1IP9A

Solution structure of the pb1 domain of bem1p
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
85
structure length
85
Chain Sequence
b'GAMGSSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BEM1 PROTEIN
publication title Structure and ligand recognition of the PB1 domain: a novel protein module binding to the PC motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 10
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ip9A00
3ZLZA 1RAXA 2KC2A 4PS7A 5D94A 3L10B 1Q0WB 1UELA 2FIFA 2IBIB 2JZ3B 1WF9A 2BYVE 2KANA 2G4SA 2D10A 2KFJA 2O2VB 5AZFA 1OQYA 1TBEA 3DVNV 4HDOA 2I1JA 2L0FA 1RLFA 4HPLB 3U8ZA 2JF5A 3HM6X 1WR6E 4GN1A 4DHZB 2WDTB 2O2VA 4MGZE 2ZJDA 2D07B 5AZGA 4ICUA 2KD0A 4A3PA 3W1YA 3V61A 3HHMA 4LJPB 3ZUNA 4K1RB 4E74A 1FXTB 5KHQA 1OGWA 1TZ1A 1WZ0A 1WMHB 2IO2B 2L0TA 4TUUA 5E6NA 2BYEA 2HD5B 4DHJB 1YX6B 3CF6E 4E3CA 1GC7A 2IYDB 1WIAA 3DBSA 4G50A 1T0YA 2DENB 3PLUA 4XC2A 2NS5A 2JVCA 3R3MA 1H4RA 1LM8B 1J0GA 2L7RA 2M4NA 2MBQA 2MRPA 3JVZX 2NPTB 4HPMB 1SGHA 2VRRB 2KWCA 4EFOA 2KXJA 4EKUA 3H6NA 2K25A 4WJQA 4BOSC 2LGYA 3UINB 2JY6A 4IC7B 3A1QA 2NPTA 2MCNB 2KNBA 2KQ7A 5HKHA 2XK5B 3PPAA 2OJRA 4W9LA 4TQ0A 2KDIA 3QCAA 2NBUA 3M62B 3V6CB 4BBNC 1TGZB 2K6DB 4II3B 2AL6A 1BT0A 3TIXA 3ZRFA 4WJPA 1V6EA 1WJ4A 4DXAB 3VFKA 4K7UA 3W1SC 4FADA 3EECA 4IG7B 3VUYA 3UF8A 1OEYJ 3H7PB 1WE6A 3VUXA 2G45B 4AJYB 3M63B 1SIFA 2JUOA 1UZXB 1F9JA 2AL3A 3OLMD 4FJYA 3PREA 2KDBA 4WQOB 1SE9A 2LRWA 1ISNA 2KC1A 3DVGY 1WGRA 2BGFA 1U4AA 3R7RA 4HCPB 3RYTA 5JH5C 1ZKHA 3U7DA 2KTFA 4GXBA 3QIJA 2KLGA 2PE9A 2C7MB 2AEHA 4ANVA 1H8CA 1AARA 1NI2A 3L54A 3PHWB 3DBLI 2MSED 1WGGA 3S2AA 1WGHA 2JZZA 4DBGA 5J2RA 2J0KA 2LWPA 1P0RA 3VH4B 3QK0A 1P9DU 4AJWA 3PGEA 2DZIA 2CU1A 4MH0E 3ML9A 1UH6A 4ASWC 4F7ZA 4RM9A 4KIKB 4EZLA 3PSEB 3ZDMC 3PHXB 2KJ6A 3KUDB 2KJHB 3TJPA 3SHQA 3A4RA 2N9EB 3NZUA 4NPNA 3VTUA 2REXA 4WWPA 4KIKA 2BYFA 3APFA 4ZRJA 4CHKA 3PTFC 5D2MB 2MP2A 5DPTA 5JZEB 3L08A 3JSVB 3DVGX 1TTNA 1S1QB 2DZMA 3WAMA 2DX5B 2AYOB 2DZKA 4AUQC 4GDLB 4LDTB 1NDDA 2N1WA 4YL8A 2KTRB 3JSVA 5JHBA 2LVPA 3DPDA 2I1KA 1Q5WB 2MBBB 3OJ4B 1JRUA 2IY1B 3PRMB 3RULA 1YIWA 3VUWA 5L83A 1P1AA 3ENEA 3EFUA 2FAZA 4GDLA 3KVFB 4RMAA 1XT9B 4RM8A 1L2NA 2KTRA 4MSQB 1UGMA 2LGXA 2IY0B 2KZRA 3NS8A 4HXDA 4CO7A 1I42A 3GOEA 2KDEB 1V2YA 2A4ZA 2YLMA 1K8RB 1IPGA 2FCQA 4B6WA 1WY8A 3JW0X 2CHZA 2KO3A 1J8CA 4DDID 2EMSA 4WJNA 4ZDVA 3IVFA 4ANWA 4GGQA 1E8WA 3L17A 