1ILYA

Solution structure of ribosomal protein l18 of thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
b'RLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGGLEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN L18
publication title The solution structure of ribosomal protein L18 from Thermus thermophilus reveals a conserved RNA-binding fold.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2001-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1ilyA00
1KD1O 1K9MO 1OVYA 3DLLL 1VQ6N 1K73O 2QEXN 3PIOL 1M1KO 5HL7L 3PIPL 1YI2N 1K8AO 3CCEN 1Q7YO 1KC8O 3CC2N 2OTLN 3CMAN 3CMEN 3G6EN 1Q81O 5GAHP 3CCLN 1KQSM 4WFBL 4IOCL 3G71N 1Q86O 1VQKN 1VQ5N 3CCSN 3CCJN 1VQMN 3CCUN 2QA4N 1QVFM 1YHQN 3CCQN 1YJNN 3CCRN 4WFAL 5JVGL 4WFNL 4WCEL 4IOAL 1ILYA 1VQ4N 3CXCM 3OW2M 1VQ7N 3J7ZO 1M90O 5GAEP 1JJ2M 5DM6L 5H1SQ 1YIJN 1NJIO 5MLCQ 3G4SN 1VQ9N 1VQON 5JVHL 3CF5L 3CPWM 1VQ8N 2ZJPL 3CCMN 3CD6N 2OTJN 1S72N 1N8RO 1VQNN 5GADP 3I56N 1YJ9N 3CC7N 3CCVN 1VQLN 1W2BM 4UY8O 1YJWN 2ZJRL 4WF9L 3CC4N 1VQPN 3I55N 1YITN 1Q82O 5DM7L 2ZJQL 5GAGP 4IO9L 1QVGM 4U67L
chains in the Genus database with same CATH superfamily
3S9HA 1IBMK 3ZEUA 5LJVA 3SAHA 4CECA 3ZEUB 4CIFA 2OANA 4ID1A 3ZT1A 1HNVA 1YAGA 1KLNA 3O9TA 4MLHA 3MN9A 1WSIA 3RRGA 3TAGA 4JRPA 4GY2B 4GNIA 1Q7YO 4U7BA 3O9SA 1VSIA 3V81A 1ZBFA 1QQOA 1RCHA 3BP8A 4CZMA 3OBYA 3AARA 4CEDA 3K59A 3T1HK 1UOCA 3D45A 3MWTA 4Z4CA 3MDQA 4FPAA 2A1RA 4CFCA 3CFRA 3OYIA 2A5XA 3MN6A 5AQXA 2Q0UA 4DR5K 3VESA 1C0FA 2VWJA 4JK8A 1CXUA 1LW2A 1HNIA 2OZSA 2ZE2A 3ZETB 4O44A 4WFAL 2I7PA 3CJAA 3J81O 2P9IB 2HBMA 1KLMA 3OYBA 5TKYA 3I0RA 1NGJA 1REVA 5AZIA 2D5RA 3NGYA 3HVRA 3MEEA 5AZIB 3B6PA 4JI4K 2IAJA 1YIJN 5AQKA 1IKXA 4BWMA 3ZX2A 1VSEA 3H45C 2JWLA 4KB0A 4M3ZA 4V19S 4CJRA 4BRHA 4FWMA 3O80A 1I39A 4FCYA 3HP9A 3SBGA 4LSLA 3TPQA 2V52B 4FK0A 3DRRA 4BRGA 1BIUA 5CZ2A 3AA3A 5KGWA 1EX4A 5J1EA 1A5VA 2NRRA 2GUPA 4CHZA 2PYJA 3L4IA 4E0DA 3AO5A 1MDUB 3QBXA 5HRNA 4DCHA 1RDCA 3V9XA 2RHKA 2Z1HA 4DSKA 1NBWA 4H5VA 2FBXA 2VWBA 2GV9A 3CM5A 3FGUA 3CQXA 3CQYA 1KD1O 4O8UA 4M3TA 4FJGA 1K9MO 1HX1A 1ZXOA 3IDHA 1BOTO 1GLAG 2QWMA 4BDPA 2VGNA 2FC0A 4LF8K 3TAFA 2FBYA 5HRPA 4A61A 4ILGB 1BQMA 4IJNA 1JKHA 1C0GA 2P5GA 4FJKA 1FJGK 5EXWA 4IWVA 3ZT4A 3HJFA 1D8YA 3NGZA 2YNFA 1C6VA 3SCXA 3CMAN 3O9QA 3PX4A 2HSTA 2KLAA 2F96A 4O8KA 4B3MK 1KVBA 4JI7K 4HHTA 2ZM6K 2R7YA 4EP4A 3KTQA 3A8YA 1NJZA 4DUYK 2FSNA 2KHOA 2YNHA 3LDQA 4JKFA 4M7YA 2QXFA 3TWHA 3H3OB 1XQSC 3V1OA 3SMSA 5J2PA 4KHWA 4W5TA 4DQRA 4AH9A 1Y64A 4ISEA 4B8AB 1HNZK 4KB1A 4BE1A 1HKCA 4BRQA 4E89A 2IGIA 3KVGA 4ILJA 3ULDA 3SUQA 4B9QA 3C7NA 3HTVA 3CCMN 3ZX3A 1S72N 3C7NB 5GADP 4BVOA 1NGIA 2HB5A 4H4MA 1WSGA 4E1JA 3OJSA 3FE1A 3RTVA 4UY8O 1YJWN 3AVIA 4E7JA 1IBKK 3GBTA 4JD2B 2XY5A 4L3QA 1MU2A 3L6QA 4DLEA 4XH1A 4JS5A 4K41A 3C94A 4HUFA 4OPAA 3AA5X 5C0YA 2P9KB 3C6AA 3FZHA 2BE2A 3QFPA 3ENBA 4I2PA 3BUZB 2UXCK 2VG7A 4LD0A 4PKGA 4N76A 2X6NA 4CCHA 1F21A 1B92A 1XC9A 3KLHA 3H6EA 4GVEA 4DV6K 4J2DA 1VHXA 2ZD1A 4BY9C 3DOKA 1MWMA 3IMXA 4O0IA 4B9NA 4K0KK 5JLHA 3W3DA 1KC8O 1ZBUA 2JGUA 4M3XA 4FWSA 3LWLA 3DLBA 3VEYA 5AQWA 4BRMA 5KPZA 3S3OA 3G6EN 5IT9O 4DSIA 1JLFA 2E20A 3AVBA 3F2KA 3SBTA 3J7AP 3NH0A 3BY5A 4BRNA 2G8VA 2QKBA 3PLAA 2O8EA 2WTUA 1VSHA 5AQNA 4HCBA 1FXXA 2O8EB 2Y1JA 2W40A 1JLEA 3MX5A 4BDYA 4BQZA 1VRTA 2QW9A 2BH1A 3NF6A 4C1NK 3VGMA 4WCEL 4M41A 1HYZA 3MECA 4B1UB 3KLIA 3JXUA 4W5NA 4IEIA 1JXEA 3ZSOA 1IKWA 3L4QA 5CR4A 3NF7A 4H03B 4FLVA 1DT9A 1RT2A 3DLRA 5F1XA 1S1TA 3LZJA 4DQQA 4CJUA 1RBTA 4MDAA 3CJCA 3LDSA 4A57A 5LMUK 3SYZA 2QXLA 1XMQK 1IG9A 3K5LA 4OO1J 2P1JA 2QM1A 5GIPA 3Q7BA 3EN9A 1SKSA 3E9LA 3GL1A 4DQ8A 4BR0A 4CJFA 1DGKN 3A5LC 4AHCA 3VQBA 3JYTA 1C1AA 3IS9A 1D9FA 4FLUA 2WBNA 3E9OA 2DFEA 1EO1A 1IJJA 5AR0A 4DTUA 4Q0BA 4BC4A 2D4WA 1NGGA 3MEGA 1OH7A 3FFIA 4CJLA 3SJHA 4DV1K 3IFRA 1S22A 3T7ZA 4B9SA 1M1KO 1BU6O 4DFJA 3KD5E 4F2RA 2BDPA 5HL7L 1HJOA 2P9PA 1YI2N 5BR8K 2O4IA 1N32K 2P9PB 4E3SA 1SKRA 2QWLA 5BPLA 4CJTA 5AQZA 2HHXA 1DLOA 4M3UA 2DFFA 4YY3K 4TSXA 3L2WA 3CCLN 2OPRA 2YNGA 1YF5L 3R9PA 2PZSA 3RMBA 1RNHA 3PUFA 1KAZA 4ISFA 3CCSN 3QNNA 4MO4A 4CEZA 3C0BA 2UUBK 2E8AA 3SJJA 4H0PA 2YJEA 3NVMA 4OPKA 2WFBA 4B1YB 1NGBA 4B3SK 1X3MA 1XHZA 4EFHA 3SQ1A 1A5WA 3DAWA 4WE1A 1UAXA 3M8RA 4FJJA 3M1FA 1ZBIA 4FJ8A 4NCAA 4Z94A 1VQON 2HHVA 1SUQA 4F2SA 4FL9A 3QEPA 3KWIA 2HOEA 4BROA 3NH1A 2CGKA 5BPNA 2JWKA 1H1VA 4CI6A 3PO5A 3CPWM 3VTHA 2QK9A 4DKWA 3HSTB 4CEOA 3O1WA 2HHTA 4BRIA 3CD6N 2KKZA 3OBWA 2O8CB 3ZT2A 1CZAN 3TANA 3N4QA 2VG6A 4YOVA 1JLBA 1I3AA 3LP0A 2E6LA 1KVCA 2UXBK 3OTOK 1VQLN 2ZJRL 3B6OA 4IJAA 4A5AA 4CF9A 3RWUA 3KWGA 4O55A 3O4WA 5C2FA 1KAYA 1T6DA 5HBMA 4C8OA 3C65A 4BWJA 1YTUA 3FR0A 4F9OA 5HROA 3QIOA 5GAGP 1NK7A 1BG3A 5EVZA 4IXCA 4EP5A 4IEEA 1GLCG 3CJ9A 3QO9A 3D0PA 1TK0A 1T7PA 1Q9XA 3PY8A 1NK9A 3HOSA 2OZMA 2IVPA 1BUPA 4EZ6A 4H0TB 4X64K 4CZKA 4C8KA 1DTTA 1TV6A 3HM8A 2Q0RA 3PO4A 2CGLA 3VETA 4WFBL 4J2AA 1YTAA 1HPZA 4H0YB 4EHTA 2A41A 1VQ5N 1BL3A 3ASMA 3AV9A 4JKEA 3HM9A 4PHTX 3L3UA 3CCQN 1OH5A 3RR7A 2J4RA 1YVUA 2V51B 3U4LA 3CJ7A 3CQ8A 1EP4A 3QDKA 2W6LA 4X65K 4ZTJA 3AVJA 1S6PA 3D6RA 1NM1A 2IDOA 3IAYA 1G15A 3MEDA 3NAEA 5AFUA 3D2EA 4BRLA 1JL1A 4R79A 4BG9A 2ZF5O 4FPBA 1JLAA 1TVRA 3F73A 4E7KA 5AQQA 1OH8A 1BWFO 3T69A 2I5JA 2HHUA 1RDUA 3OYCA 1MWKA 3H08A 5E26A 3K5NA 1NGCA 3I56N 2HBLA 4DSJA 1IKVA 2DPNA 2FF3B 1YVNA 4DTOA 3THVA 5FDLA 4KH4A 2NRZA 4WF9L 1J5EK 1DTQA 5HRRA 5BRHA 5FRNA 4J2BA 4JKGB 1UA1A 4IZ9A 3IG1A 4H0XB 3I8BA 4DTMA 3CFPA 4DSEA 3V6DA 2BUPA 3WT0A 1QTMA 2QWQA 3VENA 2XO7A 3MX2A 1L3TA 1D4XA 5DMRA 4DS4A 3O4NA 5TKWA 4BR4A 3NF8A 5EOYA 3PIPL 4DUZK 5J2NA 3OYJA 3CCEN 4DU4A 3T1AA 1TK8A 1XC3A 3CI5A 1HKGA 2P51A 4O5FA 1FKOA 1WAJA 2V7YA 4I9LA 1O13A 3VQ8A 2YHYA 1KFDA 5B8HA 1QSLA 3WEEA 3EKUA 1KVAA 1VSLA 4DMNA 4WYBA 4LF9K 2Q1NA 4K42A 4IOCL 4NO7A 1Q86O 1WSJA 4DV0K 3SQ0A 3AVNA 4FVMA 2NLXA 1NKBA 3K2PA 3CCUN 3J8AA 4CESA 3LAKA 1E4FT 4OPHA 4CVNE 3KKRA 2RE2A 5LY3A 3MAQA 4DWIA 3C6TA 1YUWA 2ATQA 4CEEA 1L5UA 4NXMK 3ISNC 3ATVA 4ILHA 3O9UA 3DRPA 4CJVA 1N5YA 3ZSRA 3K0SA 5CZ1A 4YOXA 4Z4HA 4B8CA 5F0XA 4JI6K 4CZIA 4YOWA 4B3TK 2ZWHA 5KRTA 1HYSA 1T03A 1RT7A 1V4SA 2D1KA 3CJ1A 4FWPA 4DQPA 2YNIA 2A3ZA 4CIEA 1VSMA 4AM6A 1HLUA 2D0PA 3OYFA 1NGAA 3P38A 4DHYA 3QIPA 5A2QO 2XHBA 2Q97A 3AGKA 1N33K 4CGIA 4FJMA 4DTNA 3U6FA 4FK4A 1TAQA 2W6KA 4QAGA 1ATNA 1CZ9A 1VAZA 4CGJA 4DFPA 3ZSYA 4E1NA 5LJWA 3FFKB 1TKDA 3PSFA 4CD3A 3TI0A 3ZSVA 3K5MA 2O4GA 2OYQA 2X74A 1OVYA 1BO5O 4EHUA 1QQCA 1T05A 4JI0K 3L8BA 1Z25A 1U48A 3CFOA 3VQ4A 1G99A 3T19A 4XH5A 4FM0A 3JS6A 3LPTA 4KTWA 4CGGA 2GBZA 2OA8A 2NRTA 2FBVA 5ADXH 4RWTA 2QTDA 3GE1A 3VF2A 5GAHP 1NKEA 1QQMA 3IRXA 