1ID8A

Nmr structure of glutamate mutase (b12-binding subunit) complexed with the vitamin b12 nucleotide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDEAGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The B(12)-binding subunit of glutamate mutase from Clostridium tetanomorphum traps the nucleotide moiety of coenzyme B(12).
pubmed doi rcsb
molecule keywords METHYLASPARTATE MUTASE S CHAIN
molecule tags Isomerase
source organism Clostridium tetanomorphum
total genus 18
structure length 137
sequence length 137
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 2001-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1id8A00
1CCWA 3REQA 2I2XB 3REQB 3KOZA 4JGIA 1REQA 4HH1A 3KOWA 3KOYA 1REQB 2XIJA 1I9CA 5REQA 4Q37A 1ID8A 1B1AA 4HEHA 1K7YA 5REQB 3KOXA 1FMFA 5C8DA 1K98A 3IV9A 2REQA 1XRSB 3BICA 2REQB 3EZXA 1Y80A 1E1CA 4REQA 1E1CB 1BE1A 7REQA 3BULA 3WHPA 4REQB 2XIQA 7REQB 1BMTA 6REQB 2YXBA 6REQA 4HH0A 4R3UC 4HH3C 3KP1A 3IVAA 1CB7A
chains in the Genus database with same CATH superfamily
3P9QA 3FPEA 1AUQA 3AR4A 3DXYA 2H31A 1NMQA 3GAZA 3QBJA 5E1DA 1DRKA 3GZTB 3HNPA 3FD8A 4J94A 1DPGA 4B31A 2IH4A 1J0CA 3PNKA 4N01A 1TYDE 2FW9A 3VV2A 1FS4A 3RRZA 3ZY6A 2VDOB 2X0EA 4LX8A 5EIBC 4WFQA 3IEMA 2Y9MB 2QTMA 5IC4A 1N78A 1N3BA 3AF6A 1SKYB 1MP0A 1GKIA 3IQZA 1ZU5A 4RWZA 2YUIA 5JQGA 3OZ7A 3BERA 1M0SA 1OQAA 4MW2A 2OP0A 2YIDA 5KX5F 3S2UA 3DOUA 5JWHA 1I2MA 3TW0A 3ERCA 1QHSA 3KB1A 1JQ3A 4G25A 2WF9A 1Q6ZA 4ZMSA 1AHPA 1UEJA 2Z5LA 3BCRA 3W2IA 2AC2A 1ONOA 5AD1A 1ZUIA 2C0QA 1RAAA 2X8AA 4AWBA 1G9TA 1JXQA 3AR5A 5C52B 3H11A 4UBKA 1MV8A 4HUQA 4GXNA 4KYIB 1UBFA 4MNTA 4OHPA 2RHTA 2TECE 1WUHS 2QI9C 3BIJA 3INRA 4NH0A 4F45A 1GPMA 3W0LB 2LE0A 2V03A 4ESHA 3LDUA 1FS6A 4YIKA 4DBLE 5I47A 3UFXB 1ZY2A 1L1EA 1GIAA 1MKYA 1WXWA 1TK2A 1T0HB 4LOJA 1TK3A 3BSFA 4FNOA 5FCDA 3VU9A 1UFKA 1VXOA 4JUAA 2VQDA 3HXMA 1UZUA 3R5JA 5JLAA 2OBNA 4F4UA 1EXMA 5C80A 4V0OA 1Q12A 5A0VA 7MHTA 5CVUA 4WCFB 1E99A 4Q0MA 3ZVRA 2Q0HA 2JLVA 2NUTA 3IAXA 1J2UA 2PXXA 1T5IA 3GLFA 3L3BA 4YP6A 5C5CA 4FFPA 4AN4A 5JNWA 3KAPA 5TXGA 3RS3A 2EWVA 1LPSA 2X9VA 1FDWA 4HO1X 2X3YA 6ABPA 2EKPA 3L5KA 1EUDA 3FCEA 4L5IA 3RVLA 1PZMA 3FTEA 1U04A 1QRDA 1AZWA 3CE9A 2F90A 2YCLA 3FAKA 2I5PO 3GFFA 4RK6A 5F3DA 5IAKA 1V1RA 2KLHA 1HOTA 3R6LA 2VUHB 4FEEA 4I8DA 3AKDA 4KTTE 4QJ3A 3IUJA 5B7PA 2P9TA 3ZVMA 5GIOE 3JAKB 3TRKA 1F8GA 3QSYA 2I3AA 2O14A 4LI0A 3WK6A 1ZXLA 3H5TA 3TJRA 2BMFA 2R7KA 5DGHA 5IHPA 4RK1A 5I7AA 1RPAA 4L8FA 2Z4SA 3T3IA 1H0KA 1UJNA 1VSVA 2FPPA 4QTYA 5L7WA 4GZ5A 4NZ9A 4XZ3A 3LW7A 3HE3A 3MIIA 3VH1A 1NC3A 2D5CA 1NMEA 1IK4A 4KUHA 4XUEA 2ZSUA 4RH1A 3T9CA 1E60A 1II8B 1WM1A 1FUKA 3CLRD 3EMKA 5ALUA 1QS0A 5EHGA 3JD4A 1U94A 3TQSA 1ABBA 1TO1E 3TLAA 5ULLA 3DBHB 3ZHUA 1O96A 2R6HA 3HMKA 2DQZA 3EXFA 1RQLA 4MYSA 4BXOA 3HXKA 3NAZA 4W5HA 2RGAA 4M1SA 4V0KA 3T61A 4BWGA 4CM8A 4DDKA 1AURA 1ZM7A 3A6DA 1I7QB 1AC5A 5LJLA 1GPH1 4AMBA 1XELA 3L0IB 1I94B 3FE2A 3FBWA 4IRUB 3ZWMA 4CTOA 3HB1A 5C7OO 2GCGA 4I4CA 2FZLA 2J32A 1IY0A 2WU1A 1JKFA 4BC1A 3TRFA 4O29A 3P9ZA 4JWKA 2HUPA 3COYA 4L1KA 5TNXA 3NOQA 2A0KA 4LKRA 3ORQA 4NFHA 1DGQA 4G9GA 4BPRA 1D1QA 4CM5A 3HV2A 2XGSA 3IXLA 3VHXB 2VJPA 3PQCA 4FD3A 1J39A 3GF4A 4EITA 2BFNA 1XD2B 2JNWA 1Y42X 2P90A 3HMQA 3DYBA 4R0NA 5FP0A 4FWTA 4NCKA 4IV5A 2WWWA 4B9EA 3CIFA 5JJLA 1FK8A 2PUEA 3P45A 4DJJA 4V3CA 2WB2A 1NSTA 5FJIA 4NOKA 3ZCTA 2WB4A 1ZK1A 3PI7A 4U3JB 1GCOA 3NEPX 2YJNA 4CT4B 1APBA 2X8JB 1RXCA 2PWBA 3SFTA 1QWOA 4IDFA 1JPUA 2BN4A 2FFBA 4J9VA 5DCUA 3RODA 5IT0A 1GNLA 1DFHA 3O1LA 1M10A 1EYZA 2QM0A 4UVEA 3D0OA 1YMVA 2OPBA 3WB9A 5HPYB 1U8FO 2FSPA 2FPLA 3GEMA 2K2QB 3N7AA 4LSZA 1PZEA 4G9EA 3BMNB 2Q5HA 1RRCA 4UCXA 2I7CA 4B40A 3HKDB 1UMDA 2WWHA 1JIKA 3C1UA 3QOYA 1G1AA 1SG6A 4JBNA 4N65A 4NFLA 3IOEA 3GLTA 4DA0A 1D2MA 5ISMA 3I5AA 1QZZA 2ODTX 2HX1A 2YMQA 1KOLA 1HDXA 4O6VA 3TFWA 2GN9A 4K9MA 3WLPA 3T1YB 3LUGA 3LUAA 4UUOA 5B4TA 3MMXA 4G4SO 1T2UA 2O0LA 3B7PA 5DYWA 5EA2A 3UXEA 4MR8A 3WNQA 5I8PA 4JOCA 1Q15A 1XTRA 1KYXA 4JUBA 3UHAA 3IKJA 3VKHA 4AJ9A 4AG5A 1YL7A 3P2YA 2KS6A 5KKAA 3IUPA 1NOKA 1N57A 1I7NA 3TLZA 1V7QA 1V2HE 1ZI8A 2HIHA 5AKLA 4B32A 1AQLA 1X8JA 1JEDA 3DDHA 3H2ZA 3I58A 3Q98A 3UH0A 2C42A 4V0LA 1EQ2A 3K0HA 5JSUA 3C2QA 1NVVR 1V9CA 4OI1A 3ZLTA 1N4DA 1R74A 3PIRA 4RZIA 3UAYA 2X4GA 1XJ0A 3CFYA 3PC3A 3PHLA 5EJGA 3VDNB 5HP4A 1XJ5A 3QE3A 1WBJB 3L06A 5ES4B 3P20A 5T41A 3VNBA 1Y3DE 5CXXA 5AT1A 1OFGA 2I7DA 2ZTHA 1AHHA 4U7TB 4YJ2B 3DL0A 4ZQIA 4J7AA 4HUJA 2JI6A 3I09A 4HH4A 3WIDA 2V7VA 2VHXA 3BH7A 2XUDA 1X8KA 4GD3Q 3AB7A 1A2BA 4EJSA 3TTUA 1GGVA 2XUPA 3KEFA 4G8DA 4EYKA 2GEJA 1L5VA 4KG7A 4QBTA 1ZVKA 1N6NA 2HRRA 1XAHA 1BKYA 1G20E 5EZQA 1HDEA 4MRMA 3SD7A 4G0UA 3MWGA 2PX0A 1LPAB 2D2VA 4AG6A 4ZAYA 2P2GA 3L84A 4K28A 4ZT7A 1TMGE 3JARA 2ZB2A 3AV3A 3QU2A 4B3DA 1VCIA 2XYGA 4K40A 5AUQA 3RABA 4D0LB 1HDYA 2OZPA 3AG6A 3OM8A 4PC7A 1E2NA 5E4JA 3BIFA 4OHUA 2OVBA 5KNBA 4PSCA 1IONA 3CVOA 2QJTA 4JQZA 4MCAA 1LBQA 3H42B 1GRVA 2DUMA 4DA6A 5I7VA 1KAEA 1NT4A 4HS9A 3UJ7A 2EHJA 1QYCA 1XVAA 1QNFA 3S81A 2BEUA 2BSAA 1XYVA 4DUGA 4KGVA 2J6BA 2JJQA 2D2IA 2DBZA 1Q1BA 1PUJA 3ND5A 2KWIA 1RCTE 