1KM7A 2BF8B 2DAFA 2M0XA 2C9WB 3PRPB 1WXAA 4LCDE 4A20A 3APDA 5D6JB 1LQBA 3DBHI 1EF5A 3V6EB 4JGHB 3B1LX 1V49A 2KKCA 3ZNHB 2C7HA 2MA9B 1Z5SB 2FCSA 3PVLA 3H7SA 3ZVVA 2WWZA 3B08A 3KYCD 5AZHA 1WE7A 2K1FA 1KLVA 1VD2A 2KWVB 2K8HA 3X23A 4DHZE 2Z59B 3NOBA 3QHTA 2AWTA 4HWIB 4BFRA 3AU5A 2IO3B 1Z2MA 4ICVA 4KDIC 1KJTA 4OVUA 4BVUC 1RRBA 1WM2A 4I6PA 2FNJB 4NJ7A 5BO4B 2R2QA 2GBRA 2K8BA 3AXCA 1WI0A 2ZNVC 1GJZA 3IG3A 2O6VD 3MHSD 4ZRKA 4KSLC 4ANXA 1XQQA 2ZEQA 1UBIA 1WMHA 3DBRI 3NHEB 4LDTD 2DZJA 3ZNZB 3AI5A 4GMVA 4EZKA 3ZKJC 1UD7A 2JWZA 3VAWA 1WYWB 1X1MA 2N4FA 2WYQA 1WXMA 2D2QA 4PS3A 5J17A 2LGDA 4WWOA 3UGBB 2GOWA 3PRZA 2KWUB 4FHKA 2GMIC 2FIDA 5EDSA 2C5LC 3R7QA 4MEMA 2NCNA 4IW0A 1GC6A 1WXVA 5CHWA 5FR6A 2XK5A 4FBJB 1Q1OA 4B95A 1E7UA 3DDCB 2RGFA 2WX0A 4ZYNA 2KHWB 2N7EA 4W9IA 3WAOA 4GDKB 1LFDA 3QX1A 4ZRIA 5CX3A 2EMTA 3H7PA 4TKNA 2LXCA 2LJ5A 4AOFA 4W9CA 3RZWC 1E7VA 3WA0A 4IM0A 1GNUA 4K7WA 4FJZA 2IO1B 3EHVA 3SU8X 3RUIB 1WM3A 1HE8A 2EKEC 4JIOU 4HK2A 2Z0EB 2ZZPB 3DVNU 2V3SA 5AEKB 3VTVA 4TQ1A 2MBHA 4NJ6A 2BKRB 3K9PB 3IFWB 4E71A 2V1YA 4JLCA 1R4NI 3ZIMA 2V4LA 4MM3A 4CYEA 2N9PC 3X0WA 2L00B 2PE6B 3HK0A 4BKGA 1OEYA 4WWNA 2N7DA 5DPSA 3T9LA 3L0WB 3ZTCA 2J7QB 2QHOA 2GBNA 1WX9A 4MGKE 1WJNA 4FN2A 4HLEA 4HVBA 2DYOA 1UBQA 3QAQA 3MJWA 4W9HA 2KFKB 5TR5A 3QARA 4JQWC 3ZRCA 2O6VB 5DCNA 1CMXB 4I6LB 1I35A 4IUMB 3DQVA 3DCGA 5LXHA 3WAPA 2KN5A 4HDQA 1P98A 1WR1A 2D11A 2PJHA 3ZTDA 2BKFA 5C1ZA 1WJ6A 3VXWA 2KMCA 2FUHB 2L05A 3LDZE 3N32A 1WXSA 2O6VA 4II2B 4B9KA 5IAAC 1E8XA 2L8JA 1V86A 3KUZA 5G55A 5LLIA 1YJ1A 1XD3B 1C3TA 3H9DA 5CHVC 2PPHA 1WX7A 4NQLB 2ZCBA 4M0WB 3NY5A 3V60A 2K8CA 2KDFB 2LASA 4FULA 3SDLC 1E90A 3PV1A 5CHFA 3L16A 3ONSA 2R2OA 4NQKE 4KZ0A 3UIPB 3KYDD 4GIVA 4I6NB 3ALBA 2ZPNA 4MGIE 2LXAA 4MJSB 4OVVA 2C7NB 2YVCA 1E5WA 2WX1A 3PT2B 2GBJA 4KV2A 1OTRB 4M8MA 2ZCCA 2GBKA 4ANUA 1ZW7A 2W9NA 4HCNB 4MJSA 1R4MI 2K39A 3OAWA 3VVWB 3WANA 3VTWA 3M95A 3CSTA 4NNJB 3AULA 2XBBC 2L3ZA 3BY4B 2XEWA 2PEAA 3VHTC 4N9F4 3D32A 2ZPYA 4GOCA 2Z0DB 3P2BA 3SD5A 1WX8A 4K7SA 2LVOA 2JPHA 1V5TA 1EF1A 4GSWA 4A3OA 4KDLB 2G4DB 2BWES 4K81A 5E6PA 3V62A 2JT4B 2M17A 3VDZA 3VQIA 5G2NA 4BKSD 1EUVB 3MTNB 4J6IA 1M94A 4MDKE 2KK8A 3ZDTA 2CHXA 2KX0A 4W9JA 3T8MA 3WALA 3HM3A 3C0RB 3K9OB 1V80A 5LXIB 2LZ6A 3A4SC 3NZSA 2D3GA 2NR2A 1LXDA 2CHWA 2Y5BB 2ZVOA 3O65B 3A9KB 2KMAA 2ZVNA 3A9JB 4G11A 3L13A 2M1MA 4NAWB 1VCBA 3EC8A 2ZNVB 2CR5A 2KVRA 3KH0A 3WIMA 