2VQFK 4LY7A 4FZXC 3IUCA 2F9TA 1BCOA 3QEVA 4BRKA 5FPEA 3UB5A 3KZBA 3A2FA 1LV5A 4M63C 3EE8A 4CJSA 1S1VA 4CBUA 3AGRA 3CJBA 3OY9A 1LW0A 3P5JA 2G8KA 1JJ2M 5BN9A 1NJIO 4LFAK 3J7YP 3GDQA 3DM2A 5JVHL 4B1WB 4BGBA 4OPJA 3VEVA 5C10A 3PSIA 2YCHA 1RGIA 4LF6K 2ZJPL 3JAMO 2W41A 5HRSA 4Z4EA 4JKBA 5KPRA 1HYVA 5CY4A 2ASOA 3NFAA 4CJ4A 4IKFA 4JI2K 4DV3K 1NMNA 3CM6A 2YHBA 3U3GA 2GTDA 1R0AA 1C1BA 1TL1A 1A5XA 2A1SA 5DM7L 4BRAA 4M7XA 3ALYA 2G8HA 4Z4FA 3DLEA 3A5OC 4RG8A 1FW6A 1Z05A 4KBOA 3VQDA 3SPYA 2Q2RA 4M45A 2F9WA 3DLLL 1IV0A 1NK5A 3B8AX 4KFBA 2OPQA 1JLCA 5AQMA 4HVJA 2F8SA 1WB9A 5M1OA 4BRFA 3R8EA 4DS5A 1X9MA 1IBLK 4C1NI 2FLOA 4H5RA 4FJNA 4DSLA 3O6WA 4WQ4C 5KPTA 5J2MA 4H0VB 4CFBA 1GOBA 4XH4A 3CC2N 4AHUA 1TYQA 4KAZA 1GLEG 3VERA 3KD1E 3O08A 1EETA 3VMFB 3A5NC 2ZGYA 1U45A 4N5SA 3MWPA 3VQ5A 4JI1K 1NK4A 1NNEA 1RT6A 3TU5A 3VEXA 2G8IA 1YHQN 3RR8A 1KCFA 4B9MA 5KI6A 1LCUA 1WBDA 3VF6A 4CJ7A 4MO5A 3TTCA 4FJHA 4JEPA 2UXDK 2HW3A 3BZCA 3HPHA 2AP1A 3KKSA 3RRHA 2Q31A 4DR1K 2DY4A 4I6MA 3ID8A 4IDHA 4HUEA 2QKKA 2UU9K 4G9ZA 3G4SN 4B1ZA 1W0HA 1VQ9N 4IOXA 3CHWA 4W5QA 3CF5L 1N34K 4B9VA 1XWLA 1Z26A 3MCPA 4FWLA 4BRDA 4CZJA 4CZHA 3HP6A 3SV4A 3MCAB 5EU7A 5AZJA 4KI6A 2WC9A 1C0UA 2ITMA 3WNHA 5JS2A 5AZJB 3HVTA 1LAVA 3F9KA 1ZC6A 4BREA 4AM7A 3DLGA 1RT5A 1EXQA 2QWNA 3HXMA 2G8FA 1HNWK 3THYA 4A62A 5AQLA 4FZZA 1HQUA 3KLEA 1P8ZA 3OS2A 3THYB 2A42A 1U49A 4CJWA 4MLEA 4IO9L 2E5LK 4FLXA 5EX5A 3AO1A 4AQYK 1VQ6N 3OVNA 5BREA 4OKJA 4JKDA 4DV7K 4K8ZA 1DKGD 3TAMA 2BGGA 1GLDG 4CJ5A 1NG9A 2CH5A 4FXDA 2E1ZA 1CLQA 3CYMA 1BA1A 3EZ5A 5KRSA 3PV8A 2UUAK 1K6YA 1VSKA 3LANA 3C6UA 1EKEA 4CEAA 1NGHA 3BF3A 5KGXA 2RN2A 1Q81O 2VG5A 1KQSM 3SK3A 3WNGA 3M5RA 1X9WA 1VQKN 3AVAA 1QE1A 1BIZA 3G10A 3MMVA 4ELVA 2H3GX 4BDZA 3VQEA 1KAXA 1ZBHA 2XRIA 4FM1A 1W97L 4OLAA 3AVMA 1E4GT 3NMUA 3ITHA 5K14A 2VGMA 4BRCA 5FPDA 1SV5A 1SL1A 3EE9A 1ESVA 3MXJA 4FJ7A 1RILA 5C24A 4QOZB 4DG1A 3ENHA 1WBBA 2IIRA 4BR5A 3DXKA 2JLEA 2P9LA 2Z1JA 3V9WA 2QWOA 4ICLA 2ASMA 4A59A 2KFZA 5AQRA 3QICA 4I9QA 1VSFA 3SAGA 3ZCMA 3LAMA 4CHNA 1HQEA 5E84A 1J6ZA 3P39A 1N8RO 4BGAA 4FLTA 3TSPA 1XMOK 3LM2A 1YJ9N 3D2FA 4AILC 5SZTA 3ZT3A 4KHUA 4ELUA 5GINA 4O5BA 4R5PA 3EYZA 1L3UA 4PKIA 3VGKA 1TKZA 4DFKA 3QNOA 1VQPN 2UYTA 3KK7A 1T6CA 1WSFA 1YITN 4UQGA 4H5NA 3ZLJA 2E1YA 3A5MC 1Q82O 4B1XB 4A2AA 4ZTFA 1K8KA 3ZSZA 4JI3K 1K8KB 3LL3A 3OYGA 2E2NA 2VYPA 4NLCA 3WQUA 3OYMA 4CZFA 3DWLA 4CBXA 2P9SA 3AO3A 3HK2A 5J2QA 1NOYA 2HMPA 2P9SB 3LDOA 3EL2A 2AA4A 2ZQBA 3QLHA 4JRQA 1Y97A 1HJRA 4W5OA 3I33A 3NBPA 4FWOA 5LL6Z 5C2DA 4JV5K 1ASWA 3RMDA 3OYAA 4A5BA 4CW7B 1RTDA 4IFVA 1TK5A 3S3NA 1KSPA 2HNZA 4PL8A 3R1XA 3NHGA 4IFYA 5BRFA 1BISA 3AA2A 2O8FA 3R6MA 2KW4A 3TR8A 1NK6A 4JN4A 3QMLA 2O8FB 4O4GA 3QEIA 1ZBLA 1HRHA 3BZKA 3BDPA 3CCRN 3ENOA 4JKAA 5CHIA 4EZ9A 2FBTA 4WFNL 4LF4K 4I7FA 3TARA 1ILYA 3THWA 1NLVA 4B3RK 4CEQA 4CF0A 3THWB 2QI2A 1RDDA 4F3TA 1TGOA 3OYLA 3THXA 5CYQA 5M1FA 5MLCQ 1NJWA 3THXB 4CIGA 4HCCA 4CF8A 1QQNA 3SLCA 3AVCA 3QETA 5I42A 4LFCK 3FZFA 5AQJA 1JXBA 2OTJN 1U4BA 3U9DA 1WAFA 2IVOA 5ELZA 5AQPA 1BQNA 1W9HA 1C0MA 3NCIA 4DV5K 3KIOA 5AQUA 4WQ5A 4JKHA 1IH7A 3D2EB 4K25A 2E2QA 3DJCA 2HVIA 2W42A 1TAUA 1GLLO 4FWKA 5FLXO 5C42A 1JLQA 4H0OA 1XNQK 2NRWA 2YHXA 5IWAK 2AJQA 5C12A 4GW6A 1XHXA 1ITGA 1HNXK 4YHHK 1S1UA 4DQIA 3PX0A 4C8LA 1HUXA 5E41A 1B9DA 1HMVA 1SKWA 4NXNK 2O8BA 4MQ3A 3H1VX 4AHVA 3VEZA 4E7IA 3ZSXA 3AAPA 4QS8A 3O5BA 4CZLA 4FJIA 2IC3A 2CGJA 4GKJK 1S5JA 3ULEA 4N41A 3MK6A 4BR9A 2CH6A 2QWPA 4DR2K 2XY7A 4Z4GA 2A40A 1QHTA 4WQ4A 3O3FA 4FWQA 2GX9A 4LC9B 4M42A 4CD1A 4YDUC 4FOEA 3VA0A 5C25A 3GOIA 2X6SA 4FW2A 3WEEB 1Q18A 3GG4A 3HYFA 3LM9A 4DTXA 2BANA 1NK8A 4DQSA 1RTIA 4Y0WA 4KO0A 3LDPA 3KK2A 3CIPA 3SI6A 4BRPA 1ATRA 3AY9A 4RW6A 4RW8A 4FZYA 1LWEA 4BE2A 4FOIA 4CGFA 1GLJO 2OPSA 4B9UA 3L3VA 1MA9B 4IO8A 4Z4IA 4RW4A 3L2RA 4JNEA 4PQUA 2OPPA 5SWMA 1ASUA 2FXUA 1W2BM 4FK2A 3U8XA 4W5RA 1OH6A 4CGDA 1BI4A 1BI4B 4OGEA 1J5OA 1SS6A 3SUPA 3V9SA 3SNNA 4CERA 2GWJA 4PA1A 2F8TA 3VQPA 3VQAA 3V1QA 4BG8A 2EWSA 1LWFA 4F4KA 4LH4A 5HLFA 5F2RA 3S3MA 3ZETA 2HF3A 2D0AA 3KHYA 2RF2A 4B9LA 4DU3A 1L3VA 1Z6RA 4JI8K 4YOTA 3K9KA 3LZIA 2P9IA 1VSJA 1Q9YA 4OGCA 4H5WA 5AQVA 1XI1A 2XY8A 1S1XA 4PWDA 3LDNA 1SL2A 3OYDA 3T1YK 4RW7A 1U2VA 3F9MA 4LFBK 1D5AA 3G71N 1U2VB 4ZHRA 3DI6A 2GELA 3ATUA 2WOMA 1VSDA 1NU0A 1YT3A 3LPUA 2NUBA 3U9ZA 3ZSWA 1EWRA 3O8MA 1CXQA 2NRXA 2XY6A 3G25A 3AVGA 3VGLA 3TSUA 4JLHA 3E66A 2KTQA 1GOAA 1M90O 5GAEP 5FPMA 5AFUH 4DFMA 2E2OA 4J2EA 2IOCA 4DTPA 1S9GA 4QCLA 2Z1GA 4RTFD 1HR0K 1NJXA 1QHAA 5HOOA 4O0JA 4FJLA 1RT4A 4DSFA 2E2PA 3SZ2A 4BR2A 1OVQA 2BTFA 4OLBA 5AQGA 3UKUA 2PBDA 3HO1A 1RTHA 3V9ZA 3UKUB 1SZ2A 5M1NA 1RBRA 2P9NA 4CK2A 2P9NB 4Y1CA 1BA0A 4CF1A 4YOYA 2ETJA 3HL8A 3KLFA 3Q7CA 3N4PA 3H3NO 4FSVA 4BVPA 3KJVA 3ZSQA 2HHWA 5FROA 5KQ8A 4CHPA 3QFUA 1S3XA 4BE0A 4WQ5C 3QEWA 2HHHK 3HPGA 1V4TA 2E4LA 1ZYQA 4HUGA 3SPZA 4CEFA 2YJFA 2HNDA 3NE6A 4CHOA 3VQ6A 5CYMA 3OJUA 1NJYA 1SAZA 3EKSA 1GOCA 3CPEA 4M3YA 2QEXN 4QS7A 1WNSA 2V7ZA 3FLCO 2D0BA 2YX6A 1NKCA 4DR3K 3F5TA 4X62K 5AQHA 2KQ2A 4IFEA 4NYFA 5BPMA 3RMAA 4KHSA 1P90A 4JK9A 3AVKA 3AVLA 4OJRA 3WNFA 2PYLA 4DR4K 1LWCA 3HBTA 4H4OA 3ZYYX 1JCGA 1RTJA 4B08A 4FJ5A 2HNYA 3PX6A 4KREA 2Q36A 3DLHA 4A2BA 1SQKA 4CHQA 5M1PA 5M1KA 2Y1IA 4KPYA 1RDWX 5DK5A 2NRHA 2P9UA 3LP2A 1U6ZA 4CBWA 3SQ4A 2P9UB 3DRSA 3ZT0A 1VQ4N 1JCEA 1TYQB 3NF9A 3HZ6A 3M6GA 1BCMA 2YHWA 3TAPA 1KXPA 4DU1A 4AHSA 4JD2A 4BQLA 1ASVA 1OKJA 3UE5A 4PUOA 1DEJA 1NOZA 4OX9K 1UWBA 3RSEA 3FZLA 4ID5A 3R3LA 3FZKA 3RSEB 1KTQA 2ASPA 5M1QA 4FM2A 2P9KA 3VPZA 4ELTA 4B1VA 5LMNK 1NWKA 2PY5A 1RBVA 4BC2A 1J9AA 4CJEA 4B3OA 4E7HA 1QZ6A 3OYEA 4C23A 3QB0A 4K8XA 4AHRA 3K57A 2FSJA 4LF7K 4JI5K 4BACA 3VOVA 2I7NA 4CEBA 3CERA 4H8KA 1SL0A 1U04A 1HKBA 3RVCA 5I9EB 4I6MB 4DV4K 2HBJA 4M3RA 1B9FA 4JHDA 1NK0A 4DTJA 4JHDB 1ATSA 4FJ9A 2DTUA 3HT3A 4DF4A 4KRFA 4PL7A 3UIQA 4CFAA 4H5TA 1C0TA 4PKHA 1S9EA 4KHYA 2YI1A 4RCHA 1FK9A 1JL2A 1HPMA 3LWMA 3NDKA 5T7BA 4KKOA 5D3GA 4GV3A 2F7TA 3AO4A 4NLBA 3A0IX 3M8QA 4BR7A 3NGIA 1WN7A 2O8DA 3E1YA 2P5OA 4KTQA 4DV2K 2O8DB 2A6AA 1J53A 1X3NA 3CMEN 3DMJA 1X9SA 2ZGZA 3KLGA 3BEXA 2FF6A 3FZMA 1T44A 1QSYA 3VA3A 5AJ3K 3CG7A 1U47A 4JS4A 1BDGA 3MN5A 1VQMN 3BF1A 1O1WA 3QEXA 2KZMA 1IG8A 2HF4A 4FLWA 1QVFM 4NCBA 2Q3SA 2HMIA 2RKIA 3DLKA 3VQ9A 4FW1A 1EQYA 3NVKA 5JS1A 1BHLA 3OS0A 4DR7K 3HRGA 2PAVA 3AAQA 4KH6A 3L2VA 4IG0A 1UA0A 3C95A 4HWIA 1VQ7N 4F8RA 2LSNA 3J7ZO 4CJPA 4E7LA 3RMCA 4FYDA 4FWRA 5H1SQ 3TTDA 4IDKA 3SQ2A 2IS3A 2GUIA 4JKCA 4CGHA 4XIUA 3TABA 2WONA 4E19A 3TSQA 1RDAA 4K43A 3H1QA 5AQOA 1YXQA 3WXIA 1BGXT 4C8MA 5KQDA 4M3WA 3S41A 5KTQA 5AQSA 3HSCA 3VF4A 1QSSA 4YDUA 4LH5A 3MN7A 1QS4A 3CC7N 