3ZNPA 3P19A 3A9CA 4YK7A 4DT1B 3FWZA 2NAPA 1CFZA 1Q84A 1W0JD 3FSRA 3FPSA 3IOBA 3NWBA 3SXUB 5KIAA 5ADWA 3HS3A 5IAOA 1RC1A 3W1VA 4G97A 1RVDA 3AHJA 3KQMA 3R3JA 2XIJA 5E38A 3ESXA 3M6LA 3ND6A 3LV8A 4MV1A 5G4LA 5IAJA 3OCYA 3F46A 3ELBA 5L8VA 1QRTA 4HGQA 3HC7A 1E5TA 1DJNA 3NAMA 2I4LA 4X0EA 1IZ7A 1TVMA 1Z4QA 5HK8A 3RHZA 1BXGA 4XQEA 1SXJE 4F6RB 3AJAA 5IAGA 5GJBA 2VSXA 1E7YA 1JEQB 2GERA 3QA3E 4WD3A 1VIYA 4F9GA 3E5RA 5C5EA 3G5TA 4GWLA 3DL4A 1CT9A 3GEPA 3TTXA 3HFGA 4KI7A 3ZWCA 4Y1RA 3ZW8A 1KP2A 1NNLA 3BXFA 2EJTA 1SUEA 1ZWLA 1DB3A 2JBHA 2JGIA 2R5WA 2WIJA 2YWEA 3NQ41 3OQOA 2HCTA 1L1QA 4LIPD 2FPWA 2R7LA 3DSRA 1CJCA 1ZZGA 4U8HA 5AVKA 3PGKA 4LUCA 1Q1EA 3AT1A 1MD9A 4IUCS 3VPFA 3ZTTA 1R0SA 1DNPA 4H4CA 2WA1A 5DT2A 1S7CA 5REQB 1Q0TA 4JP3A 2PXHA 1XZHA 4IF6A 2YYYA 4WKOA 1RRVA 2OBXA 4GI2A 1BJKA 2IELA 2Q28A 3PNMA 3T1VA 3WAKA 5JD4A 4KQXA 1U2DC 3O82A 3MZ0A 3NT2A 4GI7A 4LSMA 4XARA 4RTLA 1RWXA 2WF6A 1PJ2A 3B1XA 3O92A 3G7NA 4OLHA 5EMLA 1DAIA 4E1AA 1QP4A 3EBOA 2CK3D 2GN4A 3WDKA 1YS7A 2A6PA 3H99A 1VFNA 2ZSIA 3I73A 3T9DA 3JQCA 3B3QA 2PLNA 2PZ8A 3QQPA 4CWAA 1YK0A 2QMUA 3D3KA 3Q3VA 4CKBA 3FKJA 3VR3D 1ENZA 4OIMA 4BJ1A 1NBEA 4QUEA 4R40A 3W3ZB 1PS8A 3NANA 4DG5A 3LFHA 1O77A 3GDGA 4JLBA 1QHEA 1M7GA 2EYQA 3L01A 3RJZA 3UA4A 2YQ5A 2R2AA 4BLOA 4TQGA 1IY1A 1JXMA 2HJRA 2P7HA 4R1PA 1G4HA 4O08A 1ZCBA 2NTYC 1CF9A 1FYFA 3DAYA 3OEWA 5FA5A 1ULHA 5EZYB 1X9GA 2J0QA 5CLQA 2ZP1A 3ET5A 2Q3JA 3MB8A 3IR7A 4I9HA 3SGLA 2IYFA 2A1TR 2ZE8A 4D92A 3OMWA 4Y2TA 2IX3A 2HOQA 4FYIA 2Z2YA 2IU0A 2CHFA 5IUNC 3W5JA 5F5XA 1WZ2A 1QIIA 2NYUA 3GFGA 3UB3A 2FYTA 1UC4B 3IKTA 1OHHD 1LLDA 4JQOA 5IJZA 3H5RA 3JU3A 5AM4A 2QSZA 4K86A 2F9MA 3G5AA 4NDAA 4R2WA 1RJDA 8GPBA 5JAPA 5EAIA 5AVQA 5K3FA 3OC0A 4JSTA 2IU6A 5DCYA 3D64A 1VM6A 3SX2A 1GCUA 1VDMA 1IB0A 4KXUA 5K0EA 2AUMA 2M1ZA 1HYHA 4B83A 4CG1A 2A5GA 2H0AA 3EFOA 3W2HA 3ICQB 4RELA 2ZB7A 1JG3A 1ZBQA 3C8HA 3CR3C 4MUKA 3DW3X 4UJ3A 3O4GA 3E3AA 4YH1A 3WMWA 3EGDA 1GCIA 3OZDA 1J22A 3P9YA 2F55A 5GJCA 5AI0A 1CUWA 3EIWA 1AY0A 4UW9A 1XVIA 5UKDA 3WKDA 1WP9A 3UGQA 1L9XA 4L75A 3ZK8A 4M2LA 2D8AA 5B12A 3L7LA 1TAUA 2FR8C 4M0KA 4UU0A 3L8MA 1CY2A 2P6NA 3SZMA 1MX1A 3ZBTA 5FQOA 1QKKA 3EPJA 1KE2A 2OK8A 4MK4A 3ZG6A 4B2PA 4YR7A 1Y8RB 1ZUD1 5AKGA 2PZJA 3SFVA 3BF8A 2BHRA 1HDGO 2CNLA 4IIHA 2IWHA 1U2TA 1Z68A 3ZHTA 1FLAA 1UJ6A 1UK7A 1W52X 3CX4A 3HUTA 3LU1A 1ND6A 2IRWA 4TYMA 2GJ8A 4YP1A 3FHCB 2IPMA 3FNHA 5AW2A 2EQBA 1GLGA 4TGLA 1BH2A 3CB4A 4DJTA 1R8YA 4DMLA 1QU3A 1E9DA 2YOGA 3JASB 1YHZA 1W96A 2BFFA 3I32A 2ZKLA 1QX3A 1U02A 3KYJB 3M4ZA 4ZOCA 1RXYA 4BZQA 3EG9B 3FNBA 2PA3A 4CCYA 3G5UA 4LC9A 1Z6PA 1XAJA 3X1YA 2FSFA 2FOIA 4PRYA 2HT1A 1IOWA 3M2PA 4G86A 2WICA 4P2BA 1U0FA 4X45A 4G1EB 1MLDA 4M98A 4K88A 5J40A 5CD9A 2OSBA 2JCGA 5LQMA 2WJIA 4UOEA 2QS9A 5IT9A 1N5MA 4JV5B 4DDMA 3W5IA 3IT2A 1EDEA 4D0RA 1M1NA 3EH2A 3KVVA 2ADFA 2PZFA 3A8TA 3PQ2A 3WKAA 4RLHA 3GCGA 3UMSA 5LP1A 1TAHA 1H05A 3WRYC 1U3CA 1N77A 4F6LA 4FFBB 4URXR 2NO6A 1Z22A 1WABA 3DNFA 3GUVA 3BMOA 2H8GA 3QELA 1L5FA 5EJMA 3JQ7B 3K4HA 1LWOA 1UXKA 4TLAA 4B82A 3KYCA 3TG8A 4O02B 4V38A 4X3OA 5LZ8A 3I05A 2QW8A 1J2YA 3S2YA 4JASB 2QTWB 1BMFA 2OHIA 3K6JA 1KQFA 1AKYA 3PNYA 2JFOA 3EA5A 3CS3A 2HIMA 3PIIA 2P78A 3JD2A 4LOKA 2IWRA 1Y4DE 4BMVA 3C48A 3QE4A 3QVUA 1PW5A 3GH3A 5E95A 4CG0A 4FZVA 1H22A 2VJYA 3BAFA 4DW8A 2CB0A 3A32A 5ITVA 5K03A 4E5YA 1GADO 3RRFA 1FTWA 5ALPA 2J9GA 3IRUA 4QXOA 1P3DA 5JI2E 2WNIA 3ADOA 5DJ5A 4QEKA 2GD0A 5TGZA 4DHEA 1LK0A 3OFSA 3GRKA 4GBJA 5JYCA 2HF8A 1QF9A 1NF3A 1Z63A 1A27A 1ORTA 6GPBA 3CUVA 4EHLA 1MQSA 4MGHA 4F3RA 5INTA 3DT8A 4NS4A 3VOSA 3AVXA 1GAEO 2EQAA 5HZGA 1QE5A 5DHRA 1LSUA 3WNVA 1DLJA 4MUIA 3I28A 4LJ7A 1DQYA 3PQ7A 4ER0A 3R3UA 3WK9A 4MI1A 3H11B 3QXGA 2JZCA 2JIZD 3DWIA 2XQKA 2KSQA 3VO8A 1FNSA 2P5UA 3O4VA 4D4JA 4EDHA 4UDOA 4QEZA 5COBA 1Y6JA 1OX6A 1ISRA 2IY7A 3FJYA 7REQA 4C89A 3FGNA 4EF6A 5CBKA 4U5QA 1BMTA 1SHUX 3N8KA 2XJ4A 1EP2B 1GVHA 2NM0A 3GOQA 4NE2A 3FN4A 4NULA 2AUTA 4KQJA 1CY0A 2B20A 4YDHB 5ALVA 4RKRA 1E5XA 1CR0A 2EF0A 3FVWA 4TTIA 1F8FA 1ZQ1A 3U4IA 2Y1WA 4QDOA 3OFVA 4P32A 4PNHA 5F2EA 4A5SA 3OPXA 3D59A 4CKEA 3GLFB 1E6CA 3LX5A 3TCXB 4RVCA 4PNZA 2HEGA 2V4ZA 4MMXB 5KCZA 1MEOA 1R9JA 2GM3A 1E63A 5H9VA 2BR3A 4PG4A 2VPIA 4RSMA 5ALOA 2XJ9A 1J5EB 1EUDB 1ZGBA 1Y5LA 2PQMA 1J09A 3ANYB 3H1FA 3P2JA 3A2KA 1ONSA 3HYNA 5C8YB 1TECE 4M36A 1V1RB 3A28A 1ZGJA 4P5PA 1LQ2A 1X9HA 2IEYA 5IZCA 5CEFA 4J0DA 3R7NA 2QD4A 4DMHA 2PRIA 1XZGA 3ZLVA 1LNQA 3JYNA 1KR2A 1ABEA 5M34A 2G67A 3H2JA 2RH4A 2FEXA 4XGRA 3T7AA 2FPPB 1CQWA 3C3KA 3NW9A 4P3XA 4KJXA 2D2EA 1DL5A 5EZ6B 2DLDA 4QQ8A 3RANA 3TZQA 1ZKMA 3GBSA 2VZ8A 3KYBA 4PQEA 3V4PB 2IYPA 2QZPA 4W1RA 5CXSA 1YGYA 2YNMC 3DLPX 1JKIA 1H94A 2MIIA 4V0ME 4EYEA 1QS0B 3NONA 4R2LA 5MDHA 2R8BA 4N6NA 1O96B 1F1JA 1U1FA 2W2QA 3C1AA 2YWRA 2VAWA 3EXFB 3EQZA 4JCOA 2XT9A 1HDRA 4BXOB 3KJZA 4Q1FA 3RNOA 3E7WA 4E5VA 1VSQA 4CM8B 3F6CA 3UHJA 2XUQA 1SHTX 4M54A 2NU6B 1KY3A 3PE4A 5JANA 3ZZUA 2V7UA 4RSGA 2DJIA 1O08A 3P27A 2JZNA 1ZD3A 1ZP6A 2IHBA 2JIDA 3AF1A 3C70A 1U0HC 2PGAA 4IZ6A 3HB7A 5COQA 3V9AA 3WE7A 1MAVA 3B51X 2XA2A 2XMZA 1FE8A 1VE6A 1VZ3A 2C4MA 3ASVA 1CR1A 2DY0A 5CJJA 4CIBA 