4EZJA 2NVUI 3A9KA 3I3TB 3B0AA 3A9JA 4NAWA 3ZO5B 5DPRA 2K6QA 2GBMA 4BBNF 4BOZB 4F1SA 4URKA 4XX5A 1NBFC 2G3QB 3RT3B 1WGYA 2N1VA 1V9JA 4P7IA 1EO6A 4KZCA 2MBEA 1YQBA 2DHZA 2MQJA 3ECIA 3GZNI 4PYUA 4WJOA 2KQSA 4W9KA 3A1QB 4FHJA 4KSKC 4GU2A 2RD0A 1G6JA 2FCMA 3IBEA 1GG3A 2HE7A 4W9EA 2CKHB 1WH3A 3H1UA 3TCAA 3UQAA 3QWZB 3VH3B 2MLBA 3DOWA 4FA6A 5JHAA 2A5UA 3UQBA 3QQ8B 2BPSA 3RD2A 4GDKA 1E8ZA 2NBWB 4TV3A 5E6OA 3A33B 1C1YB 1P3QU 3RZFA 3W1SA 3RCZA 1ZGUB 3PS6A 3QJZA 4IWPA 4F8CB 1E8YA 3PLVA 1L7YA 2MWSB 4W9DA 3R66C 3U30A 2NBVB 1J19A 3LJ3A 3CMMB 3Q3JA 3N30A 5DPWA 3ML8A 4IWOA 4IM3A 4PYZA 3TBLD 2RR9A 3AU4A 3BINA 4G3XB 5C23A 3TL5A 3M3JA 4GB9A 4FLHA 2IZVB 4IWQA 2LD9A 1WJUA 2MW5A 4LJOB 4W9FA 4X57B 2IO0B 2M8SA 2MX2A 3ZW3A 4DDGD 2BWFA 2J0MA 1MG8A 3UIOB 4BKSA 4EOYA 1RFAA 1IP9A 1WGDA 2L76A 2KFKA 2C60A 4W9GA 5KHOA 3JYUA 2RPQA 2KJRA 2KX3A 3KUCB 4DHJD 3CSFA 4M8NA 3QC8B 3ZNGC 2MP2B 2FCNA 2LI5A 1WRDB 2RSUA 2N9XA 2LRUA 3PZDA 1V81A 2LUEA 5CTRC 1D3ZA 2UWQA 1PQSA 2MBOA 4PS8A 3ZNID 3N3KB 1GUAB 4BKTA 1QZEA 2J0JA 3APCA 4DK5A 5J18A 3TMPB 2DAJA 4AWJA 1Y8RC 2B3AA 4MGYE 2LVQA 3QA8A 4WAAA 5L95C 1KOTA 5GMVA 2OOBB 4FJVB 1S3SG 1A5RA 4XZ4A 3IHPC 5D7GA 2HTHA 1YX5B 4EUTA 4EEWA 3HIZA 4AP4C 1WZ3A 4KVGB 1YD8U 4JL9A 4NY0A 4HJKA 4MELA 4IM2A 2KLCA 2ASQA 4G0NB 3Q3FA 4DWFA 1WFYA 2HJ8A 4MSMB 5IA7A 1IYFA 2CS4A 2JRHA 3KW5B 2UYZB 2JRIB 2JXXA 2KOXA 2DYBA 2DYMA 1V5OA 3OJ3A
chains in the Genus database with same CATH superfamily
2KC2A 4PS7A 2JZ3B 1I4RA 2BYVE 2KANA 2O2VB 5AZFA 4HDOA 2JF5A 3HM6X 1ZE3D 2ZJDA 4ICUA 3AEGB 3BYYB 5KHQA 1WZ0A 2KT7A 1WMHB 2IGDA 3MC9A 1ET9A 4TUUA 2BYEA 2HD5B 4DHJB 1GC7A 2IYDB 4G50A 1T0YA 2GLSA 2NS5A 4USAA 2V4IB 2OHFA 2VRRB 3H6NA 2DNFA 4WJQA 4BOSC 2LGYA 3UINB 2MCNB 2KQ7A 1JCKB 2KQ4X 5HKHA 3DBLB 1I4PA 1TGZB 3C19A 4WJPA 1WJ4A 4DXAB 1ET6A 1TKYA 3VUYA 2V9HA 3BZDB 3VUXA 3PREA 2LRWA 2KC1A 1WGRA 2BGFA 1U4AA 1GAQB 1YJIA 4HCPB 3P4RB 1RWSA 1H8CA 4R3DA 2ICIA 2JZZA 2J0KA 2LWPA 1P9DU 3TSSA 2DZIA 1WRIA 4F7ZA 4RM9A 3PHXB 2KJ6A 2LUMA 1FD6A 3A4RA 1C4PA 2N9KA 4WWPA 1YN5A 2QCZA 3AMZA 2JYEA 5JZEB 2H89B 2DZMA 3WAMA 1FNWA 4GDLB 4LDTB 1DGJA 1SXTA 4YL8A 2LVPA 3PRMB 5G5GA 3EFUA 2FAZA 1XT9B 2BYTA 1UGMA 1TY2A 2IY0B 3NS8A 5BYQA 4CO7A 3AE2B 1IPGA 1WY8A 1FIQA 2CHZA 2UU7A 4DDID 2KVZA 1HQRD 1E8WA 2IGGA 1IGDA 3L17A 2BF8B 2C9WB 4A20A 2JWUA 3V6EB 2PLPA 3ZVVA 2FCSA 1WYGA 5EE1A 3HVDA 4DHZE 3X23A 2WHIA 2AWTA 4RFBA 3BIID 2IJ0A 2IO3B 