1Q8IA 3CC4N 2G8UA 3I8DA 3MXMA 1RDBA 3M8PA 3HOTA 3DXKB 2P9LB 5BN8A 3P1GA 3V1RA 1TUUA 3QBWA 5I3UA 3G0ZA 4OVLA 2UUCK 1NGFA 1KRPA 3VQQA 2HHSA 1WLJA 1R59O 3HI0A 4U67L 3SUNA 1WSHA 1IKYA 3MXIA 1X9JA 4NB4A 3M8SA 1K73O 3O3GA 2PFUA 4CZEA 3D2FB 1S1WA 2EHGA 5JLFA 3VTIA 5BR9A 4JK7A 2YKNA 4FVUA 4FJXA 3D7EO 1K8AO 1JCFA 4IBNA 2VQEK 4B9TA 2X78A 3AVFA 1N6QA 4I2QA 3LP1A 3OYHA 4KHQA 3UKRA 2OTLN 3QERA 3UKRB 4GVMA 4CJ3A 3EEQA 1CZBA 4LSNA 4L8RB 4RW9A 2GWKA 3M3ZA 3K9JA 5JMVA 3CCJN 4C8NA 4Q5VA 1TKTA 4AHTA 1NGEA 1T3VA 3EZWA 3BGRA 4KTZA 2QA4N 2NNWA 3L2QA 2OCEA 4N56A 4J8FA 5JVGL 2IVNA 3VQ7A 2EX3A 2O8CA 4IOAL 1J54A 1LAWA 1QZ5A 3QINA 3NH2A 1T8EA 3OS1A 4NYNA 3WXJA 1VK0A 3CXCM 3OW2M 1WSEA 1W7AA 2E6MA 1RT3A 4KH5A 4HTUA 1KFSA 1GLBG 3LALA 2D0CA 2YKMA 3QESA 2B4JA 4CZGA 4CHYA 5AQIA 1EWQA 3E9PA 3KK1A 1RFQA 3OYNA 4N47A 4XEIA 1TKXA 3O9RA 4ISGA 3JSMA 3O4QA 1TUYA 1XNRK 1XUPO 4GV9A 3WXKA 1VRUA 1NMDA 1L3SA 4EAHD 2G8WA 2HVHA 3WNEA 4YFUA 3DOLA 3O3HA 4FLZA 3V4IA 3OHRA 2KFNA 3I55N 1X1PA 4Y1DA 3DYAA 1NGDA 3C6HA 3H46O 2ZJQL 3J80O 4OKEA 4IG3A 5BRDA 3TAEA 4GV6A 1S6QA 2F4VK 3PIOL 4F3OA 3L2UA 3VQCA 5CE3A 1TL3A 3P4IA 3L0QA 2NRVA 4CFDA 1RBSA 3AVHA 4LF5K 3TTFA 3VEOA 5AQYA 1D9DA 2E88A 2RPIA 2KZZA 3DXMA 5EY4A 2B5JA 2Z1IA 2NZTA 1JLGA 4BC3A 3E01A 4GKKK 2FSKA 3DXMB 4OKKA 4YNQA 1RT1A 3P83D 4CF2A 2WUSA 4JAXA 3WQTA 5JICA 2YV0X 2D0OA 4DF8A 3ID6A 4KV8A 4QS9A 4CJQA 3EO3A 3AA4A 2VCPA 4CK3A 3T3FA 4FWNA 5ADXA 4YOUA 1C1CA 4DTSA 3LP3A 2B6AA 3TAQA 1E3MA 2YHAA 5C15A 3K58A 3SV3A 3O1BA 4YORA 3EY1A 1YJNN 4EIAA 3SUOA 4FO0A 2ITGA 3WUHA 4FLYA 5FRMA 3IKMA 4JYAK 3WXMB 4GMJB 4PY5A 2HHQA 4DLGA 3CETA 1RBUA 5DM6L 2GEMA 1GLFO 4MFBA 2O8BB 4E1MA 4CE9A 3SMPA 4Z0UA 4CJKA 3HPOA 3VEWA 4JKGA 2DFHA 3LDLA 4CK1A 1N36K 5HP1A 3ULEB 4BC5A 1VQ8N 1WUAA 3WXLA 4DB3A 4X66K 3W0LA 1IO2A 1VQNN 2VWKA 5AQFA 4DR6K 5FPNA 2HBKA 3ZX0A 5AQTA 1WOQA 4AF1A 1FKPA 2QWRA 3CCVN 3I0SA 4NCGA 4DTRA 3AO2A 3KK3A 4KHNA 3K5OA 3V9UA 1I94K 3OYKA 4G1QA 4KI4A 4MDBA 1LOTB 4KHPK 3OA9A 3P31A 5GIOA 3U3YA 1ZBSA 3VN5A 1QVGM 3SAFA 4HTLA
chains in the Genus database with same CATH topology
4IEEA 1GLCG 3ZEUA 5LJVA 3SAHA 5EX5A 1SAZA 3EKSA 3CJ9A 3ZEUB 1VQ6N 3CPEA 2OANA 2QEXN 5BREA 4QS7A 4JKDA 1YAGA 3O9TA 4MLHA 1DKGD 3MN9A 3HOSA 2V7ZA 3FLCO 1GLDG 2CH5A 2IVPA 2YX6A 2E1ZA 4GY2B 4GNIA 1BUPA 1BA1A 3F5TA 4H0TB 3O9SA 4U7BA 1Q7YO 5AQHA 1QQOA 3BP8A 4CZMA 3OBYA 3AARA 4CZKA 4IFEA 5BPMA 3MWTA 1NGHA 3BF3A 3MDQA 4FPAA 1P90A 3HM8A 2Q0RA 4JK9A 1Q81O 1KQSM 3SK3A 2CGLA 3M5RA 3VETA 4WFBL 2A5XA 3MN6A 5AQXA 2Q0UA 4H0YB 3HBTA 3ZYYX 1VQKN 4EHTA 2A41A 1JCGA 3VESA 1VQ5N 1C0FA 3MMVA 4JKEA 2H3GX 2Q36A 1KAXA 4JK8A 4PHTX 3ZETB 4A2BA 3CCQN 1W97L 2J4RA 1VQ8N 1SQKA 2V51B 3U4LA 4WFAL 2I7PA 3CJAA 5M1PA 3CJ7A 5M1KA 1E4GT 1RDWX 3NMUA 2NRHA 2P9UA 2P9IB 3QDKA 1U6ZA 4CBWA 2VGMA 2HBMA 4BRCA 5FPDA 2P9UB 5TKYA 3EE9A 1ESVA 1NGJA 1JCEA 3D6RA 1NM1A 1VQ4N 5AZIA 1TYQB 3HZ6A 3M6GA 2YHWA 1KXPA 3ENHA 5AZIB 4JD2A 4BQLA 2IIRA 1YIJN 4BR5A 5AQKA 3DXKA 2P9LA 1OKJA 3UE5A 1DEJA 3RSEA 3FZLA 3R3LA 3FZKA 3ZX2A 2QWOA 3RSEB 3H45C 2JWLA 3D2EA 4BRLA 2ASPA 5AFUA 2ASMA 5M1QA 4A59A 5AQRA 4R79A 4BG9A 2P9KA 3VPZA 3QICA 4BRHA 2ZF5O 4B1VA 3SAGA 4FPBA 4FWMA 1NWKA 3O80A 5AQQA 4BC2A 1BWFO 3T69A 3SBGA 5E84A 1J6ZA 1QZ6A 1RDUA 3P39A 3TPQA 1MWKA 2V52B 3QB0A 5E26A 1NGCA 4BGAA 3TSPA 4BRGA 4C23A 1N8RO 3I56N 2FSJA 2HBLA 3LM2A 2DPNA 1YJ9N 2FF3B 1YVNA 3VOVA 3D2FA 2I7NA 5GINA 3CERA 4KH4A 4PKIA 2NRZA 4WF9L 3VGKA 1HKBA 2NRRA 2GUPA 1VQPN 2UYTA 3RVCA 5I9EB 3KK7A 1T6CA 4I6MB 5BRHA 3L4IA 1YITN 2HBJA 1MDUB 4H5NA 2E1YA 3A5MC 4JKGB 1Q82O 3QBXA 4B1XB 4DCHA 4IZ9A 4A2AA 4JHDA 4H0XB 2RHKA 1K8KA 3I8BA 4JHDB 1NBWA 4H5VA 1K8KB 1ATSA 2VWBA 3LL3A 2E2NA 3FGUA 2VYPA 3CQXA 3CQYA 4NLCA 1KD1O 4O8UA 3WQUA 1K9MO 4PL7A 4CZFA 3DWLA 1HX1A 4H5TA 4CBXA 1ZXOA 4PKHA 2P9SA 3IDHA 2BUPA 1BOTO 1GLAG 2YI1A 4RCHA 3WT0A 2QWMA 2HMPA 2P9SB 2QWQA 2VGNA 3EL2A 2AA4A 3LDOA 3MX2A 3VENA 1HPMA 1D4XA 4GV3A 2F7TA 4NLBA 5TKWA 4BR4A 3I33A 3A0IX 5EOYA 3PIPL 4A61A 4ILGB 3CCEN 4FWOA 4IJNA 1C0GA 5C2DA 1XC3A 5EXWA 4IWVA 4BR7A 3CI5A 1HKGA 3E1YA 4A5BA 4O5FA 2V7YA 2A6AA 1O13A 2YHYA 5B8HA 1X3NA 3CMAN 3CMEN 3WEEA 3EKUA 4PL8A 3O9QA 3R1XA 2ZGZA 4WYBA 2Q1NA 3BEXA 2FF6A 4K42A 5BRFA 4NO7A 3FZMA 1T44A 4IOCL 2HSTA 1Q86O 2KLAA 3R6MA 4O8KA 4JN4A 1BDGA 2NLXA 3MN5A 3QMLA 1VQMN 3BF1A 3CCUN 3J8AA 1E4FT 4OPHA 5LY3A 2RE2A 1IG8A 2HF4A 1QVFM 3A8YA 3CCRN 3ENOA 4JKAA 5CHIA 1EQYA 4WFNL 3NVKA 2FSNA 2KHOA 1YUWA 3LDQA 4M7YA 4JKFA 1ILYA 3HRGA 3ATVA 2PAVA 4ILHA 3AAQA 3O9UA 3H3OB 4KH6A 1NLVA 1XQSC 4HWIA 1VQ7N 3SMSA 2QI2A 3J7ZO 4FWRA 5H1SQ 3TTDA 4YOXA 5M1FA 4JKCA 5F0XA 5MLCQ 1Y64A 4ISEA 4CZIA 4YOWA 2ZWHA 1QQNA 3TSQA 4K43A 3SLCA 1HKCA 3H1QA 5AQOA 1YXQA 4BRQA 1V4SA 3KVGA 4ILJA 3WXIA 4B9QA 5KQDA 2D1KA 3S41A 3CJ1A 4FWPA 3C7NA 3FZFA 3HTVA 5AQJA 3CCMN 5AQSA 2A3ZA 3HSCA 2OTJN 3ZX3A 3VF4A 1S72N 3C7NB 3U9DA 4AM6A 5GADP 1HLUA 2D0PA 2IVOA 4BVOA 1NGIA 1NGAA 4YDUA 5ELZA 4E1JA 3P38A 5AQPA 4DHYA 3MN7A 3CC7N 2Q97A 3AGKA 3FE1A 4UY8O 1YJWN 3CC4N 3GBTA 4JD2B 3HOTA 3DXKB 2P9LB 4L3QA 1ATNA 5BN8A 1VAZA 3L6QA 4XH1A 4K41A 1TUUA 3QBWA 5AQUA 4WQ5A 4JKHA 4OPAA 3D2EB 5LJWA 3FFKB 1NGFA 4K25A 5C0YA 4CD3A 2P9KB 3C6AA 3FZHA 2E2QA 3QFPA 3ENBA 1R59O 3HI0A 4U67L 3BUZB 3DJCA 1OVYA 1BO5O 4EHUA 4PKGA 1X9JA 4NB4A 1GLLO 1K73O 4FWKA 2PFUA 4CZEA 3D2FB 3H6EA 4H0OA 3VTIA 4GVEA 5JLFA 5BR9A 1G99A 2NRWA 4JK7A 4FVUA 4XH5A 2YHXA 4BY9C 3D7EO 1K8AO 3JS6A 1MWMA 1JCFA 5C12A 3IMXA 2NRTA 5JLHA 3W3DA 1KC8O 3UKRA 5ADXH 1HUXA 4FWSA 2OTLN 3VEYA 5AQWA 4BRMA 5KPZA 2QTDA 3UKRB 3GE1A 4RWTA 3G6EN 3VF2A 5GAHP 2E20A 3F2KA 3SBTA 3H1VX 3VEZA 1QQMA 2GWKA 3AAPA 4QS8A 3IUCA 2F9TA 3M3ZA 3O5BA 3K9JA 4BRNA 4CZLA 3PLAA 4BRKA 5AQNA 5FPEA 2CGJA 5JMVA 3ULEA 3CCJN 3UB5A 1NGEA 1T3VA 3EZWA 3KZBA 2W40A 3MK6A 2NNWA 2QA4N 3MX5A 4M63C 3EE8A 4BR9A 4BQZA 2CH6A 2QWPA 2QW9A 4J8FA 4CBUA 2BH1A 3AGRA 3CJBA 2A40A 2IVNA 4C1NK 5JVGL 4WQ4A 3VGMA 4FWQA 4WCEL 4IOAL 2GX9A 1QZ5A 4LC9B 4CD1A 4B1UB 4YDUC 4FOEA 3JXUA 3WXJA 4IEIA 3CXCM 3OW2M 4KH5A 3GOIA 1GLBG 1JJ2M 3WEEB 1Q18A 5BN9A 3GG4A 1NJIO 3L4QA 5CR4A 3LM9A 4CZGA 5AQIA 4H03B 3GDQA 5JVHL 1DT9A 4B1WB 3E9PA 5F1XA 4Y0WA 3LDPA 1RFQA 4BGBA 4XEIA 3VEVA 5C10A 3O9RA 2YCHA 4ISGA 1RGIA 3CIPA 2ZJPL 4BRPA 1ATRA 3AY9A 2W41A 4MDAA 3CJCA 1TUYA 4FOIA 1GLJO 1XUPO 4GV9A 3WXKA 4JKBA 4A57A 1NMDA 5KPRA 1MA9B 4IO8A 2ASOA 4EAHD 2QXLA 4OO1J 4JNEA 2QM1A 2FXUA 5GIPA 1W2BM 3Q7BA 3EN9A 3U8XA 3E9LA 3GL1A 2GTDA 4DQ8A 4BR0A 3OHRA 1DGKN 3A5LC 3I55N 1SS6A 1NGDA 3C6HA 5DM7L 4BRAA 3H46O 2WBNA 2ZJQL 3E9OA 1EO1A 1IJJA 4M7XA 5AR0A 5BRDA 3A5OC 4BC4A 2D4WA 2GWJA 1NGGA 1Z05A 4KBOA 4GV6A 2Q2RA 2F9WA 3DLLL 3B8AX 3SJHA 4BG8A 2EWSA 3IFRA 1S22A 3T7ZA 