQM A;  5JEH B;  4Q78 A;  3S73 B;  1G6V A;  3JXG A;  4DZ9 A;  3P55 A;  4JSZ A;  3RG3 A;  5DRS A;  4YX4 A;  3DBU A;  4WR7 A;  5AML A;  5DSO A;  1ZFQ A;  3V2J A;  4XIW A;  2QOA A;  3MNH A;  4COQ A;  4QEF A;  5HPJ A;  1HUG A;  1KWR A;  4Q83 A;  3MHI A;  5G01 A;  9CA2 A;  3HLJ A;  2CBC A;  1CAY A;  3S78 B;  5LMD A;  1FSN A;  3P3H A;  1CAK A;  4HEW A;  3MMF A;  2NXS A;  4CAC A;  3RG4 A;  5EIJ A;  2EZ7 A;  1YDA A;  2NXT A;  1HEA A;  4FPT A;  3M2X A;  1FSQ A;  4MDM A;  5G0B A;  4K0S A;  5FNL A;  5BYI A;  3DD8 A;  2FOQ A;  1RZD A;  3W6I A;  5JG5 B;  3DA2 A;  2GD8 A;  1CNC A;  4JSS A;  4FVN A;  1CVF A;  1LG6 A;  2X7T A;  2OSM A;  4YGL A;  3S97 A;  3DCC A;  3EFT A;  3V5G A;  3CZV A;  4YGN A;  4K0Z A;  1CNI A;  4DZ7 A;  3M2Y A;  3M2Z A;  3RYV B;  5C8I A;  1HCA A;  4XFW A;  1KOQ A;  3S74 B;  5JQT A;  3OIM A;  4M2U A;  4QJP A;  4MDL A;  1BV3 A;  3HS4 A;  4JSW A;  4YVY A;  3V3I B;  1HVA A;  1FQR A;  5DSK A;  1CNY A;  1CAI A;  3CYU A;  2ZNC A;  4LU3 A;  4R59 A;  1T9N A;  1BN1 A;  3ML5 A;  3MHO A;  4BF6 A;  3L14 A;  4Q0L A;  2FNM A;  4G0C A;  2QO8 A;  5DOH A;  4BCW A;  4E3F A;  1CNG A;  3D8W A;  4HT2 A;  4RUY A;  5E2R A;  1CNK A;  1DCB A;  3BL0 A;  1URT A;  3K7K A;  1CVH A;  1CVD A;  4ZX1 A;  4RUX A;  4HU1 A;  4FRC A;  4M2W A;  1HEC A;  5CA2 A;  3M5E A;  3S71 B;  1XEG A;  4Q7W A;  4RUZ A;  3P44 A;  1YO0 A;  2HKK A;  1JV0 A;  3KLD B;  5E5U A;  5FLR A;  3R17 B;  5EH8 A;  1BNN A;  2WEG A;  1RJ5 A;  4E3H A;  1TEQ X;  5SZ2 A;  1CNW A;  4RIV A;  2NWP A;  4WUQ A;  3HKN A;  4CNX A;  1I9P A;  5FNM A;  1ZSA A;  3D93 A;  1FR7 A;  2FNN A;  3M1Q A;  3KKX A;  4YHA A;  2CA2 A;  3IBI A;  1I9Q A;  5G0C A;  4QSB A;  3MNK A;  3K2F A;  1AZM A;  1ZNC A;  4QK1 A;  5E28 A;  1BNV A;  4YGJ A;  4ZWX A;  3D9Z A;  6CA2 A;  5SZ4 A;  4YXO A;  1CAO A;  3PO6 A;  3CAJ A;  1CRM A;  1I90 A;  1IF7 A;  5JEG B;  3T5U A;  1IF4 A;  1YO2 A;  1Z9Y A;  4R5A A;  1HEB A;  3RZ1 B;  3K34 A;  4Q7V A;  5FDC A;  1BN4 A;  4KP5 A;  3KOK A;  2W2J A;  1FR4 A;  3SBH A;  2FNK A;  4QJ0 A;  1TE3 X;  3FW3 A;  3MNJ A;  4QJO A;  1YO1 A;  5EHE A;  5SZ6 A;  2EU3 A;  5DSR A;  3F7U A;  4RN4 A;  3P5A A;  4WW6 A;  4N16 A;  2CBB A;  4PYY A;  2QP6 A;  1THK A;  3NI5 A;  3UYQ A;  5SZ5 A;  1H9Q A;  1OKN A;  5DOG A;  3KS3 A;  4Q8Y A;  1JD0 A;  4IDR X;  4FU5 A;  5FLS A;  3U7C A;  4KAP A;  3DVB A;  4PQ7 A;  7CA2 A;  4K1Q A;  2POV A;  2ILI A;  1YDD A;  3S9T A;  3M5T A;  3NB5 A;  4KNM A;  1G52 A;  4PXX A;  4TWM A;  1MUA A;  5E2S A;  4CQ0 A;  1BNT A;  3IEO A;  5AMD A;  1DMX A;  1ZH9 A;  4YGK A;  5FLP A;  3RLD A;  3C7P A;  1FQN A;  3KON A;  3OKU A;  1CRA A;  1ZGE A;  1Y7W A;  3IBL A;  5FL5 A;  5EOI A;  3T82 A;  3HKU A;  1H4N A;  4CA2 A;  4Z1E A;  1BIC A;  5FNH A; 