1Z2MA 2NTTA 4I6PA 4NJ7A 2ZNVC 3NVYA 3MHSD 2WU2B 1E7PB 1WMHA 4GMVA 2K22A 3ZKJC 4MH8A 5BMIA 4PS3A 2D2QA 4TMAB 1F77A 1XLOA 2GMIC 2FIDA 5EDSA 4XWTA 1GC6A 2EKIA 4FBJB 1Q1OA 4B95A 1GB4A 3IAS1 4ZYNA 2N7EA 5CX3A 2EMTA 1ZXHA 2INDC 4AOFA 4W9CA 3MC8A 2LGSA 3RZWC 1E7VA 1GNUA 4K7WA 4FJZA 2IO1B 1YN4A 3SU8X 1VR9A 1WM3A 1K50A 3W5UB 2V3SA 1BXTA 2Y5CA 2Z8LA 1R4NI 3ZXVA 2M56B 1YJJA 4CYEA 3Q3NC 4BKGA 2PE6B 3T9LA 1TIFA 3ZTCA 2QHOA 2WXGA 3N9YC 4MGKE 1QT9A 3FILB 4HVBA 3QAQA 1UGJA 4JQWC 1CMXB 3DQVA 5GXGB 2KN5A 2WXHA 1R4MB 1WJ6A 1ESFA 3ZYYX 1FM0D 1WXSA 3N32A 1YOVB 2OEDA 1XD3B 5CHVC 1V1PA 1CJEA 2ZCBA 3NY5A 4OW0A 1PYWD 3B2GA 4XGAB 3PV1A 3ONSA 1D6EC 4KZ0A 4GIVA 2J53A 2ZPNA 2WXQA 2WX1A 4KV2A 1OTRB 2MJEA 4EE2A 3AEDB 2W9NA 4MJSA 3OAWA 5EE0A 3WANA 2AX5A 3AULA 2XBBC 3BY4B 2IGHA 2PEAA 3VHTC 1LO5D 4M00A 3D32A 1QKZA 2D3AA 4XYCA 2Z0DB 3SD5A 1WX8A 3OG5A 1GB1A 4QAYA 2JPHA 4S17A 1EF1A 4WH4A 3V62A 2AQ2B 3BWUD 3VQIA 1KTKA 1SE4A 4BKSD 1EWCA 1EUVB 3ZXRA 3AE1B 3ZDTA 3U7ZA 3C0RB 2PKOA 5LXIB 2NR2A 1LXDA 3OWEB 3NVWA 1L0YB 2D5GA 1N61A 3L13A 3EGRA 2KVRA 4P6VF 2OJWA 4EZJA 2N0SB 4RNAA 3A9JA 4BOZB 4URKA 4XX5A 1WGYA 1M4VA 1V9JA 4XDDA 3GZNI 5FK9C 4GU2A 2JXTA 5EE3A 1PFDA 4L1BA 4W9EA 2A5UA 2IDYA 3QQ8B 3UQBA 3VR9B 3RZFA 1T3QA 2INNE 3PLVA 2HJ1A 1L7YA 3R66C 2N9LA 3CMMB 3GE8C 3GE3C 3FKYA 4IM3A 1E0ZA 3AEAB 4OHJA 1HTOA 4G3XB 1PUTA 3MP9A 4FLHA 2IZVB 4WAFA 4LJOB 4X57B 4RGTA 2BWFA 1MG8A 3FILA 4EOYA 1D4BA 2L76A 4C00A 3KWVA 4YTNB 1DOYA 5D3IB 2L83A 2K3UA 4A8XC 1FO4A 1GUAB 4RGMA 3P4PB 2YEPB 3NG0A 4DK5A 1MHHE 5J18A 2DAJA 1HZ6A 2B3AA 3TUOA 1QOFA 1DOIA 1QQRA 1A5RA 2HTHA 2IPKD 2PMVA 3SFEB 2QIEB 2BS3B 4K3BA 3HIZA 2WXLA 1CZPA 3MHZA 1T0RC 1WZ3A 1YD8U 4YSXB 2LJIA 1MJDA 4HJKA 2WDVB 4MELA 2X8XX 5IA7A 2QDFA 4REZA 3V05A 4P1CC 1F2RC 1V5OA 1C77A 1KLGD 5D94A 3L10B 3DHGC 2FIFA 1ZP0B 3RNFC 2D10A 1OQYA 3U8ZA 4GN1A 4DHZB 2D07B 5AZGA 2KD0A 4A3PA 3H8HA 2WXMA 1ROEA 3KWLA 2E6XA 3ZUNA 4E74A 1FCCC 2LGIA 1MFWA 1A70A 2Y3AA 1YX6B 2VH2A 3CF6E 3DBSA 2PW9A 4ZHPA 3PLUA 1RFKA 3R3MA 1H4RA 1LM8B 2QC8A 2M4NA 4S0RA 3JVZX 4HPMB 1SSNA 4N58A 2KWCA 4J3OD 1FXIA 2ZW0A 1QOBA 4IC7B 2KNBA 3BVZA 1QOGA 3PZ8A 2KWDA 3GP7A 4W9LA 2KDIA 2WXFA 3QCAA 3V6CB 1BT0A 1V6EA 4K7UA 4MT5A 1SE2A 3EECA 4IG7B 3ZJUA 4XE0A 3H7PB 1WE6A 2VZKD 4AJYB 3OLMD 4FJYA 1F9JA 2WXPA 4HEA1 2JSVX 1SF0A 2KDBA 1SBBB 1SE9A 1ISNA 4KGTA 1ZKHA 3U7DA 2KTFA 4GXBA 4RF0A 1AARA 2KYWA 3L54A 3PHWB 2MSED 3S2AA 