1IKCA

Nmr structure of alpha-bungarotoxin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
molecule tags Toxin
molecule keywords long neurotoxin 1
total genus 4
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ikcA00
2H64B 4LFTA 2H62D 2ABXA 2FD6U 2MJ0A 1L4WA 2H5FA 2QJBC 1QM7A 4AEAA 1RGJA 4OM5A 3PLCA 1IJCA 1PLOA 4HQPF 1IDGA 1FF4A 1RL5A 1TGXA 3HH7A 2H7ZB 1F94A 3VTSA 1BXPA 3BT2U 1LXGA 4BDTB 2MHYA 1KC4A 2CCXA 1IK8A 1CDTA 1CODA 1LX5B 3EBXA 3U74U 1CDRA 1CXOA 4FAOC 1JE9A 1IDLA 2UX2A 1KU6B 1ONJA 1XT3A 2HLQA 1COEA 4BIKB 1FSSB 1CVOA 1TXBA 1IQ9A 1CXNA 2X8BB 1DRSA 4RUDA 2MFAA 1NEAA 2QJAC 1TXAA 1FASA 2MUPA 2CDXA 1F8UB 2N99A 2PJYB 1NTNA 1FSCA 1KL8A 3FEVA 1ABTA 1CB9A 2K3GA 1IDIA 1KTZB 3NDSA 1LJZA 2MUOA 2OFSA 3EVSC 1NXBA 1HAJA 3KFDE 1CCQA 2CRTA 1KFHA 1CREA 4OM4A 1CTXA 4P7UA 1REWC 1KXIA 1KBAA 2HLRA 1JBDA 2ERAA 1KS6A 1ZADA 1TFSA 1LXHA 5DZ5A 1G6MA 1S4YA 4XJJA 1IKCA 2MJYA 1NYUA 1V6PA 2CRSA 1YWHA 2UWRA 2VLWA 2NBTA 3NEQA 2LA1A 4ZQYA 4QTIU 4DO8A 1QKEA 5EBXA 4FAOE 1CHVS 4UY2C 1CDSA 3ERAA 1I02A 3BT1U 5DO6A 1ERAA 1KBTA 1UG4A 3QB4B 2PJYC 3LAQU 3NH7A 1QKDA 3U73U 1VB0A 2BHIA 2L03A 1ERGA 6EBXA 1M9ZA 1HC9B 1H0JA 1BTEA 2QJ9C 2BTXA 2H7ZA 1LSIA 2L5SA 3KFDI 1HC9A 2GOOC 2QC1A 2MJ4A 4EY8B 1CDQA 1W6BA 2J8BA 1JGKA 1HOYA 2CTXA 2GOOB 1KBSA 1B41B 2H8UA 1IDHA 2H62C 2I9BE 2LCRA 4IYEA 1MR6A 2H64C 1NORA 1NYSA 2JVEA 1ES7B 5IMYC 1FFJA 2JQPA 1CRFA 1MAHF 5IMTD 5DU1A 1HAAA 1NTXA 1FRAA
chains in the Genus database with same CATH superfamily
2H64B 4LFTA 2H62D 2ABXA 2FD6U 2MJ0A 1L4WA 2H5FA 2QJBC 1QM7A 4AEAA 1RGJA 4OM5A 3PLCA 1IJCA 1PLOA 4HQPF 1IDGA 1FF4A 1RL5A 1TGXA 3HH7A 2H7ZB 1F94A 3VTSA 1BXPA 3BT2U 1LXGA 4BDTB 2MHYA 1KC4A 2CCXA 1IK8A 1CDTA 1CODA 1LX5B 3EBXA 3U74U 1CDRA 1CXOA 4FAOC 1JE9A 1IDLA 2UX2A 1KU6B 1ONJA 1XT3A 2HLQA 1COEA 4BIKB 1FSSB 1CVOA 1TXBA 1IQ9A 1CXNA 2X8BB 1DRSA 4RUDA 2MFAA 1NEAA 2QJAC 1TXAA 1FASA 2MUPA 2CDXA 1F8UB 2N99A 