5AQMA 3PIOL 5F2RA 5M1OA 1M1KO 3ZETA 2HF3A 1BU6O 4BRFA 3R8EA 5CE3A 3KHYA 3P4IA 3L0QA 2NRVA 4C1NI 5HL7L 2FLOA 4H5RA 1HJOA 1Z6RA 2P9PA 3TTFA 3VEOA 5AQYA 4YOTA 1YI2N 3O6WA 3K9KA 4WQ4C 2P9IA 5KPTA 2P9PB 2E88A 4H0VB 2QWLA 3DXMA 5EY4A 5BPLA 4XH4A 2NZTA 5AQZA 4H5WA 5AQVA 4BC3A 3CC2N 1TYQA 2FSKA 1GLEG 3DXMB 3LDNA 3VERA 3O08A 3VMFB 2WUSA 4JAXA 3A5NC 3WQTA 5JICA 2D0OA 3CCLN 2ZGYA 1U2VA 3F9MA 3ID6A 4QS9A 1YF5L 3R9PA 3EO3A 2VCPA 3G71N 1U2VB 3MWPA 4FWNA 5ADXA 4YOUA 1KAZA 4ISFA 3CCSN 2GELA 3ATUA 3C0BA 4MO4A 2E8AA 3TU5A 3VEXA 5C15A 1YHQN 3O1BA 4H0PA 4YORA 3U9ZA 1YJNN 2YJEA 3NVMA 4EIAA 3O8MA 1LCUA 3VF6A 4CJ7A 4MO5A 2NRXA 2WFBA 3TTCA 4B1YB 3G25A 4FO0A 3WUHA 1NGBA 4JEPA 1X3MA 3IKMA 3TSUA 3VGLA 3WXMB 4EFHA 3E66A 3DAWA 2AP1A 3CETA 5GAEP 5FPMA 5AFUH 5DM6L 1M90O 2E2OA 2GEMA 1GLFO 2Q31A 3M1FA 4I6MA 3ID8A 4IDHA 3SMPA 4G9ZA 3G4SN 4B1ZA 4RTFD 3VEWA 4JKGA 1VQ9N 4IOXA 1QHAA 3CHWA 4Z94A 5HOOA 1VQON 3LDLA 3CF5L 4FL9A 2E2PA 3KWIA 2HOEA 3ULEB 4BC5A 2CGKA 4BROA 2JWKA 4BR2A 5BPNA 1H1VA 4CI6A 2BTFA 3CPWM 3VTHA 3MCPA 4FWLA 5AQGA 1WUAA 3UKUA 3WXLA 2PBDA 4BRDA 4CZHA 4CZJA 4DB3A 4DKWA 3O1WA 4BRIA 3CD6N 3W0LA 3UKUB 2KKZA 3MCAB 1SZ2A 3OBWA 1VQNN 1CZAN 5M1NA 2P9NA 5AZJA 5AQFA 3N4QA 2WC9A 5FPNA 2ITMA 4YOVA 2HBKA 2P9NB 5AQTA 5AZJB 1WOQA 1BA0A 3ZX0A 4AF1A 2QWRA 3CCVN 4YOYA 1VQLN 1ZC6A 4BREA 2ZJRL 4AM7A 4IJAA 4A5AA 2QWNA 3Q7CA 3KWGA 3H3NO 3N4PA 3O4WA 4FSVA 4A62A 1KAYA 1T6DA 5AQLA 4BVPA 5C2FA 5KQ8A 1P8ZA 3QFUA 3C65A 1S3XA 4WQ5C 4MDBA 1LOTB 3FR0A 4F9OA 2A42A 3OA9A 3P31A 5GAGP 5GIOA 1V4TA 1ZBSA 1BG3A 5EVZA 4IXCA 4MLEA 4IO9L 1QVGM 2YJFA 3SAFA 4HTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 O;  1K9M O;  1OVY A;  3DLL L;  1VQ6 N;  1K73 O;  2QEX N;  3PIO L;  1M1K O;  5HL7 L;  3PIP L;  1YI2 N;  1K8A O;  3CCE N;  1Q7Y O;  1KC8 O;  3CC2 N;  2OTL N;  3CMA N;  3CME N;  3G6E N;  1Q81 O;  5GAH P;  3CCL N;  1KQS M;  4WFB L;  4IOC L;  3G71 N;  1Q86 O;  1VQK N;  1VQ5 N;  3CCS N;  3CCJ N;  1VQM N;  3CCU N;  2QA4 N;  1QVF M;  1YHQ N;  3CCQ N;  1YJN N;  3CCR N;  4WFA L;  5JVG L;  4WFN L;  4WCE L;  4IOA L;  1ILY A;  1VQ4 N;  3CXC M;  3OW2 M;  1VQ7 N;  3J7Z O;  1M90 O;  5GAE P;  1JJ2 M;  5DM6 L;  5H1S Q;  1YIJ N;  1NJI O;  5MLC Q;  3G4S N;  1VQ9 N;  1VQO N;  5JVH L;  3CF5 L;  3CPW M;  1VQ8 N;  2ZJP L;  3CCM N;  3CD6 N;  2OTJ N;  1S72 N;  1N8R O;  1VQN N;  5GAD P;  3I56 N;  1YJ9 N;  3CC7 N;  3CCV N;  1VQL N;  1W2B M;  4UY8 O;  1YJW N;  2ZJR L;  4WF9 L;  3CC4 N;  1VQP N;  3I55 N;  1YIT N;  1Q82 O;  5DM7 L;  2ZJQ L;  5GAG P;  4IO9 L;  1QVG M;  4U67 L; 
#chains in the Genus database with same CATH topology
 3S9H A;  1IBM K;  3ZEU A;  5LJV A;  3SAH A;  4CEC A;  3ZEU B;  4CIF A;  2OAN A;  4ID1 A;  3ZT1 A;  1HNV A;  1YAG A;  1KLN A;  3O9T A;  4MLH A;  3MN9 A;  1WSI A;  3RRG A;  3TAG A;  4JRP A;  4GY2 B;  4GNI A;  1Q7Y O;  4U7B A;  3O9S A;  1VSI A;  3V81 A;  1ZBF A;  1QQO A;  1RCH A;  3BP8 A;  4CZM A;  3OBY A;  3AAR A;  4CED A;  3K59 A;  3T1H K;  1UOC A;  3D45 A;  3MWT A;  4Z4C A;  3MDQ A;  4FPA A;  2A1R A;  4CFC A;  3CFR A;  3OYI A;  2A5X A;  3MN6 A;  5AQX A;  2Q0U A;  4DR5 K;  3VES A;  1C0F A;  2VWJ A;  4JK8 A;  1CXU A;  1LW2 A;  1HNI A;  2OZS A;  2ZE2 A;  3ZET B;  4O44 A;  4WFA L;  2I7P A;  3CJA A;  3J81 O;  2P9I B;  2HBM A;  1KLM A;  3OYB A;  5TKY A;  3I0R A;  1NGJ A;  1REV A;  5AZI A;  2D5R A;  3NGY A;  3HVR A;  3MEE A;  5AZI B;  3B6P A;  4JI4 K;  2IAJ A;  1YIJ N;  5AQK A;  1IKX A;  4BWM A;  3ZX2 A;  1VSE A;  3H45 C;  2JWL A;  4KB0 A;  4M3Z A;  4V19 S;  4CJR A;  4BRH A;  4FWM A;  3O80 A;  1I39 A;  4FCY A;  3HP9 A;  3SBG A;  4LSL A;  3TPQ A;  2V52 B;  4FK0 A;  3DRR A;  4BRG A;  1BIU A;  5CZ2 A;  3AA3 A;  5KGW A;  1EX4 A;  5J1E A;  1A5V A;  2NRR A;  2GUP A;  4CHZ A;  2PYJ A;  3L4I A;  4E0D A;  3AO5 A;  1MDU B;  3QBX A;  5HRN A;  4DCH A;  1RDC A;  3V9X A;  2RHK A;  2Z1H A;  4DSK A;  1NBW A;  4H5V A;  2FBX A;  2VWB A;  2GV9 A;  3CM5 A;  3FGU A;  3CQX A;  3CQY A;  1KD1 O;  4O8U A;  4M3T A;  4FJG A;  1K9M O;  1HX1 A;  1ZXO A;  3IDH A;  1BOT O;  1GLA G;  2QWM A;  4BDP A;  2VGN A;  2FC0 A;  4LF8 K;  3TAF A;  2FBY A;  5HRP A;  4A61 A;  4ILG B;  1BQM A;  4IJN A;  1JKH A;  1C0G A;  2P5G A;  4FJK A;  1FJG K;  5EXW A;  4IWV A;  3ZT4 A;  3HJF A;  1D8Y A;  3NGZ A;  2YNF A;  1C6V A;  3SCX A;  3CMA N;  3O9Q A;  3PX4 A;  2HST A;  2KLA A;  2F96 A;  4O8K A;  4B3M K;  1KVB A;  4JI7 K;  4HHT A;  2ZM6 K;  2R7Y A;  4EP4 A;  3KTQ A;  3A8Y A;  1NJZ A;  4DUY K;  2FSN A;  2KHO A;  2YNH A;  3LDQ A;  4JKF A;  4M7Y A;  2QXF A;  3TWH A;  3H3O B;  1XQS C;  3V1O A;  3SMS A;  5J2P A;  4KHW A;  4W5T A;  4DQR A;  4AH9 A;  1Y64 A;  4ISE A;  4B8A B;  1HNZ K;  4KB1 A;  4BE1 A;  1HKC A;  4BRQ A;  4E89 A;  2IGI A;  3KVG A;  4ILJ A;  3ULD A;  3SUQ A;  4B9Q A;  3C7N A;  3HTV A;  3CCM N;  3ZX3 A;  1S72 N;  3C7N B;  5GAD P;  4BVO A;  1NGI A;  2HB5 A;  4H4M A;  1WSG A;  4E1J A;  3OJS A;  3FE1 A;  3RTV A;  4UY8 O;  1YJW N;  3AVI A;  4E7J A;  1IBK K;  3GBT A;  4JD2 B;  2XY5 A;  4L3Q A;  1MU2 A;  3L6Q A;  4DLE A;  4XH1 A;  4JS5 A;  4K41 A;  3C94 A;  4HUF A;  4OPA A;  3AA5 X;  5C0Y A;  2P9K B;  3C6A A;  3FZH A;  2BE2 A;  3QFP A;  3ENB A;  4I2P A;  3BUZ B;  2UXC K;  2VG7 A;  4LD0 A;  4PKG A;  4N76 A;  2X6N A;  4CCH A;  1F21 A;  1B92 A;  1XC9 A;  3KLH A;  3H6E A;  4GVE A;  4DV6 K;  4J2D A;  1VHX A;  2ZD1 A;  4BY9 C;  3DOK A;  1MWM A;  3IMX A;  4O0I A;  4B9N A;  4K0K K;  5JLH A;  3W3D A;  1KC8 O;  1ZBU A;  2JGU A;  4M3X A;  4FWS A;  3LWL A;  3DLB A;  3VEY A;  5AQW A;  4BRM A;  5KPZ A;  3S3O A;  3G6E N;  5IT9 O;  4DSI A;  1JLF A;  2E20 A;  3AVB A;  3F2K A;  3SBT A;  3J7A P;  3NH0 A;  3BY5 A;  4BRN A;  2G8V A;  2QKB A;  3PLA A;  2O8E A;  2WTU A;  1VSH A;  5AQN A;  4HCB A;  1FXX A;  2O8E B;  2Y1J A;  2W40 A;  1JLE A;  3MX5 A;  4BDY A;  4BQZ A;  1VRT A;  2QW9 A;  2BH1 A;  3NF6 A;  4C1N K;  3VGM A;  4WCE L;  4M41 A;  1HYZ A;  3MEC A;  4B1U B;  3KLI A;  3JXU A;  4W5N A;  4IEI A;  1JXE A;  3ZSO A;  1IKW A;  3L4Q A;  5CR4 A;  3NF7 A;  4H03 B;  4FLV A;  1DT9 A;  1RT2 A;  3DLR A;  5F1X A;  1S1T A;  3LZJ A;  4DQQ A;  4CJU A;  1RBT A;  4MDA A;  3CJC A;  3LDS A;  4A57 A;  5LMU K;  3SYZ A;  2QXL A;  1XMQ K;  1IG9 A;  3K5L A;  4OO1 J;  2P1J A;  2QM1 A;  5GIP A;  3Q7B A;  3EN9 A;  1SKS A;  3E9L A;  3GL1 A;  4DQ8 A;  4BR0 A;  4CJF A;  1DGK N;  3A5L C;  4AHC A;  3VQB A;  3JYT A;  1C1A A;  3IS9 A;  1D9F A;  4FLU A;  2WBN A;  3E9O A;  2DFE A;  1EO1 A;  1IJJ A;  5AR0 A;  4DTU A;  4Q0B A;  4BC4 A;  2D4W A;  1NGG A;  3MEG A;  1OH7 A;  3FFI A;  4CJL A;  3SJH A;  4DV1 K;  3IFR A;  1S22 