1XCQL 4ASWC 1YMHE 3ZDMC 2WXNA 1FMAD 4HRSA 1V1OA 2REXA 4KIKA 3NS1A 4BZAA 1D5MC 1V8CA 1RM6C 3DVGX 4IKGA 2AYOB 4AUQC 1WWTA 3JSVA 3DPDA 1Q5WB 3OJ4B 4JWSC 1YIWA 4YSZB 2KTRA 1J7CA 2SAKA 2KZRA 1YN3A 3P63A 1I42A 2KDEB 1V2YA 4UDUC 4BAXA 1IUEA 4LNKA 4KX6B 2AQ1B 1L0VB 2WDQB 3P4QB 3TEXA 1KM7A 2DAFA 2VZKB 3VRAB 4FXCA 2C7HA 1Z5SB 3H7SA 2M19A 2WWZA 4YWGG 1SJHD 3IT6B 3NOBA 3QHTA 4M01A 5HFYA 4BVUC 1KJTA 4OVUA 4D2KA 1WM2A 3BK2A 2JYTA 2FNJB 2R2QA 2WXKA 2K8BA 3AXCA 1WI0A 3MJ5A 4ZRKA 1XQQA 3DBRI 4LDTD 3NHEB 1SE3A 4MACA 1TS5A 5J17A 3HRDD 4WWOA 1PGXA 2GOWA 4WQMA 3IAM1 2QILA 2WXOA 2C5LC 3R7QA 5TSSA 4IOIE 1MVKA 4XDCA 1R4NB 5FR6A 2KN4A 1IBXA 1VZ7A 4W9IA 3LXFA 2V0GA 2FE8A 3H7PA 2LXCA 2LJ5A 4C56C 5AUIA 3RUIB 4JIOU 4HK2A 2Z0EB 2ZZPB 2BS2B 1JROA 1K51A 2V1YA 2V4LA 4MM3A 1FCLA 2N9PC 3IT4B 2GBNA 1WX9A 3RPFC 4ZRQA 4HLEA 1JWAD 4JWUC 1RYJA 4W9HA 3HVZA 1R7SA 2QSDA 3DCGA 3WAPA 4C7ZA 1P98A 2D11A 2PJHA 3ZTDA 2BKFA 5C1ZA 1V1PB 2L05A 2O6VA 1Q10A 1E8XA 1NENB 1N6ZA 1V86A 3KUZA 2PPHA 1J7AA 1SEBD 4HKZE 2KDFB 1I4XA 2HDEA 5CHFA 2WQYB 4DQOC 5T8IA 4MJSB 1TS3A 2C7NB 2RDBC 2YVCA 1XCTL 3PT2B 4US9A 4M8MA 1DYQA 2K39A 5IP4D 4YT0B 4LNIA 4NNJB 5H92C 2L3ZA 1SIJA 1AW7A 3TEWA 2BTEA 1NYRA 1HEZE 2RDGA 3DWMA 3B2FA 4A3OA 4GSWA 4KDLB 1TKEA 5G2NA 1XLQA 4PT5A 1C78A 3GZNB 2KX0A 3T8MA 3NZSA 2D3GA 3RMKC 1NVID 2Q5WD 4B0EA 3Q8FA 3DHIC 3A9JB 2WGSA 1TY0A 3WIMA 3AE5B 5DPRA 2GBMA 4BBNF 4F1SA 1ZXIA 2DWQA 2MQJA 3ECIA 2KQSA 4W9KA 1L4ZB 3IBEA 1GG3A 2HE7A 1F0ZA 2CKHB 3QWZB 3VH3B 4P16A 2K0PA 4FA6A 3NJTA 4YXDB 5JHAA 2W54A 4TV3A 3A33B 1C1YB 2W3SA 3W1SA 3QJZA 4F8CB 4IWPA 3FAHA 1UNSA 1J19A 3N30A 3ML8A 4IWOA 1JWBD 4PYZA 3BINA 5C23A 3TL5A 4HKQA 1WJUA 2GI9A 1N5WA 2EELA 2IO0B 2M8SA 2L32A 3ZW3A 4DDGD 2RPVA 3L4PA 3R8BA 3ZJTA 3JYUA 3CSFA 2KMMA 2MP2B 2FCNA 2LI5A 2LRUA 4XWWA 5HG2A 1V81A 2LUEA 2MBOA 1UWXA 3APCA 2GRIA 4OZCA 1CQVA 3DWGC 3Q3OC 4WAAA 5L95C 4FJVB 3RN9C 1S3SG 5D7GA 1YX5B 1N63A 3NUHB 4EEWA 4AP4C 4KVGB 1UF0A 4GLSC 2ASQA 3NRZA 2DBYA 3Q3FA 3KLSX 3KW5B 2UYZB 1WGKA 5HI1A 2KOXA 2DYBA 3OJ3A 4DXGA 1VDVA 3N1ZC 2IBIB 2QMTA 1TBEA 3DVNV 2I1JA 2L0FA 4HPLB 2BVCA 3HHMA 4LJPB 1KFYB 1FXTB 1TZ1A 3AM9A 2L0TA 2VH1A 1WIAA 4HROA 2DENB 4XC2A 1FFVA 1UUPA 3DHHC 2L7RA 2MRPA 3U2SC 3HUIA 4KKIA 1SGHA 3RNBC 4C4VA 2KXJA 2K25A 1YQ3B 2I2YA 3RFZB 4ZYSA 2NPTA 1FRRA 3PPAA 4TQ0A 2NBUA 3M62B 2AL6A 4KGSA 4FADA 1ZOYB 3UF8A 1OEYJ 2G45B 3M63B 3SR6A 4ZHOA 2JUOA 1UZXB 4O1NA 5JH5C 