2PJYB 1NTNA 1FSCA 1KL8A 3FEVA 1ABTA 1CB9A 2K3GA 1IDIA 1KTZB 3NDSA 1LJZA 2MUOA 2OFSA 3EVSC 1NXBA 1HAJA 3KFDE 1CCQA 2CRTA 1KFHA 1CREA 4OM4A 1CTXA 4P7UA 1REWC 1KXIA 1KBAA 2HLRA 1JBDA 2ERAA 1KS6A 1ZADA 1TFSA 1LXHA 5DZ5A 1G6MA 1S4YA 4XJJA 1IKCA 2MJYA 1NYUA 1V6PA 2CRSA 1YWHA 2UWRA 2VLWA 2NBTA 3NEQA 2LA1A 4ZQYA 4QTIU 4DO8A 1QKEA 5EBXA 4FAOE 1CHVS 4UY2C 1CDSA 3ERAA 1I02A 3BT1U 5DO6A 1ERAA 1KBTA 1UG4A 3QB4B 2PJYC 3LAQU 3NH7A 1QKDA 3U73U 1VB0A 2BHIA 2L03A 1ERGA 6EBXA 1M9ZA 1HC9B 1H0JA 1BTEA 2QJ9C 2BTXA 2H7ZA 1LSIA 2L5SA 3KFDI 1HC9A 2GOOC 2QC1A 2MJ4A 4EY8B 1CDQA 1W6BA 2J8BA 1JGKA 1HOYA 2CTXA 2GOOB 4KSNA 1KBSA 1B41B 2H8UA 1IDHA 2H62C 2I9BE 2LCRA 4IYEA 1MR6A 2H64C 1NORA 1NYSA 2JVEA 1ES7B 5IMYC 1FFJA 2JQPA 1CRFA 1MAHF 5IMTD 5DU1A 1HAAA 1NTXA 1FRAA
chains in the Genus database with same CATH topology
2H64B 4LFTA 2H62D 2ABXA 2FD6U 2MJ0A 1L4WA 2H5FA 2QJBC 1QM7A 4AEAA 1RGJA 4OM5A 3PLCA 1IJCA 1PLOA 4HQPF 1IDGA 1FF4A 1RL5A 1TGXA 3HH7A 2H7ZB 1F94A 3VTSA 1BXPA 3BT2U 1LXGA 4BDTB 2MHYA 1KC4A 2CCXA 1IK8A 1CDTA 1CODA 1LX5B 3EBXA 3U74U 1CDRA 1CXOA 4FAOC 1JE9A 1IDLA 2UX2A 1KU6B 1ONJA 1XT3A 2HLQA 1COEA 4BIKB 1FSSB 1CVOA 1TXBA 1IQ9A 1CXNA 2X8BB 1DRSA 4RUDA 2MFAA 1NEAA 2QJAC 1TXAA 1FASA 2MUPA 2CDXA 1F8UB 2N99A 2PJYB 1NTNA 1FSCA 1KL8A 3FEVA 1ABTA 1CB9A 2K3GA 1IDIA 1KTZB 3NDSA 1LJZA 2MUOA 2OFSA 3EVSC 1NXBA 1HAJA 3KFDE 1CCQA 2CRTA 1KFHA 1CREA 4OM4A 1CTXA 4P7UA 1REWC 1KXIA 1KBAA 2HLRA 1JBDA 2ERAA 1KS6A 1ZADA 1TFSA 1LXHA 5DZ5A 1G6MA 1S4YA 4XJJA 1IKCA 2MJYA 1NYUA 1V6PA 2CRSA 1YWHA 2UWRA 2VLWA 2NBTA 3NEQA 2LA1A 4ZQYA 4QTIU 4DO8A 1QKEA 5EBXA 4FAOE 1CHVS 4UY2C 1CDSA 3ERAA 1I02A 3BT1U 5DO6A 1ERAA 1KBTA 1UG4A 3QB4B 2PJYC 3LAQU 3NH7A 1QKDA 3U73U 1VB0A 2BHIA 2L03A 1ERGA 6EBXA 1M9ZA 1HC9B 1H0JA 1BTEA 2QJ9C 2BTXA 2H7ZA 1LSIA 2L5SA 3KFDI 1HC9A 2GOOC 2QC1A 2MJ4A 4EY8B 1CDQA 1W6BA 2J8BA 1JGKA 1HOYA 2CTXA 2GOOB 4KSNA 1KBSA 1B41B 2H8UA 1IDHA 