#chains in the Genus database with same CATH homology
 4Q87 A;  3RGE A;  5FL4 A;  3B4F A;  1TTM A;  3ML2 A;  4JS6 A;  5A25 A;  2NWZ A;  2NNV A;  3M2N A;  4ZAO A;  4Q7P A;  3MYQ A;  4FVO A;  4KUW A;  1J9W A;  4L5W A;  2NNO A;  3KWA A;  4MLX A;  5E2K A;  1H9N A;  2POU A;  3F4X A;  4QJW A;  3ZP9 A;  1G4O A;  4QSI A;  4QSJ A;  1CVB A;  1CCS A;  2H15 A;  3D0N A;  2NXR A;  3DC3 A;  1CAH A;  4QIY A;  3U45 X;  3V2M A;  2WEJ A;  3V3G B;  1I9O A;  3S72 B;  4ZWZ A;  1LG5 A;  4UOV A;  5DSP A;  1YDB A;  1G4J A;  1UGA A;  3S77 B;  4MTY A;  3RZ7 A;  3P5L A;  4KUV A;  1CIM A;  3RZ0 B;  4ETQ C;  1CVE A;  4M2V A;  5JQ0 A;  2NNG A;  1YDC A;  5E2M A;  3DV7 A;  4LP6 A;  4YWP A;  5A6H A;  4QY3 A;  1TH9 A;  3BET A;  3M14 A;  3V3H B;  3TVO X;  1I9N A;  4Z1N A;  3Q31 A;  5BNL A;  4Q81 A;  4XE1 A;  2AW1 A;  1G45 A;  1OKM A;  3FE4 A;  3MWO A;  1CNJ A;  5EKM A;  2WEO A;  3NJ9 A;  4Q06 A;  1IF9 A;  3LXE A;  2F14 A;  4XZ5 A;  3DVC A;  5FNJ A;  4ZWI A;  1Z93 A;  3F8E A;  1I9M A;  3M96 A;  3BL1 A;  5DVX A;  3DD0 A;  2NWO A;  1TBT X;  3RYY A;  4E5Q A;  5JES B;  1KWQ A;  5CLU A;  3M1J A;  3F7B A;  3T83 A;  1RZA A;  4C3T A;  3D92 A;  4ITP A;  2HNC A;  3HKQ A;  1AVN A;  1IF6 A;  5E2N A;  1CAZ A;  3RJ7 A;  5SZ7 A;  3M40 A;  2FOS A;  3U47 A;  3M67 A;  1BZM A;  1CNB A;  2FMG A;  3DVD A;  1V9I C;  4KP8 A;  5DSN A;  2Q1Q A;  4FL7 A;  1CIL A;  1UGD A;  2FOV A;  5L3O A;  4RFC A;  1BCD A;  1LZV A;  1ZFK A;  4Q7S A;  3W6H A;  5EKJ A;  3HFP A;  2HFW A;  5IPZ A;  2AX2 A;  1CAJ A;  4TWL A;  1ZSB A;  5SZ1 A;  1CVA A;  3DCW A;  4JSA A;  3TVN X;  1KOP A;  2NN7 A;  3V3F A;  5CJF A;  1CA3 A;  1UGG A;  3P4V A;  1BNM A;  4RH2 A;  1TEU X;  5EHV A;  5FLT A;  4YXI A;  3MNA A;  3U3A X;  3SAX A;  1RZC A;  4HF3 A;  1G1D A;  4L5U A;  5SZ3 A;  2FMZ A;  4XIX A;  2EU2 A;  3N3J A;  1CCT A;  4WL4 A;  1G46 A;  1MOO A;  1CA2 A;  1RJ6 A;  1UGE A;  5FDI A;  3MHC A;  1LUG A;  4K0T A;  4KV0 A;  2HOC A;  4ILX A;  3V3J A;  4N0X B;  5E5R A;  3B1B A;  4YXU A;  1BNQ A;  1HED A;  2X7U A;  3IBN A;  3TMJ A;  1V9E A;  3EFI A;  5JDV B;  4PYX A;  4YGF A;  3RYJ B;  1OKL A;  1F2W A;  2VVB X;  3UYN A;  2X7S A;  1RZB A;  1CNH A;  3RZ8 A;  