1PGBA 4K3CA 3QIJA 2KLGA 2C7MB 2AEHA 1NI2A 2X38A 4DBGA 1WGHA 2KDMA 5J2RA 1P0RA 3QK0A 4PK1A 4AJWA 3BK1A 2WP9B 3ML9A 4KIKB 4EZLA 3PSEB 4RCOA 2N9EB 3NZUA 4NPNA 3VTUA 3AECB 5I4DA 3APFA 4CHKA 5D2MB 2MP2A 5DPTA 3L08A 1ZPSA 3JSVB 2V3NA 4WIPA 1TTNA 5LNK1 5MPOA 2DZKA 2W55A 3Q2AC 3Q3MC 1NDDA 2N1WA 3EUB2 2KTRB 5JHBA 5D3DA 3ZNHB 3VR8B 2MBBB 1SB3C 3ENEA 4RMAA 4RM8A 4NZLB 1E6EB 4MSQB 2N7JA 1C9FA 3GOEA 2A4ZA 4AS1A 1TKGA 4B6WA 3JW0X 3ZJVA 4ZDVA 4ITKA 4ANWA 2G1EA 1F52A 2M0XA 4LCDE 1LQBA 3DBHI 3DBRB 1V49A 5FR3A 5JXVA 3PVLA 2JZPA 1KLVA 2K8HA 3FC4A 4ARIA 4BFRA 1FRDA 4YSYB 1WXQA 5BO4B 3CIRB 2KAJA 1GJZA 3IG3A 1TJEA 2O6VD 4KSLC 5FKAC 4ANXA 1B9RA 2DZJA 3CWIA 2PTLA 1JW9D 1XLNA 3MFGA 2JWZA 1WYWB 2CJNA 1F2RI 1X1MA 2N4FA 1WXMA 2LGDA 5HHDG 4Q2JA 1ENFA 3UGBB 2KWUB 4FHKA 2J52A 4MEMA 1IBXB 1WXVA 2K9XA 5CHWA 1JWSD 1E7UA 3DDCB 2W82A 2WX0A 5BMGA 3GS2A 1E9MA 3WAOA 3W9CB 3QX1A 4ZRIA 2HTME 2W3RA 3WA0A 4IM0A 3EHVA 2EKEC 2FUG1 5AEKB 4MM3B 3VTVA 1TZOA 2BKRB 1XEEA 3BYTB 1TYGB 1EM7A 4JLCA 3ZIMA 3RI7C 4HPPA 3X0WA 2L00B 3HK0A 1OEYA 2N7DA 1SJED 5DPSA 4RF1A 3L0WB 1EU4A 2J7QB 5BYRA 3AE3B 1WJNA 4L23A 3U4EG 5TR5A 3QARA 3ZRCA 2O6VB 4IUMB 3Q14C 4HDQA 3P4SB 3TEYA 2FUHB 2KMCA 3R2IA 3WCQA 5IAAC 3Q8EA 5LLIA 1B1ZA 1C3TA 3H9DA 2J42A 4M0WB 2K8CA 1HTQA 1E90A 2PIAA 1VJKA 4NQKE 1UWMA 2K5PA 3ALBA 4MGIE 3RNAC 3TEZA 2GBJA 2ZCCA 2GBKA 2WXJA 4ANUA 4LTUA 1ZW7A 4JX1C 2G9HD 3VVWB 4JE3B 3CSTA 3KQ4A 1GPXA 2XEWA 1KF6B 1PDXA 3P2BA 1D5XC 1NEKB 1C76A 2J4XA 3AB5A 1V5TA 1OFFA 2G4DB 2BWES 5E6PA 2JT4B 3J9CA 1JMLA 1XXGA 2WDRB 1M94A 2KK8A 5C2TB 2XN9C 2BB6A 3K9OB 1V80A 2LZ6A 2SEBD 1AYFA 2CHWA 2Y5BB 2V3PA 2KMAA 1OQRA 1KRHA 2ZNVB 1QOAA 2RDHA 3A9KA 4NAWA 3ZO5B 2K6QA 1FFUA 1NBFC 1VLBA 2G3QB 3RT3B 2N1VA 1EO6A 1YNTE 4WJOA 3N1XC 3A1QB 4FHJA 4WURA 2RD0A 1G6JA 2B76B 2MHJA 1WH3A 3TCAA 2MLBA 3DOWA 1N5XA 2FBWB 1P3QU 4AQ7A 3R2TA 1FEHA 1E8YA 2BQQA 2MWSB 4W9DA 3U30A 2NBVB 3LJ3A 5DPWA 3ZQ4A 2RR9A 4WWMA 3NZ3A 4LLGM 4GB9A 1P7EA 1C4CA 1YQ4B 2MX2A 3Q8AA 3IXSA 3N1YC 1HA5A 1N62A 1IP9A 4LNFA 2C60A 3T3OA 2KJRA 2KX3A 2MEKA 3KUCB 1FNUA 4A55A 1I7HA 3ZNGC 3W2DA 5E6JA 1BUIC 3I9V1 3PZDA 4YTPB 1L0XB 5CTRC 1D3ZA 3U52E 2UWQA 4HJGE 2KACA 4BKTA 1QZEA 2H88B 2J0JA 4TSSA 4M0WA 3AE8B 3ABVB 4OZBA 3TMPB 4AWJA 5IO9A 5C3JB 2LVQA 3QA8A 5GMVA 2OOBB 2BW2A 3BVMA 4KKJA 4EUTA 2ACZB 1EWYC 3EA6A 2PVGC 3RNEC 2Y5PA 4A9AA 3AEFB 2NMQA 2KLCA 5BMHA 4G0NB 4DWFA 1WFYA 2HJ8A 4MSMB 1IYFA 3W5VB 