A;  3T7Z A;  4B9S A;  1M1K O;  1BU6 O;  4DFJ A;  3KD5 E;  4F2R A;  2BDP A;  5HL7 L;  1HJO A;  2P9P A;  1YI2 N;  5BR8 K;  2O4I A;  1N32 K;  2P9P B;  4E3S A;  1SKR A;  2QWL A;  5BPL A;  4CJT A;  5AQZ A;  2HHX A;  1DLO A;  4M3U A;  2DFF A;  4YY3 K;  4TSX A;  3L2W A;  3CCL N;  2OPR A;  2YNG A;  1YF5 L;  3R9P A;  2PZS A;  3RMB A;  1RNH A;  3PUF A;  1KAZ A;  4ISF A;  3CCS N;  3QNN A;  4MO4 A;  4CEZ A;  3C0B A;  2UUB K;  2E8A A;  3SJJ A;  4H0P A;  2YJE A;  3NVM A;  4OPK A;  2WFB A;  4B1Y B;  1NGB A;  4B3S K;  1X3M A;  1XHZ A;  4EFH A;  3SQ1 A;  1A5W A;  3DAW A;  4WE1 A;  1UAX A;  3M8R A;  4FJJ A;  3M1F A;  1ZBI A;  4FJ8 A;  4NCA A;  4Z94 A;  1VQO N;  2HHV A;  1SUQ A;  4F2S A;  4FL9 A;  3QEP A;  3KWI A;  2HOE A;  4BRO A;  3NH1 A;  2CGK A;  5BPN A;  2JWK A;  1H1V A;  4CI6 A;  3PO5 A;  3CPW M;  3VTH A;  2QK9 A;  4DKW A;  3HST B;  4CEO A;  3O1W A;  2HHT A;  4BRI A;  3CD6 N;  2KKZ A;  3OBW A;  2O8C B;  3ZT2 A;  1CZA N;  3TAN A;  3N4Q A;  2VG6 A;  4YOV A;  1JLB A;  1I3A A;  3LP0 A;  2E6L A;  1KVC A;  2UXB K;  3OTO K;  1VQL N;  2ZJR L;  3B6O A;  4IJA A;  4A5A A;  4CF9 A;  3RWU A;  3KWG A;  4O55 A;  3O4W A;  5C2F A;  1KAY A;  1T6D A;  5HBM A;  4C8O A;  3C65 A;  4BWJ A;  1YTU A;  3FR0 A;  4F9O A;  5HRO A;  3QIO A;  5GAG P;  1NK7 A;  1BG3 A;  5EVZ A;  4IXC A;  4EP5 A;  4IEE A;  1GLC G;  3CJ9 A;  3QO9 A;  3D0P A;  1TK0 A;  1T7P A;  1Q9X A;  3PY8 A;  1NK9 A;  3HOS A;  2OZM A;  2IVP A;  1BUP A;  4EZ6 A;  4H0T B;  4X64 K;  4CZK A;  4C8K A;  1DTT A;  1TV6 A;  3HM8 A;  2Q0R A;  3PO4 A;  2CGL A;  3VET A;  4WFB L;  4J2A A;  1YTA A;  1HPZ A;  4H0Y B;  4EHT A;  2A41 A;  1VQ5 N;  1BL3 A;  3ASM A;  3AV9 A;  4JKE A;  3HM9 A;  4PHT X;  3L3U A;  3CCQ N;  1OH5 A;  3RR7 A;  2J4R A;  1YVU A;  2V51 B;  3U4L A;  3CJ7 A;  3CQ8 A;  1EP4 A;  3QDK A;  2W6L A;  4X65 K;  4ZTJ A;  3AVJ A;  1S6P A;  3D6R A;  1NM1 A;  2IDO A;  3IAY A;  1G15 A;  3MED A;  3NAE A;  5AFU A;  3D2E A;  4BRL A;  1JL1 A;  4R79 A;  4BG9 A;  2ZF5 O;  4FPB A;  1JLA A;  1TVR A;  3F73 A;  4E7K A;  5AQQ A;  1OH8 A;  1BWF O;  3T69 A;  2I5J A;  2HHU A;  1RDU A;  3OYC A;  1MWK A;  3H08 A;  5E26 A;  3K5N A;  1NGC A;  3I56 N;  2HBL A;  4DSJ A;  1IKV A;  2DPN A;  2FF3 B;  1YVN A;  4DTO A;  3THV A;  5FDL A;  4KH4 A;  2NRZ A;  4WF9 L;  1J5E K;  1DTQ A;  5HRR A;  5BRH A;  5FRN A;  4J2B A;  4JKG B;  1UA1 A;  4IZ9 A;  3IG1 A;  4H0X B;  3I8B A;  4DTM A;  3CFP A;  4DSE A;  3V6D A;  2BUP A;  3WT0 A;  1QTM A;  2QWQ A;  3VEN A;  2XO7 A;  3MX2 A;  1L3T A;  1D4X A;  5DMR A;  4DS4 A;  3O4N A;  5TKW A;  4BR4 A;  3NF8 A;  5EOY A;  3PIP L;  4DUZ K;  5J2N A;  3OYJ A;  3CCE N;  4DU4 A;  3T1A A;  1TK8 A;  1XC3 A;  3CI5 A;  1HKG A;  2P51 A;  4O5F A;  1FKO A;  1WAJ A;  2V7Y A;  4I9L A;  1O13 A;  3VQ8 A;  2YHY A;  1KFD A;  5B8H A;  1QSL A;  3WEE A;  3EKU A;  1KVA A;  1VSL A;  4DMN A;  4WYB A;  4LF9 K;  2Q1N A;  4K42 A;  4IOC L;  4NO7 A;  1Q86 O;  1WSJ A;  4DV0 K;  3SQ0 A;  3AVN A;  4FVM A;  2NLX A;  1NKB A;  3K2P A;  3CCU N;  3J8A A;  4CES A;  3LAK A;  1E4F T;  4OPH A;  4CVN E;  3KKR A;  2RE2 A;  5LY3 A;  3MAQ A;  4DWI A;  3C6T A;  1YUW A;  2ATQ A;  4CEE A;  1L5U A;  4NXM K;  3ISN C;  3ATV A;  4ILH A;  3O9U A;  3DRP A;  4CJV A;  1N5Y A;  3ZSR A;  3K0S A;  5CZ1 A;  4YOX A;  4Z4H A;  4B8C A;  5F0X A;  4JI6 K;  4CZI A;  4YOW A;  4B3T K;  2ZWH A;  5KRT A;  1HYS A;  1T03 A;  1RT7 A;  1V4S A;  2D1K A;  3CJ1 A;  4FWP A;  4DQP A;  2YNI A;  2A3Z A;  4CIE A;  1VSM A;  4AM6 A;  1HLU A;  2D0P A;  3OYF A;  1NGA A;  3P38 A;  4DHY A;  3QIP A;  5A2Q O;  2XHB A;  2Q97 A;  3AGK A;  1N33 K;  4CGI A;  4FJM A;  4DTN A;  3U6F A;  4FK4 A;  1TAQ A;  2W6K A;  4QAG A;  1ATN A;  1CZ9 A;  1VAZ A;  4CGJ A;  4DFP A;  3ZSY A;  4E1N A;  5LJW A;  3FFK B;  1TKD A;  3PSF A;  4CD3 A;  3TI0 A;  3ZSV A;  3K5M A;  2O4G A;  2OYQ A;  2X74 A;  1OVY A;  1BO5 O;  4EHU A;  1QQC A;  1T05 A;  4JI0 K;  3L8B A;  1Z25 A;  1U48 A;  3CFO A;  3VQ4 A;  1G99 A;  3T19 A;  4XH5 A;  4FM0 A;  3JS6 A;  3LPT A;  4KTW A;  4CGG A;  2GBZ A;  2OA8 A;  2NRT A;  2FBV A;  5ADX H;  4RWT A;  2QTD A;  3GE1 A;  3VF2 A;  5GAH P;  1NKE A;  1QQM A;  3IRX A;  2VQF K;  4LY7 A;  4FZX C;  3IUC A;  2F9T A;  1BCO A;  3QEV A;  4BRK A;  5FPE A;  3UB5 A;  3KZB A;  3A2F A;  1LV5 A;  4M63 C;  3EE8 A;  4CJS A;  1S1V A;  4CBU A;  3AGR A;  3CJB A;  3OY9 A;  1LW0 A;  3P5J A;  2G8K A;  1JJ2 M;  5BN9 A;  1NJI O;  4LFA K;  3J7Y P;  3GDQ A;  3DM2 A;  5JVH L;  4B1W B;  4BGB A;  4OPJ A;  3VEV A;  5C10 A;  3PSI A;  2YCH A;  1RGI A;  4LF6 K;  2ZJP L;  3JAM O;  2W41 A;  5HRS A;  4Z4E A;  4JKB A;  5KPR A;  1HYV A;  5CY4 A;  2ASO A;  3NFA A;  4CJ4 A;  4IKF A;  4JI2 K;  4DV3 K;  1NMN A;  3CM6 A;  2YHB A;  3U3G A;  2GTD A;  1R0A A;  1C1B A;  1TL1 A;  1A5X A;  2A1S A;  5DM7 L;  4BRA A;  4M7X A;  3ALY A;  2G8H A;  4Z4F A;  3DLE A;  3A5O C;  4RG8 A;  1FW6 A;  1Z05 A;  4KBO A;  3VQD A;  3SPY A;  2Q2R A;  4M45 A;  2F9W A;  3DLL L;  1IV0 A;  1NK5 A;  3B8A X;  4KFB A;  2OPQ A;  1JLC A;  5AQM A;  4HVJ A;  2F8S A;  1WB9 A;  5M1O A;  4BRF A;  3R8E A;  4DS5 A;  1X9M A;  1IBL K;  4C1N I;  2FLO A;  4H5R A;  4FJN A;  4DSL A;  3O6W A;  4WQ4 C;  5KPT A;  5J2M A;  4H0V B;  4CFB A;  1GOB A;  4XH4 A;  3CC2 N;  4AHU A;  1TYQ A;  4KAZ A;  1GLE G;  3VER A;  3KD1 E;  3O08 A;  1EET A;  3VMF B;  3A5N C;  2ZGY A;  1U45 A;  4N5S A;  3MWP A;  3VQ5 A;  4JI1 K;  1NK4 A;  1NNE A;  1RT6 A;  3TU5 A;  3VEX A;  2G8I A;  1YHQ N;  3RR8 A;  1KCF A;  4B9M A;  5KI6 A;  1LCU A;  1WBD A;  3VF6 A;  4CJ7 A;  4MO5 A;  3TTC A;  4FJH A;  4JEP A;  2UXD K;  2HW3 A;  3BZC A;  3HPH A;  2AP1 A;  3KKS A;  3RRH A;  2Q31 A;  4DR1 K;  2DY4 A;  4I6M A;  3ID8 A;  4IDH A;  4HUE A;  2QKK A;  2UU9 K;  4G9Z A;  3G4S N;  4B1Z A;  1W0H A;  1VQ9 N;  4IOX A;  3CHW A;  4W5Q A;  3CF5 L;  1N34 K;  4B9V A;  1XWL A;  1Z26 A;  3MCP A;  4FWL A;  4BRD A;  4CZJ A;  4CZH A;  3HP6 A;  3SV4 A;  3MCA B;  5EU7 A;  5AZJ A;  4KI6 A;  2WC9 A;  1C0U A;  2ITM A;  3WNH A;  5JS2 A;  5AZJ B;  3HVT A;  1LAV A;  3F9K A;  1ZC6 A;  4BRE A;  4AM7 A;  3DLG A;  1RT5 A;  1EXQ A;  2QWN A;  3HXM A;  2G8F A;  1HNW K;  3THY A;  4A62 A;  5AQL A;  4FZZ A;  1HQU A;  3KLE A;  1P8Z A;  3OS2 A;  3THY B;  2A42 A;  1U49 A;  4CJW A;  4MLE A;  4IO9 L;  2E5L K;  4FLX A;  5EX5 A;  3AO1 A;  4AQY K;  1VQ6 N;  3OVN A;  5BRE A;  4OKJ A;  4JKD A;  4DV7 K;  4K8Z A;  1DKG D;  3TAM A;  2BGG A;  1GLD G;  4CJ5 A;  1NG9 A;  2CH5 A;  4FXD A;  2E1Z A;  1CLQ A;  3CYM A;  1BA1 A;  3EZ5 A;  5KRS A;  3PV8 A;  2UUA K;  1K6Y A;  1VSK A;  3LAN A;  3C6U A;  1EKE A;  4CEA A;  