2H62C 2I9BE 2LCRA 4IYEA 1MR6A 2H64C 1NORA 1NYSA 2JVEA 1ES7B 5IMYC 1FFJA 2JQPA 1CRFA 1MAHF 5IMTD 5DU1A 1HAAA 1NTXA 1FRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H64 B;  4LFT A;  2H62 D;  2ABX A;  2FD6 U;  2MJ0 A;  1L4W A;  2H5F A;  2QJB C;  1QM7 A;  4AEA A;  1RGJ A;  4OM5 A;  3PLC A;  1IJC A;  1PLO A;  4HQP F;  1IDG A;  1FF4 A;  1RL5 A;  1TGX A;  3HH7 A;  2H7Z B;  1F94 A;  3VTS A;  1BXP A;  3BT2 U;  1LXG A;  4BDT B;  2MHY A;  1KC4 A;  2CCX A;  1IK8 A;  1CDT A;  1COD A;  1LX5 B;  3EBX A;  3U74 U;  1CDR A;  1CXO A;  4FAO C;  1JE9 A;  1IDL A;  2UX2 A;  1KU6 B;  1ONJ A;  1XT3 A;  2HLQ A;  1COE A;  4BIK B;  1FSS B;  1CVO A;  1TXB A;  1IQ9 A;  1CXN A;  2X8B B;  1DRS A;  4RUD A;  2MFA A;  1NEA A;  2QJA C;  1TXA A;  1FAS A;  2MUP A;  2CDX A;  1F8U B;  2N99 A;  2PJY B;  1NTN A;  1FSC A;  1KL8 A;  3FEV A;  1ABT A;  1CB9 A;  2K3G A;  1IDI A;  1KTZ B;  3NDS A;  1LJZ A;  2MUO A;  2OFS A;  3EVS C;  1NXB A;  1HAJ A;  3KFD E;  1CCQ A;  2CRT A;  1KFH A;  1CRE A;  4OM4 A;  1CTX A;  4P7U A;  1REW C;  1KXI A;  1KBA A;  2HLR A;  1JBD A;  2ERA A;  1KS6 A;  1ZAD A;  1TFS A;  1LXH A;  5DZ5 A;  1G6M A;  1S4Y A;  4XJJ A;  1IKC A;  2MJY A;  1NYU A;  1V6P A;  2CRS A;  1YWH A;  2UWR A;  2VLW A;  2NBT A;  3NEQ A;  2LA1 A;  4ZQY A;  4QTI U;  4DO8 A;  1QKE A;  5EBX A;  4FAO E;  1CHV S;  4UY2 C;  1CDS A;  3ERA A;  1I02 A;  3BT1 U;  5DO6 A;  1ERA A;  1KBT A;  1UG4 A;  3QB4 B;  2PJY C;  3LAQ U;  3NH7 A;  1QKD A;  3U73 U;  1VB0 A;  2BHI A;  2L03 A;  1ERG A;  6EBX A;  1M9Z A;  1HC9 B;  1H0J A;  1BTE A;  2QJ9 C;  2BTX A;  2H7Z A;  1LSI A;  2L5S A;  3KFD I;  1HC9 A;  2GOO C;  2QC1 A;  2MJ4 A;  4EY8 B;  1CDQ A;  1W6B A;  2J8B A;  1JGK A;  1HOY A;  2CTX A;  2GOO B;  1KBS A;  1B41 B;  2H8U A;  1IDH A;  2H62 C;  2I9B E;  2LCR A;  4IYE A;  1MR6 A;  2H64 C;  1NOR A;  1NYS A;  2JVE A;  1ES7 B;  5IMY C;  1FFJ A;  2JQP A;  1CRF A;  1MAH F;  5IMT D;  5DU1 A;  1HAA A;  1NTX A;  1FRA A; 