2JRHA 3AE9B 2DYMA 3N20C 2BBCA 3LB8C 3AV8A 2L1AA 3ZLZA 1RAXA 3SEBA 2M0AA 1Q0WB 1UELA 2KFJA 1QF6A 1WF9A 2G4SA 1RLFA 3O13A 2WLBA 1WR6E 2WDTB 2O2VA 4MGZE 3Q6BA 2TSSA 3W1YA 3V61A 2BB5A 4K1RB 1OGWA 2IO2B 5E6NA 4E3CA 2JVCA 4C4VB 1J0GA 1VZ6A 2MBQA 2NPTB 4EFOA 4EKUA 1ZDVA 3E9SA 2JY6A 3A1QA 2I38A 1I4GA 1V97A 2XK5B 3AE4B 2OJRA 4BBNC 1MI0A 1WSPA 2BT6A 2K6DB 4II3B 3TIXA 3ZRFA 3VFKA 3W1SC 3I57A 1T0SC 3GB1A 4ZRPA 1SIFA 2AL3A 1VRAB 4WQOB 3DVGY 1OQQA 1STEA 3R7RA 3RYTA 3ETRA 2PE9A 1J7BA 5EE9A 1AWDA 1MHXA 4ANVA 1L4DB 3DBLI 2PVOD 1WGGA 3VH4B 2INPE 3PGEA 4MH0E 2CU1A 1UH6A 2L52A 3KUDB 4OZAA 1HZ5A 2KJHB 3TJPA 3SHQA 1PGAA 1FXAA 2WU5B 4RH6A 2BYFA 4NAMA 4ZRJA 2MH7A 3PTFC 5G5HA 1S1QB 2DX5B 1ZUD2 1TS4A 3DBHB 5AUKA 1L5PA 2I1KA 5L83A 1JRUA 2IY1B 3RULA 3VUWA 1P1AA 4GDLA 1L2NA 3KVFB 1T5XD 2WS3B 2LGXA 4HXDA 2LFIA 3NVZA 1JWMD 2YLMA 1K8RB 2FCQA 1KH0A 1Y56A 2KO3A 1J8CA 2EMSA 4OVZA 4WJNA 1T0QC 3IVFA 4GGQA 3PRPB 1WXAA 3C8YA 3APDA 2AQ3B 5D6JB 4ACFA 1EF5A 4JGHB 3B1LX 2KKCA 4L2YA 2MA9B 3URYA 3B08A 3KYCD 3PO0A 5AZHA 1WE7A 2K1FA 2QEJC 1VD2A 2KWVB 2Z59B 1F1HA 4HWIB 2XNAC 4N59A 1ZDXA 3AU5A 4ICVA 4KDIC 1RRBA 3V3XA 3EFCA 3Q69A 2GBRA 3PZ7A 1QLBB 2ZEQA 1UBIA 3ZNZB 1JQ4A 3LYYA 3AI5A 4EZKA 1UD7A 3MC0B 3VAWA 2GB1A 4C7YA 2WYQA 3PRZA 2D3CA 2D3BA 2NCNA 4IW0A 2WNMA 1D5ZC 2XK5A 4N6EB 2BS4B 2E3TA 2RGFA 2KHWB 1JWUD 4GDKB 1LFDA 1TS2A 4TKNA 2LHDA 4LNOA 1HE8A 1T6BX 5IN7A 3DVNU 3RNCC 4TQ1A 2MBHA 4NJ6A 3K9PB 3IFWB 4E71A 2WXRA 4DXFA 3UI3A 4LNNA 4LK0M 4WWNA 4M02A 4FN2A 3E56A 2DYOA 2JQRB 1UBQA 4B0MA 3MJWA 2KFKB 1LGRA 5DCNA 4I6LB 1I35A 5LXHA 1WR1A 3AE6B 4C80A 3VXWA 3LDZE 4B9KA 4II2B 4RGOS 4ARCA 2L8JA 5G55A 1YJ1A 1WX7A 4NQLB 4A90A 3V60A 4FULA 2LASA 3SDLC 3Q8CA 1AN8A 4A6QA 3L16A 2R2OA 1ACCA 3UIPB 3KYDD 4I6NB 1MPEA 5IOIA 2LXAA 1FNVA 4OVVA 1E5WA 1QILA 1XF5L 4HCNB 1R4MI 3VTWA 3M95A 1N60A 4YTMB 2R61A 1P7FA 1EU3A 4N9F4 2ZPYA 4GOCA 1MG4A 4K7SA 3NVVA 2LVOA 4CQNA 4K81A 4P1BC 2M17A 3VDZA 2INCC 3MTNB 4J6IA 5IKCM 4MDKE 2CHXA 4W9JA 3WALA 3ZGZA 3HM3A 4NJCA 3A4SC 1CK1A 1DOXA 2ZVOA 3O65B 2CU3A 1K53A 3A9KB 4G11A 2ZVNA 4NAWB 2DLBA 4RGNA 2M1MA 1VCBA 3EC8A 2LMCA 1E10A 2CR5A 3KH0A 1FPYA 2NVUI 3I3TB 3B0AA 1K52A 4ZOHC 4P7IA 4KZCA 2MBEA 1YQBA 2DHZA 4PYUA 3P1MA 1GOZA 3Q8BA 1I4QA 2WXIA 4KSKC 1HXYD 2FCMA 3VRBB 3I5JC 1JALA 3H1UA 3UQAA 2LEKA 3P42A 2BPSA 4IDIA 3B9JA 2ZW1A 4GDKA 3RD2A 3AH7A 1E8ZA 2NBWB 5E6OA 1C4AA 2MJ3A 3RCZA 1ZGUB 3PS6A 3BVGA 3SFDB 