1NGH A;  3BF3 A;  5KGX A;  2RN2 A;  1Q81 O;  2VG5 A;  1KQS M;  3SK3 A;  3WNG A;  3M5R A;  1X9W A;  1VQK N;  3AVA A;  1QE1 A;  1BIZ A;  3G10 A;  3MMV A;  4ELV A;  2H3G X;  4BDZ A;  3VQE A;  1KAX A;  1ZBH A;  2XRI A;  4FM1 A;  1W97 L;  4OLA A;  3AVM A;  1E4G T;  3NMU A;  3ITH A;  5K14 A;  2VGM A;  4BRC A;  5FPD A;  1SV5 A;  1SL1 A;  3EE9 A;  1ESV A;  3MXJ A;  4FJ7 A;  1RIL A;  5C24 A;  4QOZ B;  4DG1 A;  3ENH A;  1WBB A;  2IIR A;  4BR5 A;  3DXK A;  2JLE A;  2P9L A;  2Z1J A;  3V9W A;  2QWO A;  4ICL A;  2ASM A;  4A59 A;  2KFZ A;  5AQR A;  3QIC A;  4I9Q A;  1VSF A;  3SAG A;  3ZCM A;  3LAM A;  4CHN A;  1HQE A;  5E84 A;  1J6Z A;  3P39 A;  1N8R O;  4BGA A;  4FLT A;  3TSP A;  1XMO K;  3LM2 A;  1YJ9 N;  3D2F A;  4AIL C;  5SZT A;  3ZT3 A;  4KHU A;  4ELU A;  5GIN A;  4O5B A;  4R5P A;  3EYZ A;  1L3U A;  4PKI A;  3VGK A;  1TKZ A;  4DFK A;  3QNO A;  1VQP N;  2UYT A;  3KK7 A;  1T6C A;  1WSF A;  1YIT N;  4UQG A;  4H5N A;  3ZLJ A;  2E1Y A;  3A5M C;  1Q82 O;  4B1X B;  4A2A A;  4ZTF A;  1K8K A;  3ZSZ A;  4JI3 K;  1K8K B;  3LL3 A;  3OYG A;  2E2N A;  2VYP A;  4NLC A;  3WQU A;  3OYM A;  4CZF A;  3DWL A;  4CBX A;  2P9S A;  3AO3 A;  3HK2 A;  5J2Q A;  1NOY A;  2HMP A;  2P9S B;  3LDO A;  3EL2 A;  2AA4 A;  2ZQB A;  3QLH A;  4JRQ A;  1Y97 A;  1HJR A;  4W5O A;  3I33 A;  3NBP A;  4FWO A;  5LL6 Z;  5C2D A;  4JV5 K;  1ASW A;  3RMD A;  3OYA A;  4A5B A;  4CW7 B;  1RTD A;  4IFV A;  1TK5 A;  3S3N A;  1KSP A;  2HNZ A;  4PL8 A;  3R1X A;  3NHG A;  4IFY A;  5BRF A;  1BIS A;  3AA2 A;  2O8F A;  3R6M A;  2KW4 A;  3TR8 A;  1NK6 A;  4JN4 A;  3QML A;  2O8F B;  4O4G A;  3QEI A;  1ZBL A;  1HRH A;  3BZK A;  3BDP A;  3CCR N;  3ENO A;  4JKA A;  5CHI A;  4EZ9 A;  2FBT A;  4WFN L;  4LF4 K;  4I7F A;  3TAR A;  1ILY A;  3THW A;  1NLV A;  4B3R K;  4CEQ A;  4CF0 A;  3THW B;  2QI2 A;  1RDD A;  4F3T A;  1TGO A;  3OYL A;  3THX A;  5CYQ A;  5M1F A;  5MLC Q;  1NJW A;  3THX B;  4CIG A;  4HCC A;  4CF8 A;  1QQN A;  3SLC A;  3AVC A;  3QET A;  5I42 A;  4LFC K;  3FZF A;  5AQJ A;  1JXB A;  2OTJ N;  1U4B A;  3U9D A;  1WAF A;  2IVO A;  5ELZ A;  5AQP A;  1BQN A;  1W9H A;  1C0M A;  3NCI A;  4DV5 K;  3KIO A;  5AQU A;  4WQ5 A;  4JKH A;  1IH7 A;  3D2E B;  4K25 A;  2E2Q A;  3DJC A;  2HVI A;  2W42 A;  1TAU A;  1GLL O;  4FWK A;  5FLX O;  5C42 A;  1JLQ A;  4H0O A;  1XNQ K;  2NRW A;  2YHX A;  5IWA K;  2AJQ A;  5C12 A;  4GW6 A;  1XHX A;  1ITG A;  1HNX K;  4YHH K;  1S1U A;  4DQI A;  3PX0 A;  4C8L A;  1HUX A;  5E41 A;  1B9D A;  1HMV A;  1SKW A;  4NXN K;  2O8B A;  4MQ3 A;  3H1V X;  4AHV A;  3VEZ A;  4E7I A;  3ZSX A;  3AAP A;  4QS8 A;  3O5B A;  4CZL A;  4FJI A;  2IC3 A;  2CGJ A;  4GKJ K;  1S5J A;  3ULE A;  4N41 A;  3MK6 A;  4BR9 A;  2CH6 A;  2QWP A;  4DR2 K;  2XY7 A;  4Z4G A;  2A40 A;  1QHT A;  4WQ4 A;  3O3F A;  4FWQ A;  2GX9 A;  4LC9 B;  4M42 A;  4CD1 A;  4YDU C;  4FOE A;  3VA0 A;  5C25 A;  3GOI A;  2X6S A;  4FW2 A;  3WEE B;  1Q18 A;  3GG4 A;  3HYF A;  3LM9 A;  4DTX A;  2BAN A;  1NK8 A;  4DQS A;  1RTI A;  4Y0W A;  4KO0 A;  3LDP A;  3KK2 A;  3CIP A;  3SI6 A;  4BRP A;  1ATR A;  3AY9 A;  4RW6 A;  4RW8 A;  4FZY A;  1LWE A;  4BE2 A;  4FOI A;  4CGF A;  1GLJ O;  2OPS A;  4B9U A;  3L3V A;  1MA9 B;  4IO8 A;  4Z4I A;  4RW4 A;  3L2R A;  4JNE A;  4PQU A;  2OPP A;  5SWM A;  1ASU A;  2FXU A;  1W2B M;  4FK2 A;  3U8X A;  4W5R A;  1OH6 A;  4CGD A;  1BI4 A;  1BI4 B;  4OGE A;  1J5O A;  1SS6 A;  3SUP A;  3V9S A;  3SNN A;  4CER A;  2GWJ A;  4PA1 A;  2F8T A;  3VQP A;  3VQA A;  3V1Q A;  4BG8 A;  2EWS A;  1LWF A;  4F4K A;  4LH4 A;  5HLF A;  5F2R A;  3S3M A;  3ZET A;  2HF3 A;  2D0A A;  3KHY A;  2RF2 A;  4B9L A;  4DU3 A;  1L3V A;  1Z6R A;  4JI8 K;  4YOT A;  3K9K A;  3LZI A;  2P9I A;  1VSJ A;  1Q9Y A;  4OGC A;  4H5W A;  5AQV A;  1XI1 A;  2XY8 A;  1S1X A;  4PWD A;  3LDN A;  1SL2 A;  3OYD A;  3T1Y K;  4RW7 A;  1U2V A;  3F9M A;  4LFB K;  1D5A A;  3G71 N;  1U2V B;  4ZHR A;  3DI6 A;  2GEL A;  3ATU A;  2WOM A;  1VSD A;  1NU0 A;  1YT3 A;  3LPU A;  2NUB A;  3U9Z A;  3ZSW A;  1EWR A;  3O8M A;  1CXQ A;  2NRX A;  2XY6 A;  3G25 A;  3AVG A;  3VGL A;  3TSU A;  4JLH A;  3E66 A;  2KTQ A;  1GOA A;  1M90 O;  5GAE P;  5FPM A;  5AFU H;  4DFM A;  2E2O A;  4J2E A;  2IOC A;  4DTP A;  1S9G A;  4QCL A;  2Z1G A;  4RTF D;  1HR0 K;  1NJX A;  1QHA A;  5HOO A;  4O0J A;  4FJL A;  1RT4 A;  4DSF A;  2E2P A;  3SZ2 A;  4BR2 A;  1OVQ A;  2BTF A;  4OLB A;  5AQG A;  3UKU A;  2PBD A;  3HO1 A;  1RTH A;  3V9Z A;  3UKU B;  1SZ2 A;  5M1N A;  1RBR A;  2P9N A;  4CK2 A;  2P9N B;  4Y1C A;  1BA0 A;  4CF1 A;  4YOY A;  2ETJ A;  3HL8 A;  3KLF A;  3Q7C A;  3N4P A;  3H3N O;  4FSV A;  4BVP A;  3KJV A;  3ZSQ A;  2HHW A;  5FRO A;  5KQ8 A;  4CHP A;  3QFU A;  1S3X A;  4BE0 A;  4WQ5 C;  3QEW A;  2HHH K;  3HPG A;  1V4T A;  2E4L A;  1ZYQ A;  4HUG A;  3SPZ A;  4CEF A;  2YJF A;  2HND A;  3NE6 A;  4CHO A;  3VQ6 A;  5CYM A;  3OJU A;  1NJY A;  1SAZ A;  3EKS A;  1GOC A;  3CPE A;  4M3Y A;  2QEX N;  4QS7 A;  1WNS A;  2V7Z A;  3FLC O;  2D0B A;  2YX6 A;  1NKC A;  4DR3 K;  3F5T A;  4X62 K;  5AQH A;  2KQ2 A;  4IFE A;  4NYF A;  5BPM A;  3RMA A;  4KHS A;  1P90 A;  4JK9 A;  3AVK A;  3AVL A;  4OJR A;  3WNF A;  2PYL A;  4DR4 K;  1LWC A;  3HBT A;  4H4O A;  3ZYY X;  1JCG A;  1RTJ A;  4B08 A;  4FJ5 A;  2HNY A;  3PX6 A;  4KRE A;  2Q36 A;  3DLH A;  4A2B A;  1SQK A;  4CHQ A;  5M1P A;  5M1K A;  2Y1I A;  4KPY A;  1RDW X;  5DK5 A;  2NRH A;  2P9U A;  3LP2 A;  1U6Z A;  4CBW A;  3SQ4 A;  2P9U B;  3DRS A;  3ZT0 A;  1VQ4 N;  1JCE A;  1TYQ B;  3NF9 A;  3HZ6 A;  3M6G A;  1BCM A;  2YHW A;  3TAP A;  1KXP A;  4DU1 A;  4AHS A;  4JD2 A;  4BQL A;  1ASV A;  1OKJ A;  3UE5 A;  4PUO A;  1DEJ A;  1NOZ A;  4OX9 K;  1UWB A;  3RSE A;  3FZL A;  4ID5 A;  3R3L A;  3FZK A;  3RSE B;  1KTQ A;  2ASP A;  5M1Q A;  4FM2 A;  2P9K A;  3VPZ A;  4ELT A;  4B1V A;  5LMN K;  1NWK A;  2PY5 A;  1RBV A;  4BC2 A;  1J9A A;  4CJE A;  4B3O A;  4E7H A;  1QZ6 A;  3OYE A;  4C23 A;  3QB0 A;  4K8X A;  4AHR A;  3K57 A;  2FSJ A;  4LF7 K;  4JI5 K;  4BAC A;  3VOV A;  2I7N A;  4CEB A;  3CER A;  4H8K A;  1SL0 A;  1U04 A;  1HKB A;  3RVC A;  5I9E B;  4I6M B;  4DV4 K;  2HBJ A;  4M3R A;  1B9F A;  4JHD A;  1NK0 A;  4DTJ A;  4JHD B;  1ATS A;  4FJ9 A;  2DTU A;  3HT3 A;  4DF4 A;  4KRF A;  4PL7 A;  3UIQ A;  4CFA A;  4H5T A;  1C0T A;  4PKH A;  1S9E A;  4KHY A;  2YI1 A;  4RCH A;  1FK9 A;  1JL2 A;  1HPM A;  3LWM A;  3NDK A;  5T7B A;  4KKO A;  5D3G A;  4GV3 A;  2F7T A;  3AO4 A;  4NLB A;  3A0I X;  3M8Q A;  4BR7 A;  3NGI A;  1WN7 A;  2O8D A;  3E1Y A;  2P5O A;  4KTQ A;  4DV2 K;  2O8D B;  2A6A A;  1J53 A;  1X3N A;  