1U5BA 2CHVA 5L51A 1ZMBA 3R8FA 4C0AC 3VU0A 2ILTA 2DKNA 3UWOA 2FCAA 3MTQA 1SD5A 5EXPA 3FHLA 5H80A 3WGTA 5A6VA 4LOIA 3AXSA 5AW0A 1L8XA 1I24A 3UV3A 1Y4SA 2FV8A 1XK6A 1Q0LA 4PHCA 1NW3A 3OP1A 3LFTA 2G40A 4W1PA 2IVFA 2JFBA 5B2ZA 1Z7WA 4WINA 1EDDA 3CTPA 3TW8A 4LRUA 1T0BA 3ZGOA 3KQQA 3QWBA 2W2OA 4FXOA 4I4NA 1KO8A 4LYDA 2TMDA 1I3LA 1IOVA 3BRWD 1QOPB 1USVA 1ZA2A 2G25A 2Y2UA 3AKCA 3IMEA 4C21A 3GFSA 3SC2A 1AO3A 3R0ZA 1QFXA 1JILA 2B5OA 3EPRA 2JEYA 1GNRA 1W0JA 1WY7A 2ZWPA 3LUFA 4UNQA 5LMUB 4DQUA 3OLZA 2M6SA 4OAOA 4BGUA 1K92A 4YJKA 3RDPA 1RHJA 1UPFA 4ZKEA 2XQJA 3DHNA 5IMBA 4G8BA 5FTMA 1GLNA 1KIAA 2DFNA 1TA4A 1SFRA 2WHXA 5F51A 2NVWA 2GKGA 4F6CA 5C7LO 4HJRA 3K1TA 3QTLA 1PFYA 1UMDB 3IAS6 4LJ4A 1UP6A 2O7NA 4DDWA 1BJTA 2QM3A 4BMPB 4IDHA 4AVYA 1QV7A 1Q3KA 4KPUA 1JR3E 1ISPA 1J8FA 2BZ1A 3PDIA 1W1WA 3N8NA 1TJNA 4L3WA 3NRBA 3TH5A 2AMLA 1ZUNA 2FFRA 3COSA 3ETHA 4RA6A 4TMVA 1QIMA 4X41A 3V2HA 4B74A 2E1PA 3V6MA 4XYGA 5TEWA 2PH1A 4AWAA 2FN7A 4GRAA 4CR7A 3W9YA 2HYIC 2NVOA 4MWDA 2OAEA 4UVGA 2E5FA 4OX9B 3L8EA 4EUSA 4G5RA 4JBYA 1FW8A 1BQEA 1SG0A 4KDRA 1C0EA 1QYDA 4O3MA 1GG8A 3MJDA 4RW0A 1ML3A 4P58A 3IVXA 1P1IA 2BISA 2JLRA 3EOAI 2QROA 4IHJA 2C84A 3RGWS 2PMCA 2GPAA 3IDAA 4J0QA 4DXHA 5FEMA 1PT6A 4OHXA 2CK3A 1OSNA 4KPGA 5BSUA 1MF7A 1S2GA 3T54A 3ROKA 1L5RA 5LLTA 3AW8A 3SG0A 1RBMA 2B4TO 4YXFA 2OO7A 4NPHA 1MJ5A 3VR3A 5L45A 1LH0A 1MPXA 2XNCA 4EX6A 4LDNA 3JVVA 3OKFA 1FXWF 5DHTA 2W6MA 3K2IA 3TW6A 5IXSA 3EWNA 2BF7A 2SNIE 3CEPB 3Q8XB 1V5GA 4Y6QA 3UMYA 2PKCA 4ERXA 4IKOA 1BDHA 3F8SA 3WQSB 1KH3A 1PEKE 3MK31 3NHKA 1JHXA 2REXB 4FGLA 1W30A 1Z4JA 3GOHA 3GFRA 2WJHA 4EG7A 4ER5A 4MMZB 2EGHA 3N3BC 4MRMB 4BV8A 3U16A 3H9CA 4D7AA 2P9YA 5JFOA 2J3KA 2C9CA 3JARB 3OE7D 1OHHA 1S01A 4XJSA 4IXTA 1RWPA 1O89A 4ZXPA 3X1DA 1WB5A 3ZI4A 4WNAA 3TSOA 1BIFA 4MUFA 4EQ6A 3K96A 3I01A 1E0KA 5FA8A 4IVRA 3EW9A 1YCGA 2X58A 1QIFA 1C9DB 4QAJA 5DYGA 4ZDKA 3UPUA 3NVMB 2QT1A 2YDXA 4M21A 2ZJ7A 4NJOA 1VL5A 1T3TA 4PLGA 3VTZA 2B92A 2BEUB 4Q5IA 5KKNB 1P8JA 5AI9A 3IBGA 1CQZA 3QVOA 3QX3A 1EZ4A 4P1ZA 4YBRA 2XKAA 4H0NA 2GBGA 4TXMA 3N0RA 2GX6A 2VPYA 1A71A 4QTTB 5ALIA 4I50F 4PRKA 3TSWA 2Q7DA 3VKWA 2R6DA 1H1LA 2CWWA 5BVGA 1U80A 4EARA 1JBEA 5A71A 3EIEA 1OXXK 2OWDA 1QLHA 1U4SA 2X0RA 5ALGA 4CLEA 1PSZA 4PZYA 2O05A 4OHFA 5IF9A 5EJ7A 1J6UA 1NJFA 1ODKA 4CF6A 2VBFA 1KY2A 2VWHA 3EGEA 1UFOA 1WDLA 4OPMA 4OMFG 4Z0NA 3GYGA 4J1QA 5KTOA 4ZVKA 2QP3A 4I14A 4X9XA 1BXGB 3VU1A 1UPTA 2TS1A 3I8XA 4JL8A 4XFKA 3EC7A 3HCWA 3G2MA 4ZCLA 1EVJA 2E21A 4Z1OA 1H23A 3CWQA 2DR0A 2XF8A 2HBQA 3DXXA 3V33A 4TTSA 5B6PA 4Y1RB 4NPAA 1YCFA 1WQ4A 1ULTA 3C98A 4BLQA 1TIBA 1MXHA 3C3XA 2FN8A 1DWUA 2C3OA 1HG1A 2O0KA 3D7RA 3PR2B 4G0QA 4IFIA 5IVKA 1S0UA 3L7BA 2ERCA 1U8YA 2FGKA 3BORA 2D8MA 3HKCA 2CNBA 3CUSA 2H57A 2LTAA 5G0UA 4CU5A 4JMPA 1E4EA 2FW8A 2RKWA 2ECQA 3QPBA 3CRZA 2AXNA 4FMDF 3U37A 1SZPA 1LEHA 4M49A 1TMKA 3EYWA 2DWPA 2ZUDA 5GOZA 1GPBA 1HYBA 3F9RA 1ZHHA 3AL2A 4ENTA 3QGMA 3HWWA 3BKXA 4ARBA 2HPZA 2W8ZA 1L0BA 1XRJA 2AJLI 2YXEA 1NOIA 4D42A 5EHZA 5F4ZA 3TOSA 4R83A 1L8AA 5E8RA 4EHIA 2FJUA 1NFFA 1EFKA 3C1TA 4ZRDA 1WV1A 4CKBB 5BQFA 4CIYA 1WPQA 2POCA 5KCMA 2VDMB 1NXXA 1TKRA 1K8QA 2W4QA 4Z4EA 1SU7A 2EX1A 1GAQA 3AIOA 3O84A 4G2NA 4IM7A 3VBCA 2QVXX 1I4TD 2GMWA 3R0QA 1V9SA 4IOLA 2NOAA 1LPOA 4ZA2A 1BQ4A 3EOBI 5AOCA 1KC3A 4E3ZA 1RIFA 3TAUA 2DERA 1A8IA 4RTPA 3RC7A 4AO8A 4FLEA 1T4MA 1AKRA 5FUQA 3C1OA 2QI9F 4Z0TA 2D1FA 1PVDA 1JDBB 2OG1A 1PWZA 3AI3A 3IAS1 3CRMA 1T8RA 1I6MA 4BNUA 4NX2A 1X7GA 2B4RO 5TJ9A 4RTNA 1BH6A 2X0JA 4JT2A 2J07A 2Q6OA 4IQ4A 4D9BA 4CGZA 4L5YA 5KYWA 2QSYA 2ZBFA 3LHSA 5JTUA 2F1IA 3LIIA 4OJYA 1SXHA 4KIUA 1Z3CA 2OB2A 2V5AA 1EZZA 2WF7A 3KQVA 4OHCA 3STVA 4ZYWA 5K3FB 1KVTA 3TINA 3QM1A 1II9A 2XA9A 3BN3A 4FYJA 1DXHA 3FYCA 5K1ZA 1GDDA 1GSHA 3GJTA 4EO7A 1GG5A 1BC5A 2QTRA 3CNHA 5EINA 3KTFA 1CRQA 1WR8A 3D2CA 4N6OA 1OGYA 3NWEA 5SV2A 5JMWA 3EFOB 4I9NA 5L9AA 4LISA 1C7EA 1N5KA 3RK0A 3EGDB 4ACBA 1B42A 3EGOA 3MG9A 4EHHA 5JC8A 2WNHA 2C3MA 4YRQA 5T8KA 3OPNA 3FDIA 1LRJA 2PUHA 3AOGA 1O6GA 3FCOA 4N6GA 1JIVA 4WACA 4YCDA 5HRAA 3GG2A 2DUNA 3DCYA 3K8ZA 4BVFA 2CXPA 2R68A 3D6AA 4ZVPA 3I2GA 4JA0A 4OF4A 1CHDA 2XWPA 3STUA 5IABA 5LDHA 1CF2O 1QYIA 2D2XA 3NPAA 5JH7A 2A1TS 2J3IA 2VSYA 3O91A 4Y2YA 2YZGA 2HT6A 1J25A 3RSCA 4EKGA 5EKXA 5CCXA 1PQUA 1G6HA 1U1DA 4EP1A 1FNBA 4L3VA 4I55B 4ZCRA 3GZNA 1OLOA 1WU7A 1SC9A 2EFYA 2YVUA 4HLUC 5H4HA 3ZIAD 3F0TA 4DIDA 2FE1A 2BFFB 5DMXA 4E14A 4NZNA 2VPPA 3DGFC 1P7WA 5K0JA 3ZN2A 3HRIA 1XAIA 4CCYB 3NIGB 1M54A 3A1DA 3QKWA 4OGFA 4UDNA 2PAFA 4Z9YA 2C5BA 1NVUQ 3V5NA 1JZTA 2GJ4A 1YA8A 2HO5A 2RHBA 2VF7A 4ZV4A 5LQCA 1E2BA 3THWA 1K6MA 1V7PC 621PA 3QLUC 3RTBA 5KVSA 1VBMA 1U0RA 1FDRA 3CVYA 2CY0A 2QF7A 1C7JA 1M1NB 5EMKA 1SRRA 2P5SA 3ZNNA 1NBMD 2ZSJA 4YRKA 3CF2A 2HDNB 1TJPB 1YRQA 2NV6A 1LSSA 2MSCB 2Q6LA 2ZWAA 1SCJA 5GV7A 1N9KA 2HF2A 1Z13A 4J91A 5JXWA 5LR6A 5DM1A 2WG2A 3BMOB 3WKBA 3QELB 1NL3A 3OPQA 3PEFA 4L8WB 1GZ4A 5I6DA 5FOXA 1F0PA 3ADCA 3KYCB 1KGDA 4MICA 4XFDA 4V24A 4F11A 3DBRB 4F1JA 5K0NA 3CF0A 1M66A 3I3SR 3W5UA 3EQ7A 1Y3IA 2E1RA 3PQ8A 1TQ8A 3ZUPA 3BGIA 2CLIB 2HU8A 3LL4A 4W9NC 4LQ4A 1EDBA 5JV5A 3W5DA 3RU2A 3PICA 2I2CA 4GVXA 3UKJA 4ARSA 1RNLA 3O4HA 1QGZA 2ZGVA 3B1FA 3GB9A 3I2HA 4FS3A 1KR5A 4HPXB 2O2GA 4QHTA 1XQWA 2GHIA 1T5LA 4M83A 1AD2A 1Z5PA 3P4XA 3L82B 4FWIB 1GXSA 2PYIA 4R01A 4XUCA 5JBNA 5KJ1A 5ICGA 1BCRB 1PGJA 3D3EA 3BB4A 3DV0A 4YP9A 3UHPA 2J59A 5BSEA 5CXUA 5KJ6A 1NWCA 3M1LA 3FPAA 2B8WA 1WB4A 2AFIE 4GPZA 3SBDA 4CPDA 3QFFA 2B37A 4MKHA 4EQZA 1VA5A 3GLHE 2FPKA 2IS1A 4DPKA 3E27A 5JD6A 1HDOA 2H3EA 4WKBA 3EIUA 2ZTVA 3ZHOA 1CUJA 2F3TA 3I4CA 2DSTA 3ENKA 1WE2A 3KKQA 3GJZA 4I1RA 3HJAA 4GX0A 4K6HA 4TUYF 3WSVA 1HQKA 4TZTA 4ZJYA 2XDYA 3H4TA 3PNVA 4KN8A 4OXQA 1MOQA 3U48A 2HU7A 1PZNA 4HNHA 2OENG 1TUGA 1TIKA 2B1JA 2Z43A 3L8GA 4G4IA 3EF0A 4WIAA 2ZW9A 3WZMA 1AGPA 2BTEA 3Q8LA 3BRWA 1HDZA 4CEIA 1KI9A 1BU8A 4DVJA 3OTOB 1GZ6A 5CM8B 1W2HA 7REQB 5D3KA 3IERA 2RGUA 4FZ3A 4INJA 4JKYA 1MX9A 3E7DA 3WA7A 3K9NA 2OECA 4QUJA 3A2LA 4M1WA 4RK5A 4ZZIA 3RNLA 5A62A 4HVTA 5TDHA 5C5IA 2PCJA 2G1UA 4LPKA 3K4QA 5KTKA 4W5NA 4NJEA 3TGWA 3SJBA 2P3QA 2XGJA 5AXAA 3DC2A 5JVDF 1IVYA 3WHPA 4OMCA 2I9KA 4CKEB 1BTOA 4PLFA 5K0LA 1S96A 3L4BC 3NUZA 3WGVA 2UUAB 4MKZA 3THYB 2YL2A 3AY7A 3CH7A 4LTDA 4MS1A 4XTRA 3T4XA 4QUGA 2R0QC 1MO5A 3S70A 3O8LA 2PVSA 3ROTA 4P6VF 3JWJA 2YVKA 4HQOA 3PWTA 3EAFA 3QZUA 3HCCA 2PZGA 1F9AA 1WXEA 2EZ4A 2BSQA 4UNRA 3SF8A 3E8SA 1NAHA 3IX7A 2VXCA 5K3EA 2K87A 1KSGA 4IDPA 3S28A 3ZDBA 2OHVA 2VK8A 4MHTA 2IUSA 1QHNA 1QIJA 4LF5B 2RHGB 2AZXA 1SBTA 4RF2A 2J9FA 4Z7NB 1Z6XA 2J9ZB 4R9SA 2FW7A 1JF8A 4IJWA 1X87A 1J21A 3I9NA 2Q5QA 2V6JA 2XTZA 1KQGA 2JAQA 3EHDA 2Z5VA 3CG4A 4EENA 4DTIA 4ZVVA 4YO8A 1RWBA 3E1GA 2ZM6B 3G8DA 3CH6A 2OC9A 1EPUA 3BMXA 4CV2A 2HBRA 1YBHA 3GLUA 4UEOA 4BDSA 4RYDA 4MKGA 4NWIA 3UJ3X 4GVPA 1BAPA 2WDPA 2WVHA 2GJAA 2XCIA 3H5IA 3O1IC 4RO0A 3VZCA 3ZCPA 9ABPA 3W5AA 1P60A 1R0KA 3HUEA 1T8YA 4CCAA 2PUVA 3B89A 4L9RA 2VLBA 2I2BA 1RSZA 4LK3A 4NE9A 4M1KA 4DWWA 1RHMA 2JD0A 1TVEA 4MPRA 3RREA 1SQGA 1OI3A 5ALEA 1LF0A 3AVTA 1GZ3A 5AXCA 4XRGA 3EXHA 2AE1A 3P2MA 4HSEA 4LY6A 1R9MA 3U7HB 1TK9A 2GN1A 2MMCA 3U9SA 2WV7A 5B1YA 2C7QA 2G72A 2KE5A 3DF9A 3R6GA 121PA 1ISFA 3ZE6A 4IMIB 2NNLD 3LQYA 5KUTA 4NBNA 3QHAA 3V4SA 4E30A 3D3QA 3EVEA 1M6EX 5KTMA 1Z5NA 3DDNA 1EK0A 1TPYA 3GLKA 1B6TA 1PK8A 3NPMA 2WBLC 3P5BA 1Z5UA 3OE7A 3RHTA 4ND6A 4CMJA 5EKTA 4FVTA 4INZA 4RTMA 1NV9A 3OEHD 1WTAA 3V8MA 1H3EA 1EFAA 4FGZA 2ZB8A 3KL4A 3PD0A 2YFKA 3ZDYB 3M4NA 1L5MA 2C31A 1RT9A 3C5WP 4MUJA 4ESVA 4GGOA 3TW8B 1X3SA 4YLYA 1TU4A 5AJUA 2VUUA 1FUEA 4XR9A 4CV3A 2D74A 1KYWA 2ZS9A 2I1QA 1OC2A 2BLLA 3C45A 3SC2B 2O2IA 3J7TA 4RJ2A 1BX0A 1J8YF 3LECA 3RBAA 4ITVA 1ZL2A 4RE6A 4YRZA 1N2BA 4NZZA 4RHTA 5D51S 1QIKA 1KC1A 4TLDA 4CLXA 3QEJA 1PV1A 2ZRLA 1GQSA 3L93A 2J5BA 2M32A 3PRJA 5ITZA 3GNLA 4LF8B 5IKOA 8MHTA 3TX6A 3F49S 5AYVA 1B14A 4J0HA 1PQYA 2Q5EA 3PV0A 1HFKA 1A4RA 4FZJA 3DD1A 4PGMA 1TM7E 1RM4A 2Q9CA 2ID4A 4YAIA 1MXFA 3I64A 2PBFA 2BPOA 3BA6A 3ACBA 3W6NA 5HKBA 1ZUWA 1MGPA 3MUFA 3N75A 4QPPA 4UE3S 3TLEA 4F46A 2GSWA 1XTVA 4EF4A 2QAIA 4KPUB 4EIWA 5E3JA 2LBPA 1I3KA 3PDIB 3TDMA 5CFLA 1WEHA 1ZUNB 3L8FA 4RA6B 1W5FA 3OFJA 2Z5GA 4O2RA 1V8ZA 4MJ3A 5FADA 1Y80A 5DB4A 3ZYCA 4XM1A 5IPFA 5FO1A 3DPUA 5B55A 2XDWA 2GYVA 2CWDA 2OKGA 3GVCA 3ETEA 3ONVA 4OUDB 3W05A 5IZ4A 1F2UA 2JAHA 3DE4X 2ZRAA 2CXTA 4D44A 1ZPDA 1CB7A 1PQWA 4GYJA 5IAAA 3HVRA 2HPAA 1AB6A 3Q9NA 4JODA 1IY9A 3FCSB 2H48A 3ENWA 4C5AA 1ZH8A 2IU3A 2VHEA 3AH8A 4GKVA 3Q7TA 1LSJA 3RWOA 2A4KA 3W8FA 4CI9A 4P34A 4RTOA 1QNLA 2OQRA 1WULS 4PXSA 4UHKA 4EW6A 1JTVA 1B26A 3QYJA 1GNTA 2C96A 2CVFA 2YHBA 4B7ZA 5DBIA 3HXOA 2J87A 1O1YA 1X0VA 2C9ZA 3CKLA 2PKEA 1X8LA 1XDBA 4NP6A 3NO4A 3V3KA 4I6EA 2NU9B 3R3ZA 2V7EA 2VNSA 3MCWA 1P2DA 5D5PA 5ABPA 2HNKA 3LF2A 2H1HA 5GZ6A 2VRBA 4YX9A 4LHSA 4C4AA 4LXUA 2Y3IA 3OVMA 2ONCA 1P8AA 3FB1A 2BD0A 1I0ZA 4RZHA 4CN8A 4QLAA 1K8ZB 1W4RA 4FIDA 4JLPA 4U4AA 3WBJA 4BASA 4DLYA 4PCLA 3IPYA 4MDEA 4GLBA 1OILA 5HZKA 3S27A 4X62B 3QVSA 4DBZA 1KVSA 1M34B 3ODPA 4WNAB 5NULA 5C34B 4NBLA 3GFOA 4P80A 1E9RA 1MG5A 3A0UA 3LL7A 4GYKA 2WG1A 3KSRA 3CXRA 5JUWA 1QP0A 5IEJA 1YZGA 2ATIA 2H1SA 3CUKA 3QNMA 2XLCA 3COWA 2ZYUX 4IILA 4YI3A 4AZSA 4EI8A 3L46A 1SXPA 5L4LA 4BTEA 2ZFUA 4JC0A 1M6YA 1O0SA 2Q0SA 4KPEC 1P39A 3AOEC 4MIYA 2WSMA 3IPRA 2P2CA 3OD1A 4QNNA 4OAPA 2OV8A 3TIVA 5BVGB 4QVGA 1TQHA 1GR0A 1Q1AA 721PA 4O4JA 4P7KA 5HDBB 4AICA 5KNDH 1V5FA 2PJRA 1FLVA 3SIXA 1R0WA 1PR9A 4DRZA 1DRWA 1W5EA 1UK9A 4RPIA 5AJXA 4ZP1A 1QH0A 3DOHA 1P4SA 1T9AA 4EB3A 1Q2XA 4P3KA 2YOHA 4H0FA 1X6VA 1EQUA 4C0XA 2AI1A 3I12A 3L6BA 2OQVA 1B4DA 2R6ZA 2YHIA 3W5CA 1CJSA 2WZBA 2XQVA 4ITUA 5EHIA 4HB4A 1PNVA 2PRKA 5KTTA 1KDTA 1H1TA 3TQRA 2R00A 1E9CA 3Q41A 2PBRA 4Q01A 1LW6E 4MVYA 4D8UA 2B8EA 3MAGA 3ZIAA 1UP7A 1UC5B 2QWXA 1M2OA 2CBZA 3HKCB 4LE2A 4XB6B 4WV3A 3F4BA 3LUPA 4LRSB 1SC1A 1Q0PA 5GIPE 1E4EB 3DQQA 4U0KA 2BEJA 4ZOLA 3C4VA 5EP4A 2VSNA 4LEIA 1IJEA 2VK2A 2KM1A 1W5BA 4HYEA 5E9AA 3STHA 1WL8A 5AW1A 3KQOA 4N3GA 4NAVA 4ZQGA 5LQSA 4J6EA 2J48A 1ORWA 2I3ZA 3HJGA 2G76A 2ZPAA 3Q1KA 5EP2A 4DRXA 3PLAE 1NR7A 3JZIA 1NBMA 4OH1A 3A7DA 1ZOIA 2PSEA 4XB1A 3PYXA 5BSFA 4C7OA 3L8HA 4IIEA 1T0UA 3M70A 4N18A 3PFCA 1QC5A 1ENPA 2JHCA 1B16A 2VL7A 3CZAA 3K35A 4IQ8A 4PXYA 1E3EA 4EWLA 