1ILFA

Nmr structure of apo cbfb
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
141
structure length
141
Chain Sequence
b'MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQQEDALAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORE-BINDING FACTOR
publication title Structure and backbone dynamics of Apo-CBFbeta in solution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 22
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2001-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.250.10 Mainly Beta Beta Barrel Polyomavirus Enhancer Binding Protein 2; Chain: A; Core binding factor, beta subunit 1ilfA00
1ILFA 3WTVB 3WTXB 4N9F0 2JHBA 3WTYB 1CL3A 1E50B 3WTTB 3WTWB 3WTUB 1H9DB 1IO4D 3WTSB
chains in the Genus database with same CATH superfamily
1ILFA 3WTVB 3WTXB 4N9F0 2JHBA 3WTYB 1CL3A 1E50B 3WTTB 3WTWB 3WTUB 1H9DB 1IO4D 3WTSB
chains in the Genus database with same CATH topology
1ILFA 3WTVB 3WTXB 4N9F0 2JHBA 3WTYB 1CL3A 1E50B 3WTTB 3WTWB 3WTUB 1H9DB 1IO4D 3WTSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ILF A;  3WTV B;  3WTX B;  4N9F 0;  2JHB A;  3WTY B;  1CL3 A;  1E50 B;  3WTT B;  3WTW B;  3WTU B;  1H9D B;  1IO4 D;  3WTS B; 
#chains in the Genus database with same CATH topology
 1ILF A;  3WTV B;  3WTX B;  4N9F 0;  2JHB A;  3WTY B;  1CL3 A;  1E50 B;  3WTT B;  3WTW B;  3WTU B;  1H9D B;  1IO4 D;  3WTS B; 
#chains in the Genus database with same CATH homology
 1ILF A;  3WTV B;  3WTX B;  4N9F 0;  2JHB A;  3WTY B;  1CL3 A;  1E50 B;  3WTT B;  3WTW B;  3WTU B;  1H9D B;  1IO4 D;  3WTS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...