3CME N;  3DMJ A;  1X9S A;  2ZGZ A;  3KLG A;  3BEX A;  2FF6 A;  3FZM A;  1T44 A;  1QSY A;  3VA3 A;  5AJ3 K;  3CG7 A;  1U47 A;  4JS4 A;  1BDG A;  3MN5 A;  1VQM N;  3BF1 A;  1O1W A;  3QEX A;  2KZM A;  1IG8 A;  2HF4 A;  4FLW A;  1QVF M;  4NCB A;  2Q3S A;  2HMI A;  2RKI A;  3DLK A;  3VQ9 A;  4FW1 A;  1EQY A;  3NVK A;  5JS1 A;  1BHL A;  3OS0 A;  4DR7 K;  3HRG A;  2PAV A;  3AAQ A;  4KH6 A;  3L2V A;  4IG0 A;  1UA0 A;  3C95 A;  4HWI A;  1VQ7 N;  4F8R A;  2LSN A;  3J7Z O;  4CJP A;  4E7L A;  3RMC A;  4FYD A;  4FWR A;  5H1S Q;  3TTD A;  4IDK A;  3SQ2 A;  2IS3 A;  2GUI A;  4JKC A;  4CGH A;  4XIU A;  3TAB A;  2WON A;  4E19 A;  3TSQ A;  1RDA A;  4K43 A;  3H1Q A;  5AQO A;  1YXQ A;  3WXI A;  1BGX T;  4C8M A;  5KQD A;  4M3W A;  3S41 A;  5KTQ A;  5AQS A;  3HSC A;  3VF4 A;  1QSS A;  4YDU A;  4LH5 A;  3MN7 A;  1QS4 A;  3CC7 N;  1Q8I A;  3CC4 N;  2G8U A;  3I8D A;  3MXM A;  1RDB A;  3M8P A;  3HOT A;  3DXK B;  2P9L B;  5BN8 A;  3P1G A;  3V1R A;  1TUU A;  3QBW A;  5I3U A;  3G0Z A;  4OVL A;  2UUC K;  1NGF A;  1KRP A;  3VQQ A;  2HHS A;  1WLJ A;  1R59 O;  3HI0 A;  4U67 L;  3SUN A;  1WSH A;  1IKY A;  3MXI A;  1X9J A;  4NB4 A;  3M8S A;  1K73 O;  3O3G A;  2PFU A;  4CZE A;  3D2F B;  1S1W A;  2EHG A;  5JLF A;  3VTI A;  5BR9 A;  4JK7 A;  2YKN A;  4FVU A;  4FJX A;  3D7E O;  1K8A O;  1JCF A;  4IBN A;  2VQE K;  4B9T A;  2X78 A;  3AVF A;  1N6Q A;  4I2Q A;  3LP1 A;  3OYH A;  4KHQ A;  3UKR A;  2OTL N;  3QER A;  3UKR B;  4GVM A;  4CJ3 A;  3EEQ A;  1CZB A;  4LSN A;  4L8R B;  4RW9 A;  2GWK A;  3M3Z A;  3K9J A;  5JMV A;  3CCJ N;  4C8N A;  4Q5V A;  1TKT A;  4AHT A;  1NGE A;  1T3V A;  3EZW A;  3BGR A;  4KTZ A;  2QA4 N;  2NNW A;  3L2Q A;  2OCE A;  4N56 A;  4J8F A;  5JVG L;  2IVN A;  3VQ7 A;  2EX3 A;  2O8C A;  4IOA L;  1J54 A;  1LAW A;  1QZ5 A;  3QIN A;  3NH2 A;  1T8E A;  3OS1 A;  4NYN A;  3WXJ A;  1VK0 A;  3CXC M;  3OW2 M;  1WSE A;  1W7A A;  2E6M A;  1RT3 A;  4KH5 A;  4HTU A;  1KFS A;  1GLB G;  3LAL A;  2D0C A;  2YKM A;  3QES A;  2B4J A;  4CZG A;  4CHY A;  5AQI A;  1EWQ A;  3E9P A;  3KK1 A;  1RFQ A;  3OYN A;  4N47 A;  4XEI A;  1TKX A;  3O9R A;  4ISG A;  3JSM A;  3O4Q A;  1TUY A;  1XNR K;  1XUP O;  4GV9 A;  3WXK A;  1VRU A;  1NMD A;  1L3S A;  4EAH D;  2G8W A;  2HVH A;  3WNE A;  4YFU A;  3DOL A;  3O3H A;  4FLZ A;  3V4I A;  3OHR A;  2KFN A;  3I55 N;  1X1P A;  4Y1D A;  3DYA A;  1NGD A;  3C6H A;  3H46 O;  2ZJQ L;  3J80 O;  4OKE A;  4IG3 A;  5BRD A;  3TAE A;  4GV6 A;  1S6Q A;  2F4V K;  3PIO L;  4F3O A;  3L2U A;  3VQC A;  5CE3 A;  1TL3 A;  3P4I A;  3L0Q A;  2NRV A;  4CFD A;  1RBS A;  3AVH A;  4LF5 K;  3TTF A;  3VEO A;  5AQY A;  1D9D A;  2E88 A;  2RPI A;  2KZZ A;  3DXM A;  5EY4 A;  2B5J A;  2Z1I A;  2NZT A;  1JLG A;  4BC3 A;  3E01 A;  4GKK K;  2FSK A;  3DXM B;  4OKK A;  4YNQ A;  1RT1 A;  3P83 D;  4CF2 A;  2WUS A;  4JAX A;  3WQT A;  5JIC A;  2YV0 X;  2D0O A;  4DF8 A;  3ID6 A;  4KV8 A;  4QS9 A;  4CJQ A;  3EO3 A;  3AA4 A;  2VCP A;  4CK3 A;  3T3F A;  4FWN A;  5ADX A;  4YOU A;  1C1C A;  4DTS A;  3LP3 A;  2B6A A;  3TAQ A;  1E3M A;  2YHA A;  5C15 A;  3K58 A;  3SV3 A;  3O1B A;  4YOR A;  3EY1 A;  1YJN N;  4EIA A;  3SUO A;  4FO0 A;  2ITG A;  3WUH A;  4FLY A;  5FRM A;  3IKM A;  4JYA K;  3WXM B;  4GMJ B;  4PY5 A;  2HHQ A;  4DLG A;  3CET A;  1RBU A;  5DM6 L;  2GEM A;  1GLF O;  4MFB A;  2O8B B;  4E1M A;  4CE9 A;  3SMP A;  4Z0U A;  4CJK A;  3HPO A;  3VEW A;  4JKG A;  2DFH A;  3LDL A;  4CK1 A;  1N36 K;  5HP1 A;  3ULE B;  4BC5 A;  1VQ8 N;  1WUA A;  3WXL A;  4DB3 A;  4X66 K;  3W0L A;  1IO2 A;  1VQN N;  2VWK A;  5AQF A;  4DR6 K;  5FPN A;  2HBK A;  3ZX0 A;  5AQT A;  1WOQ A;  4AF1 A;  1FKP A;  2QWR A;  3CCV N;  3I0S A;  4NCG A;  4DTR A;  3AO2 A;  3KK3 A;  4KHN A;  3K5O A;  3V9U A;  1I94 K;  3OYK A;  4G1Q A;  4KI4 A;  4MDB A;  1LOT B;  4KHP K;  3OA9 A;  3P31 A;  5GIO A;  3U3Y A;  1ZBS A;  3VN5 A;  1QVG M;  3SAF A;  4HTL A; 
#chains in the Genus database with same CATH homology
 4IEE A;  1GLC G;  3ZEU A;  5LJV A;  3SAH A;  5EX5 A;  1SAZ A;  3EKS A;  3CJ9 A;  3ZEU B;  1VQ6 N;  3CPE A;  2OAN A;  2QEX N;  5BRE A;  4QS7 A;  4JKD A;  1YAG A;  3O9T A;  4MLH A;  1DKG D;  3MN9 A;  3HOS A;  2V7Z A;  3FLC O;  1GLD G;  2CH5 A;  2IVP A;  2YX6 A;  2E1Z A;  4GY2 B;  4GNI A;  1BUP A;  1BA1 A;  3F5T A;  4H0T B;  3O9S A;  4U7B A;  1Q7Y O;  5AQH A;  1QQO A;  3BP8 A;  4CZM A;  3OBY A;  3AAR A;  4CZK A;  4IFE A;  5BPM A;  3MWT A;  1NGH A;  3BF3 A;  3MDQ A;  4FPA A;  1P90 A;  3HM8 A;  2Q0R A;  4JK9 A;  1Q81 O;  1KQS M;  3SK3 A;  2CGL A;  3M5R A;  3VET A;  4WFB L;  2A5X A;  3MN6 A;  5AQX A;  2Q0U A;  4H0Y B;  3HBT A;  3ZYY X;  1VQK N;  4EHT A;  2A41 A;  1JCG A;  3VES A;  1VQ5 N;  1C0F A;  3MMV A;  4JKE A;  2H3G X;  2Q36 A;  1KAX A;  4JK8 A;  4PHT X;  3ZET B;  4A2B A;  3CCQ N;  1W97 L;  2J4R A;  1VQ8 N;  1SQK A;  2V51 B;  3U4L A;  4WFA L;  2I7P A;  3CJA A;  5M1P A;  3CJ7 A;  5M1K A;  1E4G T;  1RDW X;  3NMU A;  2NRH A;  2P9U A;  2P9I B;  3QDK A;  1U6Z A;  4CBW A;  2VGM A;  2HBM A;  4BRC A;  5FPD A;  2P9U B;  5TKY A;  3EE9 A;  1ESV A;  1NGJ A;  1JCE A;  3D6R A;  1NM1 A;  1VQ4 N;  5AZI A;  1TYQ B;  3HZ6 A;  3M6G A;  2YHW A;  1KXP A;  3ENH A;  5AZI B;  4JD2 A;  4BQL A;  2IIR A;  1YIJ N;  4BR5 A;  5AQK A;  3DXK A;  2P9L A;  1OKJ A;  3UE5 A;  1DEJ A;  3RSE A;  3FZL A;  3R3L A;  3FZK A;  3ZX2 A;  2QWO A;  3RSE B;  3H45 C;  2JWL A;  3D2E A;  4BRL A;  2ASP A;  5AFU A;  2ASM A;  5M1Q A;  4A59 A;  5AQR A;  4R79 A;  4BG9 A;  2P9K A;  3VPZ A;  3QIC A;  4BRH A;  2ZF5 O;  4B1V A;  3SAG A;  4FPB A;  4FWM A;  1NWK A;  3O80 A;  5AQQ A;  4BC2 A;  1BWF O;  3T69 A;  3SBG A;  5E84 A;  1J6Z A;  1QZ6 A;  1RDU A;  3P39 A;  3TPQ A;  1MWK A;  2V52 B;  3QB0 A;  5E26 A;  1NGC A;  4BGA A;  3TSP A;  4BRG A;  4C23 A;  1N8R O;  3I56 N;  2FSJ A;  2HBL A;  3LM2 A;  2DPN A;  1YJ9 N;  2FF3 B;  1YVN A;  3VOV A;  3D2F A;  2I7N A;  5GIN A;  3CER A;  4KH4 A;  4PKI A;  2NRZ A;  4WF9 L;  3VGK A;  1HKB A;  2NRR A;  2GUP A;  1VQP N;  2UYT A;  3RVC A;  5I9E B;  3KK7 A;  1T6C A;  4I6M B;  5BRH A;  3L4I A;  1YIT N;  2HBJ A;  1MDU B;  4H5N A;  2E1Y A;  3A5M C;  4JKG B;  1Q82 O;  3QBX A;  4B1X B;  4DCH A;  4IZ9 A;  4A2A A;  4JHD A;  4H0X B;  2RHK A;  1K8K A;  3I8B A;  4JHD B;  1NBW A;  4H5V A;  1K8K B;  1ATS A;  2VWB A;  3LL3 A;  2E2N A;  3FGU A;  2VYP A;  3CQX A;  3CQY A;  4NLC A;  1KD1 O;  4O8U A;  3WQU A;  1K9M O;  4PL7 A;  4CZF A;  3DWL A;  1HX1 A;  4H5T A;  4CBX A;  1ZXO A;  4PKH A;  2P9S A;  3IDH A;  2BUP A;  1BOT O;  1GLA G;  2YI1 A;  4RCH A;  3WT0 A;  2QWM A;  2HMP A;  2P9S B;  2QWQ A;  2VGN A;  3EL2 A;  2AA4 A;  3LDO A;  3MX2 A;  3VEN A;  1HPM A;  1D4X A;  4GV3 A;  2F7T A;  4NLB A;  5TKW A;  4BR4 A;  3I33 A;  3A0I X;  5EOY A;  3PIP L;  4A61 A;  4ILG B;  3CCE N;  4FWO A;  4IJN A;  1C0G A;  5C2D A;  1XC3 A;  5EXW A;  4IWV A;  4BR7 A;  3CI5 A;  1HKG A;  3E1Y A;  4A5B A;  4O5F A;  2V7Y A;  2A6A A;  1O13 A;  2YHY A;  5B8H A;  1X3N A;  3CMA N;  3CME N;  3WEE A;  3EKU A;  4PL8 A;  3O9Q A;  3R1X A;  2ZGZ A;  4WYB A;  2Q1N A;  3BEX A;  2FF6 A;  4K42 A;  5BRF A;  4NO7 A;  3FZM A;  1T44 A;  4IOC L;  2HST A;  1Q86 O;  2KLA A;  3R6M A;  4O8K A;  4JN4 A;  1BDG A;  2NLX A;  3MN5 A;  3QML A;  1VQM N;  3BF1 A;  3CCU N;  3J8A A;  1E4F T;  4OPH A;  5LY3 A;  2RE2 A;  1IG8 A;  2HF4 A;  1QVF M;  3A8Y A;  3CCR N;  3ENO A;  4JKA A;  5CHI A;  1EQY A;  4WFN L;  3NVK A;  2FSN A;  2KHO A;  1YUW A;  3LDQ A;  4M7Y A;  4JKF A;  1ILY A;  3HRG A;  3ATV A;  2PAV A;  4ILH A;  3AAQ A;  3O9U A;  3H3O B;  4KH6 A;  1NLV A;  1XQS C;  4HWI A;  1VQ7 N;  3SMS A;  2QI2 A;  3J7Z O;  4FWR A;  5H1S Q;  3TTD A;  4YOX A;  5M1F A;  4JKC A;  5F0X A;  5MLC Q;  1Y64 A;  4ISE A;  4CZI A;  4YOW A;  2ZWH A;  1QQN A;  3TSQ A;  4K43 A;  3SLC A;  1HKC A;  3H1Q A;  5AQO A;  1YXQ A;  4BRQ A;  1V4S A;  3KVG A;  4ILJ A;  3WXI A;  4B9Q A;  5KQD A;  2D1K A;  3S41 A;  3CJ1 A;  4FWP A;  3C7N A;  3FZF A;  3HTV A;  5AQJ A;  3CCM N;  5AQS A;  2A3Z A;  3HSC A;  2OTJ N;  3ZX3 A;  3VF4 A;  1S72 N;  3C7N B;  3U9D A;  4AM6 A;  5GAD P;  1HLU A;  2D0P A;  2IVO A;  4BVO A;  1NGI A;  1NGA A;  4YDU A;  5ELZ A;  4E1J A;  3P38 A;  5AQP A;  4DHY A;  3MN7 A;  3CC7 N;  2Q97 A;  3AGK A;  3FE1 A;  4UY8 O;  1YJW N;  3CC4 N;  3GBT A;  4JD2 B;  3HOT A;  3DXK B;  2P9L B;  4L3Q A;  1ATN A;  5BN8 A;  1VAZ A;  3L6Q A;  4XH1 A;  4K41 A;  1TUU A;  3QBW A;  5AQU A;  4WQ5 A;  4JKH A;  4OPA A;  3D2E B;  5LJW A;  3FFK B;  1NGF A;  4K25 A;  5C0Y A;  4CD3 A;  2P9K B;  3C6A A;  3FZH A;  2E2Q A;  3QFP A;  3ENB A;  1R59 O;  3HI0 A;  4U67 L;  3BUZ B;  3DJC A;  1OVY A;  1BO5 O;  4EHU A;  4PKG A;  1X9J A;  4NB4 A;  1GLL O;  1K73 O;  4FWK A;  2PFU A;  4CZE A;  3D2F B;  3H6E A;  4H0O A;  3VTI A;  4GVE A;  5JLF A;  5BR9 A;  1G99 A;  2NRW A;  4JK7 A;  4FVU A;  4XH5 A;  2YHX A;  4BY9 C;  3D7E O;  1K8A O;  3JS6 A;  1MWM A;  1JCF A;  5C12 A;  3IMX A;  2NRT A;  5JLH A;  3W3D A;  1KC8 O;  3UKR A;  5ADX H;  1HUX A;  4FWS A;  2OTL N;  3VEY A;  5AQW A;  4BRM A;  5KPZ A;  2QTD A;  3UKR B;  3GE1 A;  4RWT A;  3G6E N;  3VF2 A;  5GAH P;  2E20 A;  3F2K A;  3SBT A;  3H1V X;  3VEZ A;  1QQM A;  2GWK A;  3AAP A;  4QS8 A;  3IUC A;  2F9T A;  3M3Z A;  3O5B A;  3K9J A;  4BRN A;  4CZL A;  3PLA A;  4BRK A;  5AQN A;  5FPE A;  2CGJ A;  5JMV A;  3ULE A;  3CCJ N;  3UB5 A;  1NGE A;  1T3V A;  3EZW A;  3KZB A;  2W40 A;  3MK6 A;  2NNW A;  2QA4 N;  3MX5 A;  4M63 C;  3EE8 A;  4BR9 A;  4BQZ A;  2CH6 A;  2QWP A;  2QW9 A;  4J8F A;  4CBU A;  2BH1 A;  3AGR A;  3CJB A;  2A40 A;  2IVN A;  4C1N K;  5JVG L;  4WQ4 A;  3VGM A;  4FWQ A;  4WCE L;  4IOA L;  2GX9 A;  1QZ5 A;  4LC9 B;  4CD1 A;  4B1U B;  4YDU C;  4FOE A;  3JXU A;  3WXJ A;  4IEI A;  3CXC M;  3OW2 M;  4KH5 A;  3GOI A;  1GLB G;  1JJ2 M;  3WEE B;  1Q18 A;  5BN9 A;  3GG4 A;  1NJI O;  3L4Q A;  5CR4 A;  3LM9 A;  4CZG A;  5AQI A;  4H03 B;  3GDQ A;  5JVH L;  1DT9 A;  4B1W B;  3E9P A;  5F1X A;  4Y0W A;  3LDP A;  1RFQ A;  4BGB A;  4XEI A;  3VEV A;  5C10 A;  3O9R A;  2YCH A;  4ISG A;  1RGI A;  3CIP A;  2ZJP L;  4BRP A;  1ATR A;  3AY9 A;  2W41 A;  4MDA A;  3CJC A;  1TUY A;  4FOI A;  1GLJ O;  1XUP O;  4GV9 A;  3WXK A;  4JKB A;  4A57 A;  1NMD A;  5KPR A;  1MA9 B;  4IO8 A;  2ASO A;  4EAH D;  2QXL A;  4OO1 J;  4JNE A;  2QM1 A;  2FXU A;  5GIP A;  1W2B M;  3Q7B A;  3EN9 A;  3U8X A;  3E9L A;  3GL1 A;  2GTD A;  4DQ8 A;  4BR0 A;  3OHR A;  1DGK N;  3A5L C;  3I55 N;  1SS6 A;  1NGD A;  3C6H A;  5DM7 L;  4BRA A;  3H46 O;  2WBN A;  2ZJQ L;  3E9O A;  1EO1 A;  1IJJ A;  4M7X A;  5AR0 A;  5BRD A;  3A5O C;  4BC4 A;  2D4W A;  2GWJ A;  1NGG A;  1Z05 A;  4KBO A;  4GV6 A;  2Q2R A;  2F9W A;  3DLL L;  3B8A X;  3SJH A;  4BG8 A;  2EWS A;  3IFR A;  1S22 A;  3T7Z A;  5AQM A;  3PIO L;  5F2R A;  5M1O A;  1M1K O;  3ZET A;  2HF3 A;  1BU6 O;  4BRF A;  3R8E A;  5CE3 A;  3KHY A;  3P4I A;  3L0Q A;  2NRV A;  4C1N I;  5HL7 L;  2FLO A;  4H5R A;  1HJO A;  1Z6R A;  2P9P A;  3TTF A;  3VEO A;  5AQY A;  4YOT A;  1YI2 N;  3O6W A;  3K9K A;  4WQ4 C;  2P9I A;  5KPT A;  2P9P B;  2E88 A;  4H0V B;  2QWL A;  3DXM A;  5EY4 A;  5BPL A;  4XH4 A;  2NZT A;  5AQZ A;  4H5W A;  5AQV A;  4BC3 A;  3CC2 N;  1TYQ A;  2FSK A;  1GLE G;  3DXM B;  3LDN A;  3VER A;  3O08 A;  3VMF B;  2WUS A;  4JAX A;  3A5N C;  3WQT A;  5JIC A;  2D0O A;  3CCL N;  2ZGY A;  1U2V A;  3F9M A;  3ID6 A;  4QS9 A;  1YF5 L;  3R9P A;  3EO3 A;  2VCP A;  3G71 N;  1U2V B;  3MWP A;  4FWN A;  5ADX A;  4YOU A;  1KAZ A;  4ISF A;  3CCS N;  2GEL A;  3ATU A;  3C0B A;  4MO4 A;  2E8A A;  3TU5 A;  3VEX A;  5C15 A;  1YHQ N;  3O1B A;  4H0P A;  4YOR A;  3U9Z A;  1YJN N;  2YJE A;  3NVM A;  4EIA A;  3O8M A;  1LCU A;  3VF6 A;  4CJ7 A;  4MO5 A;  2NRX A;  2WFB A;  3TTC A;  4B1Y B;  3G25 A;  4FO0 A;  3WUH A;  1NGB A;  4JEP A;  1X3M A;  3IKM A;  3TSU A;  3VGL A;  3WXM B;  4EFH A;  3E66 A;  3DAW A;  2AP1 A;  3CET A;  5GAE P;  5FPM A;  5AFU H;  5DM6 L;  1M90 O;  2E2O A;  2GEM A;  1GLF O;  2Q31 A;  3M1F A;  4I6M A;  3ID8 A;  4IDH A;  3SMP A;  4G9Z A;  3G4S N;  4B1Z A;  4RTF D;  3VEW A;  4JKG A;  1VQ9 N;  4IOX A;  1QHA A;  3CHW A;  4Z94 A;  5HOO A;  1VQO N;  3LDL A;  3CF5 L;  4FL9 A;  2E2P A;  3KWI A;  2HOE A;  3ULE B;  4BC5 A;  2CGK A;  4BRO A;  2JWK A;  4BR2 A;  5BPN A;  1H1V A;  4CI6 A;  2BTF A;  3CPW M;  3VTH A;  3MCP A;  4FWL A;  5AQG A;  1WUA A;  3UKU A;  3WXL A;  2PBD A;  4BRD A;  4CZH A;  4CZJ A;  4DB3 A;  4DKW A;  3O1W A;  4BRI A;  3CD6 N;  3W0L A;  3UKU B;  2KKZ A;  3MCA B;  1SZ2 A;  3OBW A;  1VQN N;  1CZA N;  5M1N A;  2P9N A;  5AZJ A;  5AQF A;  3N4Q A;  2WC9 A;  5FPN A;  2ITM A;  4YOV A;  2HBK A;  2P9N B;  5AQT A;  5AZJ B;  1WOQ A;  1BA0 A;  3ZX0 A;  4AF1 A;  2QWR A;  3CCV N;  4YOY A;  1VQL N;  1ZC6 A;  4BRE A;  2ZJR L;  4AM7 A;  4IJA A;  4A5A A;  2QWN A;  3Q7C A;  3KWG A;  3H3N O;  3N4P A;  3O4W A;  4FSV A;  4A62 A;  1KAY A;  1T6D A;  5AQL A;  4BVP A;  5C2F A;  5KQ8 A;  1P8Z A;  3QFU A;  3C65 A;  1S3X A;  4WQ5 C;  4MDB A;  1LOT B;  3FR0 A;  4F9O A;  2A42 A;  3OA9 A;  3P31 A;  5GAG P;  5GIO A;  1V4T A;  1ZBS A;  1BG3 A;  5EVZ A;  4IXC A;  4MLE A;  4IO9 L;  1QVG M;  2YJF A;  3SAF A;  4HTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...