1FNMA 1YDEA 3AYXB 5AKXA 5EQDA 3MTGA 1RQRA 2JFVA 1SMKA 5DNWA 2RGXA 3BXXA 1Y7TA 3MILA 4YY3B 3SQDA 5LB4A 3WJ1A 4Z7OB 4I7EA 4REQA 5CBPB 5JYEA 5H59A 4DM4A 3OJOA 1QHIA 4C76A 1I1OA 4MINA 4UDXX 2HA6A 3B9PA 2PRZA 1FQKA 1XX6A 3RIYA 4ESEA 3CEHA 4QTZA 1ZESA 4TWAA 2CE2X 2WYUA 4O59O 1U4NA 1XL1A 3LT4A 3B3JA 2ETXA 2NXEA 1UKAA 3KOYA 1GZHB 1EKXA 1D2EA 1W2WB 4PLYA 4F9FA 1UJBA 2PUJA 2F1OA 2EV9A 4UTNA 3WADA 2Z8XA 1Z07A 3ENVA 1DCTA 2Y67A 4RDHA 5CTAA 3SAJA 5JNSA 1U0EA 4Z51A 1EM8A 1R0RE 1FXSA 1AJEA 2I1WA 2XODA 4HAOA 2QV7A 1MN6A 2NADA 3EXG1 3KAKA 2FZCA 2WZCA 4L0DA 1OUMA 2IOFA 2IPNA 3X2EA 4AYXA 5CDTA 3H0CA 2VBIA 3H5WA 1JHPA 3RVMA 2MSWA 1MDFA 2WD8A 3GUHA 4ZZ0A 1PLKA 4NYIQ 2BMVA 2AW3A 2JGRA 3KT3A 4QAQA 2AI2A 4WXEA 3NIDB 4YP7A 4BFTA 2QRMA 4W5WA 2QUHA 5IYZA 3K9FC 4MW4A 4H31A 4LXYA 2Q21A 2F43A 1EVQA 4JYPA 2AFHE 2UYCA 5TGTA 3NYIA 4PAGA 4Z5XA 4CEIB 2BRUC 3HJTA 1ZVVA 4TM8A 3IOYA 1KJIA 1MJHA 2DKFA 3AJEA 5LYJF 1YJ8A 1NUQA 3OZFA 4D3FA 1A04A 2RK6A 4BJ5A 4CFSA 5JH7B 3F6PA 4JQCA 5A5GA 1JSLA 2XZLA 2WW8A 4UEQA 2PL9A 4FC7A 3D8HA 2PX6A 3GZNB 4RK0A 4RTRA 4YCMA 3HY4A 1KI1A 4WJLA 5CIQA 4HN4B 1OI7A 2A0XA 1AS2A 2G63A 4I99A 1HFJA 2I2XB 3M4YA 2JGNA 3GPCA 2P0YA 3JTMA 2O8CA 3BWCA 4PQGA 4FDLA 4D9IA 2PR2A 3RJ9A 2AQKA 1PZGA 1JN0A 1WB6A 4OGLA 4CEHA 4RZQA 1VRVA 4QELA 1AGRA 4YAKA 5J59A 3B1YA 4REOA 4EZIA 4M8LA 1KEPA 1KS9A 2AKAB 4P3PA 4WDQA 4WEOA 3Q85A 3BIOA 5DTMA 5EJ9A 1JIQA 2QXTA 3ICPA 1FDTA 2IYSA 3U80A 1NWHA 1QCZA 1Y6FA 1ULUA 2Z9CA 4L8LA 2B1IA 2P91A 2OCLA 3NALA 5IJXA 5DW0A 3CLTD 2FKNA 3IIMA 1DEHA 4XIIA 3WKEA 3SS7X 5KQPA 2J3LA 5CA0A 4KI0A 4A8PA 2YR0A 1CZLA 3R5SA 4QU9A 5KAPA 4AP5A 3I2JA 5AVRA 2QTFA 5A3QA 3L4JA 5F2OA 3G2IA 3NHZA 3HB4X 4ML3A 1R4NB 2OYCA 1VHJA 2VHYA 4YRBA 2VA9A 5JALA 2ISQA 3D6JA 3U31A 5BN4A 1VJ5A 3D9QX 4EHAA 5ESDA 1DDIA 1WXIA 1EA7A 1QYWA 3O4IA 4IMRA 2L82A 4P3YA 1AGYA 4UAVA 5FFNA 3U81A 3A3NA 1PJ8A 3BBPA 3GQVA 1MQ8B 1V1MB 2B3DA 2BM8A 3BWXA 4BNFA 1KDPA 2CFOA 4FWBA 5A4AA 3VR2D 5I7WA 1LPBB 3PS9A 3IB6A 1I7PA 3UT6A 4D97A 2YY6A 3BFXA 4D6PA 4D57A 3BD6A 1GXSB 3P2KA 3SLRA 2MYNA 3TM4A 3VKGA 4KLNA 5TIIA 4L85A 5DYYA 2OV3A 1MVLA 1HKUA 1L5YA 2J3HA 2ZI6A 4F06A 1AQYA 2I9PA 4ZQFA 1Q11A 2XTAA 3LS2A 1ISSA 4QPCA 1FJXA 2ADOA 1OZAA 5TX7A 1YVRA 1NLUA 3KXPA 5G4KA 3JYPA 4TT3D 3OEHA 4LWPA 3D6TB 1N6RA 3B6IA 2H4JA 3NWOA 4UAJA 1A95A 1IC6A 1TZKA 1H2XA 3E03A 3KG2A 4KNYA 2PWPA 4L7VA 3T94A 3ANMA 3W2TA 1I0IA 2N47A 2ON6A 4L9AA 2B6NA 4HR7A 4LJSA 5THKA 4N3NA 1JYFA 4K2HA 2UYOA 2XOXA 4ZVQA 5GGXA 5GPBA 4W82A 1OFVA 5IJAA 1QUFA 1GL6A 3GFTA 3L7NA 2H1IA 3UWDA 4B7CA 4ZEMA 1VMKA 3RC2A 1XA0A 3FMIA 2Q1WA 3L4EA 1E61A 4L15A 3UXYA 4MW5A 3WLKX 1SWVA 1BEUB 3UOWA 4BKPA 3AI7A 1XZPA 1QCYA 1YQWA 3RF7A 4NJEB 4RV4A 3TOCA 4E11A 3FAZA 3FFTA 5BSGA 2W6JD 5KINB 3L7AA 1O6FA 2ZU6A 3O3CA 3OKPA 4IR7A 2ZUWA 4DKXA 5CDGA 3U3RA 5FR2A 1FP7A 2O4UX 3T5AA 2NX2A 1QHHB 1F4VA 4MS1B 4BE9A 1KJZA 3UVEA 2GBIA 1E0JA 3MT7A 2W2MA 2YJ4A 3SZGA 3DFIA 2VF5X 3QV2A 2QSUA 3ETJA 4UM7A 4ZVOA 5I9TA 5KVAA 5T64A 2RHDA 4MEAA 1CUZA 1XVUA 1X19A 3AY3A 2CFTA 3DEFA 3HZOA 3JD3A 1JSRA 4Z8XA 3SF8B 5J4LA 3PQDA 3EIXA 4K6MA 3AZQA 4Q3BA 1TMOA 4MOWA 4R8RA 2P2ZA 5IBPA 1TVKA 1NR1A 2VDQB 3JPWA 4IUBS 4G0MA 2PIDA 2GXSA 1KXZA 1QTNA 2J9FB 1RWQA 1RRMA 2JFYA 3N2YA 2ECOA 3JTEA 3V7UA 2HMUA 5EEGA 4A6XA 4CR6A 1H5NA 1MAHA 3JQGA 5YASA 2Q0QA 3AJ8A 1O0BA 2Y1KA 2R7MA 2NZ8A 3PXDA 5FBZA 2KHZA 2JFPA 2PS0A 2PT5A 3ACDA 5AHWA 4DLKA 4PHHA 1GQFA 3STTA 5KWJA 2VYND 4FS8A 5DIFA 1N3YA 4L9WA 4YRDA 1G8YA 2RE8A 2EATA 1EWKA 1KMIY 5I9BA 3OP4A 1JTFA 1VA4A 3F47A 1QK4A 2OSVA 4JGBA 5F7JA 4G1VA 1C3XA 3L79A 3QPCA 4X00A 3UT0A 2JKZA 3LQQA 4AG3A 3RG2A 3BGWA 3GI1A 4NLLA 4WNYA 2VXBA 1WVIA 1Q6YA 1FXUA 2PWYA 1PE0A 4NPCA 1RAEA 1T8TA 3C5VA 3DTVB 2GJSA 7GPBA 5J4YA 1NULA 5GVSA 4BFLA 3KUDA 2GCIA 1U3WA 3HLTA 2QUKA 3MJCA 4YAOA 3EMDA 1N34B 1G4UR 1FQOA 4F3CA 1GTL1 3R77A 2PSSA 1MB0A 3NGMA 5HF8A 4KUGA 3ZZMA 5H8WA 1GYQA 1AKUA 1ZXBA 2I8AA 3P0IA 4W5QA 4H1WA 1XMIA 2GDZA 2JH3A 3GWGA 1N2EA 3Q12A 3QENA 3UJHA 5B1EA 1QANA 2BMEA 2CLEB 4NZOA 4BO2A 5IWAB 1NSYA 3LPMA 1F2VA 1XO1A 3D5QA 5THQA 4CF4A 5C8XA 5K0CA 3GGJA 4DANA 1A7KA 3KCNA 5KYUB 2YY7A 5DGTA 2ZE7A 2JGLA 4ZALA 4ES6A 1XKLA 4RPKA 4D9GA 5K99A 1GV1A 3BXHA 4CQMD 1B93A 3BS4A 3EC2A 1BE6A 3C97A 2RBKA 3H9BA 4LMPA 2VWPA 2JLBA 3G59A 1XI2A 2I34A 1ECBA 1OB2A 2WD7A 1JEYA 2JAUA 5T7BA 4AJLA 5LQDA 1F2TA 5CYFA 4RMIA 3JRWA 4BP8A 4C6TA 1O94C 3X0DA 4QATA 4RACA 5B2EA 5ITZB 1DO2A 2KPOA 1MOZA 1R0CA 2W2NA 4JELA 5AW8A 1Q1ZA 1NJ5A 2Q5CA 1KRWA 4JYBA 4KL8S 2BEWA 2J1LA 5KYKA 4JK3A 3EIQA 4LPSA 4UMDA 1NLMA 1W49A 4YDSA 1IZ8A 1LCIA 1SURA 2WJ3A 5ECDA 3RUHA 4ENVA 3BYZA 1W19A 3DEZA 3H5NA 1JFVA 1CEYA 1XDUA 3BC1A 3DZHA 4QU0A 2IEIA 3GT7A 4A4DA 4C14A 4WA7A 2OM2A 1HQYE 1KDZA 4YRAA 4JB2A 4XLZA 4EKDA 5LD2B 2P3OA 2KX7A 5KX5A 1Y1TA 2A8YA 2NAFA 4B71A 2H5IA 2P1RA 4GR9A 1U28C 4J4HA 1G59A 1EHCA 1DC3A 1F2UB 1PG2A 1WQ3A 1S1CA 3QRWA 3WTBA 4EMTA 1UFRA 5BPFA 2JLYA 4Z4QA 1AA9A 2NUAB 1T1IA 1E32A 4KXXA 1N8SA 2HTFA 4XX1A 5JRJA 3LCMA 1G98A 4JY7A 3AUUA 4BVLA 1CUGA 1DC7A 5SICE 4BE4A 1YQEA 1Z62A 3TKLA 4KQ9A 2QT0A 3DB1A 1G8AA 2YOFA 5EZYF 4RHXA 2ATVA 3L6DA 2XHZA 3PZBA 3WHKA 