#chains in the Genus database with same CATH topology
 2H64 B;  4LFT A;  2H62 D;  2ABX A;  2FD6 U;  2MJ0 A;  1L4W A;  2H5F A;  2QJB C;  1QM7 A;  4AEA A;  1RGJ A;  4OM5 A;  3PLC A;  1IJC A;  1PLO A;  4HQP F;  1IDG A;  1FF4 A;  1RL5 A;  1TGX A;  3HH7 A;  2H7Z B;  1F94 A;  3VTS A;  1BXP A;  3BT2 U;  1LXG A;  4BDT B;  2MHY A;  1KC4 A;  2CCX A;  1IK8 A;  1CDT A;  1COD A;  1LX5 B;  3EBX A;  3U74 U;  1CDR A;  1CXO A;  4FAO C;  1JE9 A;  1IDL A;  2UX2 A;  1KU6 B;  1ONJ A;  1XT3 A;  2HLQ A;  1COE A;  4BIK B;  1FSS B;  1CVO A;  1TXB A;  1IQ9 A;  1CXN A;  2X8B B;  1DRS A;  4RUD A;  2MFA A;  1NEA A;  2QJA C;  1TXA A;  1FAS A;  2MUP A;  2CDX A;  1F8U B;  2N99 A;  2PJY B;  1NTN A;  1FSC A;  1KL8 A;  3FEV A;  1ABT A;  1CB9 A;  2K3G A;  1IDI A;  1KTZ B;  3NDS A;  1LJZ A;  2MUO A;  2OFS A;  3EVS C;  1NXB A;  1HAJ A;  3KFD E;  1CCQ A;  2CRT A;  1KFH A;  1CRE A;  4OM4 A;  1CTX A;  4P7U A;  1REW C;  1KXI A;  1KBA A;  2HLR A;  1JBD A;  2ERA A;  1KS6 A;  1ZAD A;  1TFS A;  1LXH A;  5DZ5 A;  1G6M A;  1S4Y A;  4XJJ A;  1IKC A;  2MJY A;  1NYU A;  1V6P A;  2CRS A;  1YWH A;  2UWR A;  2VLW A;  2NBT A;  3NEQ A;  2LA1 A;  4ZQY A;  4QTI U;  4DO8 A;  1QKE A;  5EBX A;  4FAO E;  1CHV S;  4UY2 C;  1CDS A;  3ERA A;  1I02 A;  3BT1 U;  5DO6 A;  1ERA A;  1KBT A;  1UG4 A;  3QB4 B;  2PJY C;  3LAQ U;  3NH7 A;  1QKD A;  3U73 U;  1VB0 A;  2BHI A;  2L03 A;  1ERG A;  6EBX A;  1M9Z A;  1HC9 B;  1H0J A;  1BTE A;  2QJ9 C;  2BTX A;  2H7Z A;  1LSI A;  2L5S A;  3KFD I;  1HC9 A;  2GOO C;  2QC1 A;  2MJ4 A;  4EY8 B;  1CDQ A;  1W6B A;  2J8B A;  1JGK A;  1HOY A;  2CTX A;  2GOO B;  4KSN A;  1KBS A;  1B41 B;  2H8U A;  1IDH A;  2H62 C;  2I9B E;  2LCR A;  4IYE A;  1MR6 A;  2H64 C;  1NOR A;  1NYS A;  2JVE A;  1ES7 B;  5IMY C;  1FFJ A;  2JQP A;  1CRF A;  1MAH F;  5IMT D;  5DU1 A;  1HAA A;  1NTX A;  1FRA A; 