5EH7 A;  4ZWY A;  5FNI A;  4E9O X;  4YYT A;  4MDG A;  1HUH A;  3MHL A;  4IWZ A;  1CAM A;  4Q09 A;  3DAZ A;  3S76 A;  3CA2 A;  3M5S A;  4PZH A;  3SBI A;  1TG3 A;  2Q1B A;  2HD6 A;  4WW8 A;  3OYQ A;  1RZE A;  2POW A;  1CNX A;  4QSA A;  4CNR A;  4RFD A;  1I8Z A;  3GZ0 A;  5EHW A;  4MO8 A;  5FNG A;  4ZX0 A;  5CAC A;  4X5S A;  3HKT A;  4Z1J A;  3M98 A;  4KNN A;  1FSR A;  3JXF A;  1RAY A;  4BF1 A;  5FLO A;  4QK2 A;  5G03 A;  3PJJ A;  4M2R A;  1KEQ A;  4LHI A;  1FQL A;  1RAZ A;  3IAI A;  1XEV A;  2CBD A;  5L6K A;  4K13 A;  4E4A A;  2FW4 A;  1I9L A;  2OSF A;  4FIK A;  3S75 B;  5JGT B;  1ZSC A;  5FLQ A;  3VBD A;  1UGC A;  4QJM A;  3KOI A;  2FOU A;  4HEY A;  3V7X A;  3M04 A;  4E3G A;  1EOU A;  5AMG A;  3N0N A;  3OKV A;  2VVA X;  3RZ5 A;  3T84 A;  3OIL A;  3KNE A;  1I91 A;  4KNJ A;  4Q6D A;  5SZ0 A;  3IBU A;  4CNW A;  1CAL A;  1BNU A;  2WD2 A;  3OIK A;  4QTL A;  3MDZ A;  4WUP A;  5FNK A;  1BNW A;  1FLJ A;  2ABE A;  1IF8 A;  1G0F A;  3MHM A;  4KUY A;  2CAB A;  3FFP X;  4MLT A;  3IGP A;  5BRV A;  4E3D A;  5DSI A;  3DCS A;  3QYK A;  4Q8Z A;  2NMX A;  4Y0J A;  1A42 A;  2HL4 A;  2O4Z A;  3MZC A;  2H4N A;  3N2P A;  1UGB A;  4Q8X A;  4Q49 A;  3S8X A;  3R16 A;  5DSM A;  4ITO A;  1CVC A;  4QJX A;  2FOY A;  5FL6 A;  4L5V A;  5DSL A;  1ZGF A;  2CBA A;  1Z97 A;  3KIG A;  4Q07 A;  5JEP B;  1G48 A;  1CZM A;  2NWY A;  3M1K A;  5BRW A;  4QK3 A;  2CBE A;  1AM6 A;  4HT0 A;  4HEZ A;  1G0E A;  3ZNC A;  1CCU A;  5EH5 A;  3M3X A;  3OYS A;  2WEH A;  1TG9 A;  4KNI A;  3RYZ A;  8CA2 A;  3MNU A;  4GL1 X;  3JXH C;  4CNV A;  4Q9Y A;  3P3J A;  1UGF A;  3SAP A;  3T85 A;  5JG3 B;  3RYX B;  2IT4 A;  1HCB A;  3N4B A;  1BN3 A;  4HBA A;  2Q38 A;  5DSJ A;  4Q6E A;  2GEH A;  5JGS B;  1G53 A;  4Q90 A;  4E49 A;  12CA A;  1XQ0 A;  3MNI A;  4R5B A;  5DSQ A;  2NN1 A;  4G7A A;  3T5Z A;  1DCA A;  1XPZ A;  1TB0 X;  4Z0Q A;  5BRU A;  3P58 A;  4Q99 A;  1JCZ A;  1LGD A;  4QIZ A;  5EZT X;  5J8Z A;  1G54 A;  5EKH A;  3M1W A;  4Z1K A;  4RIU A;  1OQ5 A;  1CAN A;  1IF5 A;  4Q08 A;  1G3Z A;  1DMY A;  2WD3 A;  3PYK A;  1ZE8 A;  1CIN A;  3DC9 A;  2NNS A;  3OY0 A;  1FQM A;  5JEH B;  4Q78 A;  3S73 B;  1G6V A;  3JXG A;  4DZ9 A;  3P55 A;  4JSZ A;  3RG3 A;  5DRS A;  4YX4 A;  3DBU A;  4WR7 A;  5AML A;  5DSO A;  1ZFQ A;  3V2J A;  4XIW A;  2QOA A;  3MNH A;  4COQ A;  4QEF A;  5HPJ A;  1HUG A;  1KWR A;  4Q83 A;  3MHI A;  5G01 A;  9CA2 A;  3HLJ A;  2CBC A;  1CAY A;  3S78 B;  5LMD A;  