1S8NA 2ZIUB 3AR6A 3DMRA 4QL3A 4XW2A 4I08A 3EZ2A 3TUJC 2QU7A 2ES4A 2RH9B 4C43A 4MAAA 3UK0A 1J70A 3T3OA 1EWVA 1OAAA 2X76A 3MWEB 4IFEA 4NZMA 5HJ5A 3PA6A 3SSNA 3HBMA 3IP3A 3FXAA 3QX9A 4WOBA 4PZUA 3T3EA 4BL5A 3IDFA 3A25A 4I8IA 1B15A 4LTMA 3FG9A 4XD7D 1QXSA 4HWOA 4RMHA 4EHBA 3I6YA 5J58A 5FBHA 4H6PA 1P0IA 5BV0A 1MENA 3X2SA 1XLTC 1ZLXA 1X74A 2L42A 3BL5A 2C5FA 5DM2A 3SM3A 4ECEA 1CDZA 2O7QA 2YBDA 4NENA 4S0ZA 1VL1A 1OTXA 4BQNA 1I1NA 1WCXA 4EJ6A 1BCSA 1HEYA 1UBTS 3DG9A 5B3JC 3A37A 1Z4OA 4P0PB 1V3TA 4FSHA 1CJKC 1H8HD 3N39C 3IESA 3OIFA 1GEEA 2SECE 5CNIA 3V4FA 4G85A 5CDFA 3W77A 4F4DA 2HLHA 2AGVA 3FLAA 3OT4A 4O5AA 3F5MA 1YRLA 1TZJA 1GPJA 5AJYA 2XT0A 5LLDA 2NO7A 2Z9DA 3DFZA 4NATA 2ACVA 4PBRA 1DFGA 4F5DA 2FP4A 3R5KA 5FPSA 4DDUA 2AEFA 4HYYA 4XYLA 1S8AA 1P7PA 3F96A 3O93A 1T9CA 1DXQA 1ZL0A 1CRLA 1JJBA 2CMFA 2WYIA 4WN3A 4BN5A 4BVGA 4EYOA 2L0XA 4ZYZA 2ECPA 2ZQYA 5FEUA 1MMFB 1LFAA 2VJLA 4J43A 1F17A 2NQ8A 1W29A 2QX4A 4G01B 1LX6A 2HH9A 3GEEA 1P0PA 1TFUA 2WV9A 1S2IA 2GNPA 3PFGA 3PJEA 4CGYA 2J3MA 4TVBA 3KZVA 3SQXA 3I92A 4TL7A 3JQBA 4CVNA 5HSGA 1W75A 3I30X 1Y89A 3CLHA 3EQ6A 4IS2A 4UMVA 5E7MA 3DDOA 4O4JB 4DLRA 5FUMA 1PFGA 3LQ1A 4N54A 2J9YB 2HTEA 3PGMA 5HFNA 4TLCA 5ERXA 2BKEA 2Y1OA 3CUUA 2IC5A 3KHKA 4G0PA 4ABYA 1KO5A 1UUFA 1YKGA 5JXJA 4NTZA 4DARA 4WK0B 1KIMA 1O5OA 3R09A 2P9GA 4XH9B 5AVZA 3GR6A 4FCWA 1KEEB 1V35A 1AS0A 2YHIB 3SR0A 3OX4A 3RARA 2HLDD 1YDMA 1JTEA 2NT3A 5DASA 4ZCSA 3NBFA 4YV1A 4N3CA 3C8UA 4YJ3A 1UBKS 1KI2A 1T0JB 1J0XO 2DH5A 4OHOA 4XUDA 5DGIA 5ALSA 2VOJA 3ELYA 1ILEA 3NIWA 3QUCA 2IUYA 1P2UA 4GAEA 3E61A 5EXSA 2FZEA 2AR7A 4BU0A 2FXIA 1DX6A 4ENSA 1M2OB 3EZLA 5DSTA 4JT8A 5FI0B 4CL2A 4AULA 4S1PA 4FMBB 5A04A 1TUBB 1VBKA 1XTSA 1J07A 1YJQA 1Z7EA 1NMYA 2ZG6A 4K81B 4ZOLB 3JQEA 4MCIA 1VLLA 4TLLB 4TZ6A 2CFRA 1Y5IA 4QM6A 4WJKB 4OH7A 1IOZA 1J2EA 2R6R1 3C74A 2QN2A 4GHWA 1MX5A 3QW2A 4EK9A 2Z0MA 3FDJA 4MYCA 3QHQA 4BNYA 3IJPA 5BYKA 3SNHA 2QTAA 5HIAA 2ZI4A 4KX3A 2XRFA 1N1MA 4BATA 2XYHA 3PIDA 4FEAA 3UKDA 2R8YA 2XKKA 1R0YA 4QUKA 4JP5A 5SZKB 5LXTA 4W6ZA 2NP7A 1K8XB 4UPVA 1H4TA 2G70A 1Y34E 1QRAA 4R68A 4Y7DA 3HJRA 1QC5B 1RLTA 2KI5A 3QPUA 1IFXA 3KKOA 2A2ZA 1Z4PX 1GD1O 1U7XA 3LBYA 4WJZA 5F1YA 4Q39A 4UZSA 4A82A 2GLXA 2VZLA 4C7KA 1L4MA 3LHKA 4IGEA 2WKPA 5TPWA 3ZZ1A 3HFSA 3LOQA 1TGYA 4Y9SA 1DC5A 3HEAA 4REQB 4EX7A 3IKLA 5DWDA 1XTTA 3CSDA 4R3WA 5ALHA 1YR7A 1QZ3A 1VE1A 1ZH2A 2ZJ1A 4HWRA 4ND2A 3HQ4O 3IPXA 4LMRA 3VR2A 2JLXA 2CL0X 2R7NA 3CNOA 4ALJA 3DZGA 2AG8A 4OQLA 4FHEA 3NUGA 4J0EA 2OHHA 1Q17A 1FFCA 4JBWA 3AL3A 4R51A 4WMLA 3Q9SA 5H02A 5DBHX 1C1HA 3Q8KA 3D4BA 3RTCA 3KQNA 4XDZA 5C7IO 4U2BA 2IPAB 1QO9A 4G9BA 2DRIA 4WBSA 1EM8B 2GZRA 1Q2UA 4Q4CA 4DUZB 1NVDA 1SXJD 4TT3A 1MU0A 3PPXA 5EJEA 2IDJA 3ESRA 3TJMA 3DVLA 3OTWA 3U5TA 1TM5E 3JPYA 2R66A 4ZPXA 1R15A 1QUEA 3DDWA 2G83A 4WLFA 2WSBA 3FCYA 4JAVC 4GLLA 4PWYA 2BTQA 4W5JA 2VZ9A 3USES 4LZNA 1X1TA 2Q2NA 3VTFA 2QLJA 2GBLA 4H16A 3P9NA 4GG1A 3DDZX 5IYZB 1E8DA 3G23A 3A70A 1G5RA 3PG5A 4IZIA 1O5IA 1L5OA 3IBYA 3IEXA 4UHDA 3WGQA 4LFBB 5H82A 2WVAA 1VJ0A 3OPMA 4EYQA 3E9QA 1E2FA 3ORFA 2ZSBA 5IULC 4OMDA 1J1ZA 4QRIA 2A58A 2CN1A 2JHGA 1R16A 1ZIXA 3FFXA 3QFHA 1UIMA 3MW8A 5BR7A 4ZAXA 3IC5A 1XZFA 3HSYA 4Y67A 3UY4A 2Y0EA 1ZK4A 3IT3A 3GROA 4YFYA 3B78A 1Q3TA 1Z83A 4TSKA 1MNAA 5LZ7A 2BV3A 4A0RA 1JMVA 4BNLA 3G9XA 3DLHA 1NZDA 2IPXA 2Q3EA 3G6KA 4F92B 1MC4A 2R7AA 1WXDA 1M2EA 1VG1A 2HW8A 5DKFA 5E4TA 2O8CB 4KR7A 5IAEA 1Y4ZA 3MUNA 1E96A 1PEAA 3G9UA 3IKVA 4BMSA 1SBCA 3H4MA 4X1OA 1GZVA 1QWSA 4MGIR 3O8CA 1PKEA 3T38A 1XCBA 4MI6A 4F04A 1GLVA 1RI1A 5KSPA 1PUIA 4CEHB 5IXJA 3EVZA 4HWGA 1OWOA 4QGSA 1M0EA 4QGHA 3KOUA 2XXJA 3T8YA 3GD5A 2LCQA 3II6X 5HOEA 3OQVA 4ZTBA 1TRKA 4HF7A 4LNUA 3K94A 1WXFA 3CPHA 3PE3A 5EXXA 5J5CA 2OGZA 4UTZA 3VX3A 4ZI2A 5I3ZA 4PO3X 3K0EA 4CTJA 2BEKA 3UJBA 3UH1A 2FX2A 3DLAA 1A0OA 2XLBA 3VNVA 2AWNA 2ZBUA 1VI2A 4J0GA 4XOUA 5B1HA 3X1ZA 4G24A 4YYZA 5CA0B 5A5FA 1XRRA 4R16A 3OQNA 2A9VA 2PRJA 1FFHA 3IXQA 2Q1XA 3M89A 4CDMA 1P91A 2VYNA 2R6AA 3D0RA 3UWMA 4HD8A 2G80A 4CEJA 3O2NA 3OY2A 5BN4B 3T7DA 5C1DA 1ZW6A 2IYUA 1OAOC 5ILGA 3O31A 3VJMA 1CUHA 4ENQA 5C8VA 1U7DA 4KE8A 3TLXA 5L4SA 3RC1A 9LDBA 4FFDA 1VB5A 2AC7A 5J23A 4ZYUA 1BNCA 1NN1A 5FOVA 1DTWA 4F3KA 2OHGA 3GJ0A 5T4HA 5I7SA 4LCJA 1N33B 1XQ1A 4P54A 5EJ8A 1JALA 1QKJA 3DAGA 1P0QA 2W71A 2VDVE 4JX8A 1TJ4A 3FBGA 2GN2A 5GY7A 4ND8B 2MSKA 2XB9A 2EP8A 3H9GA 4GX1A 2C2HA 2RHOA 5G4KB 1K2VN 1QV6A 3RBVA 1ZJ4A 1I36A 2OCDA 1M3SA 2WJGA 2O52A 4KE7A 2P6MA 1P5FA 3DJFA 4XDHA 1ZCJA 3EVCA 2FJPA 2VQ3A 3GJ3A 3FTCA 3GUCA 3PTZA 1SCIA 2MYUA 5IW8A 4M60A 5G41A 2FPIA 5JFTA 1MAWA 2GPBA 2R8XA 3MCUA 1GTSA 1Z8HA 1UWVA 2PZBA 3AINA 4JDPA 4DNPA 2XKBA 2PT9A 3IILA 4CQMA 3DOOA 4HEQA 4ILKA 4JVMA 4XI9A 2Y1EA 3L18A 5D3MB 1ISMA 2PVPA 3BTOA 2R47A 4EB6A 4M8SA 4YEDA 3DJYA 4EG3A 2ZKIA 3DT9A 4KGXA 1MDBA 4Q34A 1QRRA 4F3YA 1CUVA 2XGGA 1FVFA 2D1RA 3WTCA 1EEHA 3A9SA 5DNEA 1R8JA 1VMDA 3Q3IA 4DSOA 1G64A 1HL7A 2I6GA 4QEDA 2QOEA 5TC4A 5BMVB 2JGKA 4PN7A 3IIEA 1XNRB 3HVKA 3LE8A 3OCXA 4MUGA 3VJLA 4PNEA 1UDXA 2NVUA 4HMQA 1YZYA 4R8LA 3WWDA 5I4KA 1AMUA 1N8TA 4OAQA 4Z0PA 4L9SA 2OORA 3F3YA 4LZPA 2ZJBA 