#chains in the Genus database with same CATH homology
 2H64 B;  4LFT A;  2H62 D;  2ABX A;  2FD6 U;  2MJ0 A;  1L4W A;  2H5F A;  2QJB C;  1QM7 A;  4AEA A;  1RGJ A;  4OM5 A;  3PLC A;  1IJC A;  1PLO A;  4HQP F;  1IDG A;  1FF4 A;  1RL5 A;  1TGX A;  3HH7 A;  2H7Z B;  1F94 A;  3VTS A;  1BXP A;  3BT2 U;  1LXG A;  4BDT B;  2MHY A;  1KC4 A;  2CCX A;  1IK8 A;  1CDT A;  1COD A;  1LX5 B;  3EBX A;  3U74 U;  1CDR A;  1CXO A;  4FAO C;  1JE9 A;  1IDL A;  2UX2 A;  1KU6 B;  1ONJ A;  1XT3 A;  2HLQ A;  1COE A;  4BIK B;  1FSS B;  1CVO A;  1TXB A;  1IQ9 A;  1CXN A;  2X8B B;  1DRS A;  4RUD A;  2MFA A;  1NEA A;  2QJA C;  1TXA A;  1FAS A;  2MUP A;  2CDX A;  1F8U B;  2N99 A;  2PJY B;  1NTN A;  1FSC A;  1KL8 A;  3FEV A;  1ABT A;  1CB9 A;  2K3G A;  1IDI A;  1KTZ B;  3NDS A;  1LJZ A;  2MUO A;  2OFS A;  3EVS C;  1NXB A;  1HAJ A;  3KFD E;  1CCQ A;  2CRT A;  1KFH A;  1CRE A;  4OM4 A;  1CTX A;  4P7U A;  1REW C;  1KXI A;  1KBA A;  2HLR A;  1JBD A;  2ERA A;  1KS6 A;  1ZAD A;  1TFS A;  1LXH A;  5DZ5 A;  1G6M A;  1S4Y A;  4XJJ A;  1IKC A;  2MJY A;  1NYU A;  1V6P A;  2CRS A;  1YWH A;  2UWR A;  2VLW A;  2NBT A;  3NEQ A;  2LA1 A;  4ZQY A;  4QTI U;  4DO8 A;  1QKE A;  5EBX A;  4FAO E;  1CHV S;  4UY2 C;  1CDS A;  3ERA A;  1I02 A;  3BT1 U;  5DO6 A;  1ERA A;  1KBT A;  1UG4 A;  3QB4 B;  2PJY C;  3LAQ U;  3NH7 A;  1QKD A;  3U73 U;  1VB0 A;  2BHI A;  2L03 A;  1ERG A;  6EBX A;  1M9Z A;  1HC9 B;  1H0J A;  1BTE A;  2QJ9 C;  2BTX A;  2H7Z A;  1LSI A;  2L5S A;  3KFD I;  1HC9 A;  2GOO C;  2QC1 A;  2MJ4 A;  4EY8 B;  1CDQ A;  1W6B A;  2J8B A;  1JGK A;  1HOY A;  2CTX A;  2GOO B;  4KSN A;  1KBS A;  1B41 B;  2H8U A;  1IDH A;  2H62 C;  2I9B E;  2LCR A;  4IYE A;  1MR6 A;  2H64 C;  1NOR A;  1NYS A;  2JVE A;  1ES7 B;  5IMY C;  1FFJ A;  2JQP A;  1CRF A;  1MAH F;  5IMT D;  5DU1 A;  1HAA A;  1NTX A;  1FRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...