1FSN A;  3P3H A;  1CAK A;  4HEW A;  3MMF A;  2NXS A;  4CAC A;  3RG4 A;  5EIJ A;  2EZ7 A;  1YDA A;  2NXT A;  1HEA A;  4FPT A;  3M2X A;  1FSQ A;  4MDM A;  5G0B A;  4K0S A;  5FNL A;  5BYI A;  3DD8 A;  2FOQ A;  1RZD A;  3W6I A;  5JG5 B;  3DA2 A;  2GD8 A;  1CNC A;  4JSS A;  4FVN A;  1CVF A;  1LG6 A;  2X7T A;  2OSM A;  4YGL A;  3S97 A;  3DCC A;  3EFT A;  3V5G A;  3CZV A;  4YGN A;  4K0Z A;  1CNI A;  4DZ7 A;  3M2Y A;  3M2Z A;  3RYV B;  5C8I A;  1HCA A;  4XFW A;  1KOQ A;  3S74 B;  5JQT A;  3OIM A;  4M2U A;  4QJP A;  4MDL A;  1BV3 A;  3HS4 A;  4JSW A;  4YVY A;  3V3I B;  1HVA A;  1FQR A;  5DSK A;  1CNY A;  1CAI A;  3CYU A;  2ZNC A;  4LU3 A;  4R59 A;  1T9N A;  1BN1 A;  3ML5 A;  3MHO A;  4BF6 A;  3L14 A;  4Q0L A;  2FNM A;  4G0C A;  2QO8 A;  5DOH A;  4BCW A;  4E3F A;  1CNG A;  3D8W A;  4HT2 A;  4RUY A;  5E2R A;  1CNK A;  1DCB A;  3BL0 A;  1URT A;  3K7K A;  1CVH A;  1CVD A;  4ZX1 A;  4RUX A;  4HU1 A;  4FRC A;  4M2W A;  1HEC A;  5CA2 A;  3M5E A;  3S71 B;  1XEG A;  4Q7W A;  4RUZ A;  3P44 A;  1YO0 A;  2HKK A;  1JV0 A;  3KLD B;  5E5U A;  5FLR A;  3R17 B;  5EH8 A;  1BNN A;  2WEG A;  1RJ5 A;  4E3H A;  1TEQ X;  5SZ2 A;  1CNW A;  4RIV A;  2NWP A;  4WUQ A;  3HKN A;  4CNX A;  1I9P A;  5FNM A;  1ZSA A;  3D93 A;  1FR7 A;  2FNN A;  3M1Q A;  3KKX A;  4YHA A;  2CA2 A;  3IBI A;  1I9Q A;  5G0C A;  4QSB A;  3MNK A;  3K2F A;  1AZM A;  1ZNC A;  4QK1 A;  5E28 A;  1BNV A;  4YGJ A;  4ZWX A;  3D9Z A;  6CA2 A;  5SZ4 A;  4YXO A;  1CAO A;  3PO6 A;  3CAJ A;  1CRM A;  1I90 A;  1IF7 A;  5JEG B;  3T5U A;  1IF4 A;  1YO2 A;  1Z9Y A;  4R5A A;  1HEB A;  3RZ1 B;  3K34 A;  4Q7V A;  5FDC A;  1BN4 A;  4KP5 A;  3KOK A;  2W2J A;  1FR4 A;  3SBH A;  2FNK A;  4QJ0 A;  1TE3 X;  3FW3 A;  3MNJ A;  4QJO A;  1YO1 A;  5EHE A;  5SZ6 A;  2EU3 A;  5DSR A;  3F7U A;  4RN4 A;  3P5A A;  4WW6 A;  4N16 A;  2CBB A;  4PYY A;  2QP6 A;  1THK A;  3NI5 A;  3UYQ A;  5SZ5 A;  1H9Q A;  1OKN A;  5DOG A;  3KS3 A;  4Q8Y A;  1JD0 A;  4IDR X;  4FU5 A;  5FLS A;  3U7C A;  4KAP A;  3DVB A;  4PQ7 A;  7CA2 A;  4K1Q A;  2POV A;  2ILI A;  1YDD A;  3S9T A;  3M5T A;  3NB5 A;  4KNM A;  1G52 A;  4PXX A;  4TWM A;  1MUA A;  5E2S A;  4CQ0 A;  1BNT A;  3IEO A;  5AMD A;  1DMX A;  1ZH9 A;  4YGK A;  5FLP A;  3RLD A;  3C7P A;  1FQN A;  3KON A;  3OKU A;  1CRA A;  1ZGE A;  1Y7W A;  3IBL A;  5FL5 A;  5EOI A;  3T82 A;  3HKU A;  1H4N A;  4CA2 A;  4Z1E A;  1BIC A;  5FNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...