4BJ6A 2L19A 2QMYA 1GU1A 1G41A 1EX9A 3LT0A 2VQEB 3FYUB 5H0IA 2WQZA 2QORA 4XVUA 4Q4AB 3RQSA 1ABFA 2I3DA 1SUIA 2JKVA 3GLIA 4NBUA 1GFZA 1B2LA 4OHKA 5EQFA 2ZIFA 4BYMA 1TVKB 3S8YA 3KTAA 3IO5A 2JLSA 3I1IA 1X42A 1DQNA 4J1NA 3DE2X 2SKDA 4ZK2A 3FF1A 1DWQA 4GPIB 3TN7A 5KSZA 1TEHA 3JQGB 4PPFA 5K4GA 4FTWA 2HU2A 1A9ZA 1EQAA 2C78A 1UH5A 2AD5A 3BMQB 1NXQA 4KIGA 2ZRJA 3LZDA 2HK6A 2H0RA 2CVZA 3PC6A 4WWHA 1MR3F 1EVYA 3VKUA 1XSEA 4GP7A 3TCKA 1XZDA 4D8VA 4ZPJA 1YZNA 1C9YA 1NY6A 2JZOA 2PMDA 2CNDA 3SQWA 1RJFA 2OEPA 1V8BA 2O6LA 4NG4A 4S12A 5J2TA 4KX5A 4M9XA 3ZU5A 3MRXA 1LY1A 3A11A 1TF7A 4XD7A 1AVTA 2C7OA 2OAP1 4RLSA 1BSVA 3MQ2A 1YZKA 1MB2A 2BCGY 2I78A 1BGXT 2CEKA 3OWHA 4JA2A 5GWXA 4AMZA 5A9RA 5IJ9A 5KSOA 3UPTA 1W85A 3UB4A 5AVTA 2XRZA 1DBIA 1QQTA 1X13A 1XU9A 2NSLA 1RIIA 4HKTA 2PEYA 4AECA 4KR0A 3SZ3A 1XDWA 2D0PB 1N8KA 1FYXA 2INGX 1GQYA 2FSVC 1GGKA 1H8HA 4GRDA 4OI2A 4TQ9A 1P75A 2RGYA 4XSHA 3JAMA 1Q1QA 1FUIA 3CUYA 4Q1AA 5CT9A 3LQ4A 3T7IA 5K0SA 5EIBD 1W8IA 2EW8A 1KEZA 2IGTA 5KB3A 1W48A 4UUAA 2OP1A 3K0BA 3RRYA 5A9TA 1C81A 1M0TA 2FPMA 2WOJA 3DMYA 2EERA 2ZE6A 3DWFA 4YCCA 3HTXA 3BSSA 2VZEA 1ECJA 2JLZA 4AJ1A 4BKQA 1MA3A 4N49A 4DLSA 3G2PA 3HJCA 5IFKA 1Q91A 3JZAA 3WMXA 2YMPA 3K15A 1SC6A 2AQIA 3RYFA 3VISA 3HLKA 2B78A 3HYRA 3O1JC 5HZHA 2A3NA 3IVRA 3KR0A 1XDGA 1Y8CA 1CY7A 5CW1A 3LP5A 4HL6A 2VDLB 4IDBA 2WD7B 4QD3A 3TQIA 4AJPA 4RL4A 3STXA 4G1UC 4BJHB 1FNNA 1F2TB 1JEYB 2V7XA 1KZ1A 1MIOA 3FWYA 3V80A 1YU6A 1G5QA 4HH3C 1T91A 1WZEA 1H1DA 4FN4A 3KOOA 3B3FA 3L40A 3ABRB 4Q3CA 1P45A 4XGQA 2AN4A 1Q7GA 3A7EA 3AB8A 5IKEA 1H2FA 2Y6VA 3HHEA 1D1PA 4NBKA 3ZHQA 4G65A 1SU4A 2BEWB 4AAYA 4WXMA 2JHAA 3EYAA 4D99A 4WLNA 4GE0A 2HLDA 4GI3A 4HN9A 4RM2A 4UNPA 2FI1A 1TUIA 4GI1A 3BQNB 3ENQA 2UUPA 2HIGA 3JVEA 2P2YA 4H9GA 3TL2A 1GYRA 3NNDA 5HMMA 1V8OA 5IM4F 4U7HA 2RJNA 2VP9A 2EEZA 4K0RA 3SS8A 4CM1A 2ALJA 3SJZA 1ZOPA 5KX5B 1SVSA 2C9DA 2H00A 4KXMA 3ZD9A 5TMPA 5C7YA 1N2XA 2WUWE 4ZHSA 1CCWA 3VSCA 2PU5A 1OKKA 3BWVA 5HF6A 1JJ7A 4C88A 5C4IA 1KNXA 4X91A 1L1FA 1I2BA 4Y6LA 4DG8A 1DRUA 3H6GA 1CQIA 1DIRA 2G06A 2DBRA 4NBWA 2O07A 2OCXA 1QQ7A 2IOYA 3JQAD 1GQ2A 4NFSA 4A8HA 1N2IA 1YR9A 2VJQA 3QH4A 1NJSA 1T3LA 1E9EA 2GXUA 2WMNB 3EAQA 1G20A 4XCQA 4BOYA 3AETA 3K73O 2JGJA 5H83A 4KU4A 1UEIA 1QH9A 1XCJA 1GT91 3U7FB 1MO3A 2ATXA 3RAEC 1MRSA 4OFXA 4FR2A 3QYAA 2Y99A 1AN0A 3CC8A 3QX8A 2FSGA 1P61B 4OQMA 4LHYA 1S9HA 1SUBA 1V16A 3VSBA 3HY6A 4FKMA 5IN4A 4GNKA 1Y6GA 5AXBA 2HA7A 2X0FA 2B7BA 1WSWA 5A7HA 4LDZA 1NUSA 4WX2B 2C7VA 3JWHA 4O5OA 3A1UA 1ZINA 4GICA 1FMFA 5BQ5A 1NMSA 1A8HA 1YI8A 3NLLA 2A94A 1JQAA 3WQQA 1BCSB 2AF4C 3CZRA 3LKBA 2ZIZA 4P4UA 1Z35A 3EG5A 4F60A 2YX1A 5F33A 3S2EA 5HUHA 1G38A 1S6YA 2GWRA 2WUFA 2BI4A 3I9LA 4LDAA 4OM8A 4UDYX 5FOUA 4H1HA 3ZE9A 3L49A 2PPLA 3O8RA 2XGMA 5K8TA 3QI7A 4ZJZA 4C9BA 3MBKA 1F6DA 4PSUA 4DWOA 5J2UB 1UQTA 2FP4B 5EE5B 3A4IA 2AEEA 1XXHB 3EA4A 4JXKA 3G8YA 4A73A 4DJ5X 5KQLA 1JP7A 2PQ6A 4TPKA 4NBSA 1R9GA 4FSDA 5EE9A 3DE1X 1SXJA 3MGKA 3HUUA 4HLQB 4KLZA 1YOVA 3T5PA 4BBZA 3IPCA 1Z2PX 2DCUA 4IJ6A 2CJWA 1NI4A 2X23A 1JR3D 1KFEB 1UZAA 2BVNA 4JH0A 2K5UA 6AT1A 5EHXA 1TF2A 2GCOA 3C3JA 1CZNA 2GF9A 3HWSA 2QDKA 5CX1B 3T5DA 1Z2OX 2IEZA 2OO5A 2V1XA 4B87A 3AEXA 3TQQA 2XOKD 3GX1A 4LJYA 5LDGA 4XPZA 1AMOA 1U7WA 2IBSA 4JBHA 4X84A 1E6WA 1WLYA 1D0VA 1EUZA 4NCNA 3ZD7A 1BXZA 4D81A 2YWGA 3GXBA 1YS1X 3Q2IA 3EGIA 1EZ1A 3ZXXA 4TWIA 1BN6A 2NUBA 2AWOA 5TGDA 3WP0A 1V7ZA 3KJGA 3DLBA 1CS0A 5JDCA 4X1IA 5LDDC 2JGDB 4YJ3B 4X93A 2ZK7A 4BRSA 1XP8A 4BJ3A 3C5CA 3WNZA 1V37A 4HDSB 4H18A 5JLJA 3BJRA 4QPDA 1NVVQ 1NQXA 4G0VA 3HJNA 4YAEA 5F52A 2ZSAA 3CLSC 1YE8A 4RGYA 1EFVA 4MV7A 1FMLA 2VKTA 2WYOA 4US2R 5H68A 2IYZA 1JSCA 2NQ2C 1QMGA 4QFMA 1XZEA 2VYFA 2FG7C 3T1OA 4EG4A 4COKA 3QJ5A 4UBMA 4BO4A 1B0PA 3T3GA 2XVXA 4OGWA 4P4NA 1HE3A 5A03A 3FX2A 1UPXA 3M9WA 4C7OB 2V55B 1L6RA 3AY0A 3D02A 3HUDA 4N47A 4R7TA 2HHCA 2V6GA 1CUBA 4P7FA 1ECFA 5LXTB 1ACJA 4TWRA 4E3WA 5IVDA 3V8PA 3JVDA 3OETA 3A06A 4PXAA 1Z5OA 3WL7A 3T1TA 4BNDA 3NGLA 1X1CA 3OIWA 2ENUA 2R1VA 1PWXA 5JY1A 3SYMA 3U17A 2HWKA 3HACA 1VMAA 1D5CA 1D9ZA 1K6IA 1ZRNA 2XZDA 4MR7A 4BNNA 4AJEA 4P7JA 5HJ2A 1QAQA 1CJVC 2Z1DA 3CPSA 3MJVA 2A86A 1PT8A 4OKSA 3KL2A 1AO0A 2NUPA 4MJXA 4PC1A 4RLQA 1GZUA 4CDRA 2WTMA 4PG7A 4O0MA 1J0AA 1H2HA 3IJ5A 5JRZA 1R6VA 3DWEX 3R6TA 1MVNA 1RAHA 2BKLA 2QQ0A 4WEQA 2Y6UA 4QTXA 3ZWKA 4BNTA 4DB4A 1KE1A 5CFMA 1VCOA 1ETHA 3K9WA 1R8XA 5JU6A 2Y1CA 3EZGA 3K09A 5TRTA 1FZTA 4A0QA 4FGWA 3S99A 2X1HA 3PX7A 4YMUA 2B21A 2XCTB 3LBFA 1X7WA 1NVTA 2NWQA 3GP3A 5FR1A 1PJCA 4FR0A 3ITEA 1T8WA 2ZT5A 5AHKA 4QDZA 2Z6AA 2F3QA 4LZZA 1E6LA 5K09A 4X90A 4DHWA 2W83A 4B46A 2I6TA 1V0JA 2QLFA 1C41A 4OHWA 2HF9A 1E1YA 1BEEA 4EGCB 3MOIA 3NBKA 1W94A 1YRBA 3KLMX 2ZUTA 1C4KA 4R1LA 3W6PA 4D79A 2XUGA 2E4UA 3M81A 1JQEA 2ANCA 3W5VA 3AVQA 1SQ5A 4EG6A 3HJUA 3ZNOA 3T7KA 4OHZA 1CS4C 1Z16A 4P5DA 3CM0A 1KYQA 2GPSA 2K4MA 3CN7A 4RHUA 2BTQB 4GKAA 2EBWA 5JO9A 1YZUA 1X1RA 2A5LA 2VXYA 1NW7A 2P9CA 4G4SP 2DHRA 1Y9AA 2I2AA 3EVAA 4KMMA 3C3EA 3P9KA 4NV1A 4Q7MB 2G0TA 1VCHA 4IOJA 4DLZA 5JJ5A 5K8JB 1DC4A 1PDOA 5KTNA 4M9RA 3D4PA 1GQQA 1KARA 1T43A 5JEDA 1XQXA 1DJMA 2COUA 2H11A 3KJNA 2BI7A 3L43A 3AF3A 3PFBA 1Z8FA 1YBMA 2C4NA 3JQQA 1W4LA 3IE1A 4ZFNA 3VGPA 1NPDA 3GA5A 2DFKB 2PUDA 1QDLB 2AE2A 1CFJA 1C1XA 5AM1A 1LTQA 3OZVA 5LZ5A 4F21A 4LW8A 1U0BB 1CYEA 4EVSA 1U7OA 4GECA 2P6PA 2FW0A 3U3ZA 2Q5FA 1Z4LA 1F51E 1R3DA 3ZZNA 4TYYA 5JSYA 4GPAA 3W79A 3BDVA 1FJHA 1IWOA 4RF5A 1VJDA 5CXQA 2C88A 3TOVA 2IS6A 2I6SA 5DBOA 2FKAA 2DFTA 3MYYA 4XLLA 4Y1FA 3UMCA 2LDBA 3GJ5A 1TO2E 3M4JA 1URPA 2QL9A 1M1ZA 1GPAA 4N0QA 4IDGA 3VC7A 3WC4A 4CTMA 1J24A 1YNOA 5AVVA 4L7QA 2MDTA 3HO8A 4IDEA 2P4SA 3V00A 2PO5A 1GTMA 1PL6A 3LC7O 3HR7A 1J00A 2GTIA 2YIVX 4GYWA 4LNUB 2AK3A 5CPFA 1G6Q1 4Z2AA 1MZVA 4YUVA 1S3GA 3MINA 3QFRA 4DIEA 2EYUA 4I50A 4O2BA 4JBGA 5B37A 3WLEA 4LE0A 5F2NA 3U44A 2IIVA 4KOAA 3I6ZA 1S3FA 1MCZA 2HB6A 1MHTA 2V5VA 2WY2D 2AJBA 2GFHA 1Z5GA 2X77A 4YV0A 1Q1NA 1YJXA 3OSUA 2QUAA 4IF4A 3BJZA 2E5WA 3SYRA 3EIHA 4JYMA 4OVKA 4TXLA 4C7VA 2Z8YA 4ZK6A 4CEJB 1H6DA 5AESA 1JDUA 4UM9D 4Y3UA 2P5TB 1KH2A 4M53A 3N86A 4B6FA 4QDKA 3NP9A 3AC0A 3ODGA 3SKXA 1N7IA 2BFBA 4PPGA 1E1CA 1QPBA 1RWVA 4X95A 3SQMA 4QXPA 3EUEA 1QH1A 4J0CA 5B7NA 2Q9AA 2GD1O 3HGQA 1T2FA 4EFMA 3VDMA 1IUNA 1VBFA 4YRCA 3PX2A 1XT6A 1DTWB 4ZWNA 1UJ2A 2WWYA 3WQRA 1EGQA 1X80A 3QY9A 2GFIA 2DX7A 4TMXA 1JT2A 1ADFA 1W4AA 2HK9A 2CV0A 2HIAA 3OX1A 1NF2A 4UBJA 1FCJA 4ZYXA 3M49A 1JU4A 4MR9A 5IXYA 1NZJA 1B1AA 1R0XA 1QYVA 3KLOA 3S1AA 2HU5A 1WSAA 4HFNA 4JD5A 3P4UA 4DSAA 3NHBA 5GM1A 3FOEC 4DXAA 1MFZA 4MWSA 4YN3A 2FEKA 1K98A 2Z4RA 2P35A 4Q00A 2QN7A 2X2EA 3IFSA 5F7ZA 5TV2A 4H7IA 2CE7A 2OVFA 4BO3A 1C3EA 4CKXA 5L3VA 2F3SA 1ID1A 3ABSB 2FPIB 3V4VB 1A5SB 4H35A 4PFSA 1KSHA 4AZ3A 4HB2A 4BGEA 5MFZA 3VR0A 1HE2A 4JS0A 1ZO8A 4X3CA 3RYCA 4CUZA 1AF4A 5FWYA 1I5RA 1NXOA 4KVGA 3UK1A 2AHOA 2YWCA 4CQMB 3DCIA 1HQCA 1NAIA 2LD4A 4JGIA 3W8EA 3D43A 1IQUA 2E7ZA 5TARA 3BCSA 4MZDA 4DQXA 3W9BA 1KQNA 5JG7A 4EB6B 1F38A 1TL7C 4DMFA 1DSSG 3B2QA 1GY8A 1W5AA 4GEKA 3FW1A 4B2IA 3I5YA 3AJDA 4K9KA 3B36A 5E4YA 3ZCRA 3ABZA 3V8VA 4DYVA 2UUCB 2IS2A 2J67A 4KO4S 1GM5A 4DSNA 3FIJA 3RSSA 5TQ2A 4PQFA 2EW1A 3EXEA 3L8CA 4M1OA 3AIIA 1PT5A 1Y1KE 2NVUB 5HHTA 4E32A 4Q9AA 3S1SA 4JJKA 1DS6A 3ZBPA 3JALA 4YC7A 3AERB 3AUAA 3V8EA 3HL4A 1AXGA 3N87A 4HCJA 4AP6A 1NC1A 3R4VA 2AUNA 3EXAA 2HQ1A 1PHPA 1I7LA 4IGAA 5CJ2A 1QIGA 1H4VB 2ZS8A 3R24A 4QRHA 5KTSA 1DG1G 1AQJA 1FMCA 3GLIB 1UMKA 3HB0A 4YAUA 1G8GA 3CRW1 3KTAB 2WF8A 3N7TA 3QNWA 3MPOA 2VT7A 4RPHA 1HBJA 1YH3A 2LV8A 2NSYA 3C0KA 4TN5A 1U8EA 1R5BA 1IAQA 5KYXB 1E7QA 3WS7A 2ZJFA 4OK6A 4RD1A 3WLSA 2H5EA 2WUEA 1A82A 1G21E 1AT1A 3TIGA 3JQAA 4UTVA 1ZDMA 3LXRA 3TQOA 3WK8A 3DNPA 4RM3A 3NUQA 4Z4IA 3FYUC 3EB9A 3PCRB 1A2OA 3LVQE 1RKQA 4P83A 3I9OA 5CU7A 1NYLA 1DC6A 4BFWA 3BT7A 4CUKA 3JYLA 2ZZMA 1QOQB 1J06A 5A4MS 1CYDA 3T5GA 2JRLA 4P98A 4KO1S 5G0SA 5CJPA 2EFJA 1NTOA 1JEJA 5EIWA 3CCCA 3P71T 5J2TB 1N25A 1T2NA 5U4XA 1F3OA 4PGFA 1XMJA 1QK5A 5CCDA 1OLSB 2F6RA 3TZLA 1EGVB 2OMKA 1AF7A 1HUQA 3NBQA 4MWEA 3HL0A 4RKEA 4UNNA 7YASA 1CUXA 1G5PA 1X7YA 3B5IA 4JC8A 4ZIRA 4YLGA 1MO2A 2C2YA 1H6BA 1M73E 1W85B 5F64A 1VBNA 1J9GA 3ZOZA 3ZXYA 5JADA 4DDTA 3R44A 5AI5A 3KPYA 3ETDA 4HFMA 2GM4A 2WKRA 5EIEA 4K6KA 1EIWA 5CDSA 5BWNA 2GZHA 1UAGA 2XEDA 5I5EA 4UM5A 4Y9DA 2RJOA 3B5JA 2VRWA 4E6PA 1FF9A 3T3MB 5KEIA 4RTSA 4EPTA 1A8PA 2F3UA 3FCUB 3QLVC 2OHOA 4UEWA 3U4QA 5G0WA 3DEHA 1OPRA 4ONEA 4R1UA 3HCNA 1P1KA 1U6JA 1UBCA 2TSYB 5JS8A 4KHZA 3DO8A 4OKIA 3EZYA 3U62A 5C35A 4B6QA 1I3OA 1Y7LA 2FR0A 3R8XA 5FNZA 3W7VA 3RYFB 1T6XA 3H9QA 3ZHRA 1XL0A 1JR3A 1NTRA 4YACA 3RQIA 4HFJA 1IEXA 1M5TA 4S35A 3OJXA 3A9UA 1IM8A 3WZ2A 2LR0A 3U7QA 2XOKA 1SCAA 1QGUA 2HK7A 3RB8A 3RV3A 1MIOB 1T1RA 2IBMA 4WESA 4WFIA 4C2UA 2NP6A 4LOLA 1YQGA 1WMEA 2FWRA 4A23A 3VOBA 4IJ5A 1WNTA 2GD6A 2CGEA 2GM9A 4Q3DA 2PT7A 3QEOA 5EIAA 4Y30A 3U1VA 4MP8A 4K2AA 1P19A 1HXHA 4AK9A 1SUSA 3CH4B 4D56A 4DADA 2WJJA 2LNDA 4H15A 3A2NA 4CQLA 4J8PA 4DCMA 1OW3B 4L76A 3U3DA 2H1RA 4GYYA 1NUTA 4NU0A 4BP9A 4HLCA 3UJ6A 3KWLA 3ZCVA 3R1IA 1A9PA 1DBVO 3HYSA 1XLVA 2OCPA 1VLHA 2ZBVA 2RH8A 3GMIA 4HDCA 4MPDA 3SYTA 3HA2A 3U1BA 1YS9A 4ARUA 3HDQA 3IQDB 5L3SA 3LNTA 1M0WA 2GEDA 4R2IA 1XEWX 2OD2A 1E0DA 1XNHA 5H3CA 1N92A 2IZ7A 2J85A 3RTEA 4TUYA 3Q8MA 5TMEA 2RHJA 3VI3B 1CQIB 3OLYA 4MV4A 4QDXA 1H93A 4DCJA 3KEGA 4NONA 3KE9A 4TS1A 4AROA 4B1FA 1XGKA 2XW6A 3DZ8A 4JFRA 4BLTA 5F7XA 1FJGB 5CPBA 1WXGA 1G20B 3R5XA 4G56A 4LBWA 2QX7A 3AETB 4WKCA 4OJNA 4A1FA 3PDWA 4KMSA 4DA8A 2VJMA 1RE1A 5HK9A 3A3KA 1G3MA 2V7PA 3UF0A 2FR1A 4G1MB 4DMUB 3BHIA 3FZNA 5B1DA 3B1JA 5LZ2A 3WBKA 2WFZA 2OYSA 3IMFA 4KDCA 3SYKA 2YNMD 2YV5A 3EW7A 1D1SA 1V16B 3TQFA 4I1PA 2IE0A 3FGPA 3OOJA 4RORA 5FRDA 4AIRA 3ZCSA 4OQZA 3FR8A 5JVDA 2CHEA 3T7JA 1Y8AA 2GK6A 2G9RA 1S02A 1LW7A 1O8CA 1PL7A 2O50A 2XRYA 4KDFA 2ECKA 3HCOA 4IUDS 2DR3A 1EFHA 3GA7A 4IIFA 1J9ZA 4KN6A 2NXJA 4LV6A 4KDEA 4QASA 3HP4A 1DOZA 1WQ1R 4HVAA 4E4YA 1XC7A 4QVIA 5KKCA 1ECLA 2OFPA 2QQEA 3PR1A 2G1PA 3MLBA 2Q5JA 4LXGA 4YA6A 2NTJA 1W34A 3H4VA 1Z5ZA 4OSEA 1KFCB 3LLSA 1P9RA 4LYHA 2H1FA 4XIJA 3GJ8A 5E9QA 2RI0A 5A7GA 1THZA 2Q6VA 3V4ZA 5HBGA 3I34X 1E9BA 2QAGB 3TEFA 5EJ6A 4XWTA 3WWCA 1T5OA 3ED1A 1IN5A 3KYDA 2JG3A 1CVIA 3KXLA 2C04A 2PRYA 1U3VA 3MJFA 2QSJA 3EN0A 3R4CA