2QJLA 4JPSA 1VZ8A 3Q3JA 2ONQA 1L6UA 3TBLD 1XLPA 4US8A 3AU4A 2NTSA 3M3JA 4IWQA 2LD9A 2MW5A 4W9FA 2J0MA 3UIOB 4BKSA 1RFAA 1KLUD 1IGCA 1WGDA 2KFKA 4W9GA 1L6VA 5KHOA 2RPQA 2YEPF 4DHJD 2ON8A 1BMLC 4M8NA 3QC8B 1NYQA 3AE7B 1WRDB 2RSUA 2N9XA 5H8YE 5BYSA 2MJDA 4PS8A 1PQSA 2LHEA 3ZNID 3N3KB 3RNGC 3AEBB 1JRPA 1Y8RC 1XO3A 3T3NA 4MGYE 1I4HA 2RMMA 1KOTA 2CJOA 4XZ4A 3I63C 3IHPC 1C79A 1NI3A 3AEEB 4H2AA 2JX5A 4JL9A 2JU6X 4NY0A 4IM2A 2CS4A 2JRIB 1TT5B 2JXXA 3AN1A 4KGRA
chains in the Genus database with same CATH topology
3ZLZA 1RAXA 2KC2A 4PS7A 5D94A 3L10B 1Q0WB 1UELA 2FIFA 2IBIB 2JZ3B 1WF9A 2BYVE 2KANA 2G4SA 2D10A 2KFJA 2O2VB 5AZFA 1OQYA 1TBEA 3DVNV 4HDOA 2I1JA 2L0FA 1RLFA 4HPLB 3U8ZA 2JF5A 3HM6X 1WR6E 4GN1A 4DHZB 2WDTB 2O2VA 4MGZE 2ZJDA 2D07B 5AZGA 4ICUA 2KD0A 4A3PA 3W1YA 3V61A 3HHMA 4LJPB 3ZUNA 4K1RB 4E74A 1FXTB 5KHQA 1OGWA 1TZ1A 1WZ0A 1WMHB 2IO2B 2L0TA 4TUUA 5E6NA 2BYEA 2HD5B 4DHJB 1YX6B 3CF6E 4E3CA 1GC7A 2IYDB 1WIAA 3DBSA 4G50A 1T0YA 2DENB 3PLUA 4XC2A 2NS5A 2JVCA 3R3MA 1H4RA 1LM8B 1J0GA 2L7RA 2M4NA 2MBQA 2MRPA 3JVZX 2NPTB 4HPMB 1SGHA 2VRRB 2KWCA 4EFOA 2KXJA 4EKUA 3H6NA 2K25A 4WJQA 4BOSC 2LGYA 3UINB 2JY6A 4IC7B 3A1QA 2NPTA 2MCNB 2KNBA 2KQ7A 5HKHA 2XK5B 3PPAA 2OJRA 4W9LA 4TQ0A 2KDIA 3QCAA 2NBUA 3M62B 3V6CB 4BBNC 1TGZB 2K6DB 4II3B 2AL6A 1BT0A 3TIXA 3ZRFA 4WJPA 1V6EA 1WJ4A 4DXAB 3VFKA 4K7UA 3W1SC 4FADA 3EECA 4IG7B 3VUYA 3UF8A 1OEYJ 3H7PB 1WE6A 3VUXA 2G45B 4AJYB 3M63B 1SIFA 2JUOA 1UZXB 1F9JA 2AL3A 3OLMD 4FJYA 3PREA 2KDBA 4WQOB 1SE9A 2LRWA 1ISNA 2KC1A 3DVGY 1WGRA 2BGFA 1U4AA 3R7RA 4HCPB 3RYTA 5JH5C 1ZKHA 3U7DA 2KTFA 4GXBA 3QIJA 2KLGA 2PE9A 2C7MB 2AEHA 4ANVA 1H8CA 1AARA 1NI2A 3L54A 3PHWB 3DBLI 2MSED 1WGGA 3S2AA 1WGHA 2JZZA 4DBGA 5J2RA 2J0KA 2LWPA 1P0RA 3VH4B 3QK0A 1P9DU 4AJWA 3PGEA 2DZIA 2CU1A 4MH0E 3ML9A 1UH6A 4ASWC 4F7ZA 4RM9A 4KIKB 4EZLA 3PSEB 3ZDMC 3PHXB 2KJ6A 3KUDB 2KJHB 3TJPA 3SHQA 3A4RA 2N9EB 3NZUA 4NPNA 3VTUA 2REXA 4WWPA 4KIKA 2BYFA 3APFA 4ZRJA 4CHKA 3PTFC 5D2MB 2MP2A 5DPTA 5JZEB 3L08A 3JSVB 3DVGX 1TTNA 1S1QB 2DZMA 3WAMA 2DX5B 2AYOB 2DZKA 4AUQC 4GDLB 4LDTB 1NDDA 2N1WA 4YL8A 2KTRB 3JSVA 5JHBA 2LVPA 3DPDA 2I1KA 1Q5WB 2MBBB 3OJ4B 1JRUA 2IY1B 3PRMB 3RULA 1YIWA 3VUWA 5L83A 1P1AA 3ENEA 3EFUA 2FAZA 4GDLA 3KVFB 4RMAA 1XT9B 4RM8A 1L2NA 2KTRA 4MSQB 1UGMA 2LGXA 2IY0B 2KZRA 3NS8A 4HXDA 4CO7A 1I42A 3GOEA 2KDEB 1V2YA 2A4ZA 2YLMA 1K8RB 1IPGA 2FCQA 4B6WA 1WY8A 3JW0X 2CHZA 2KO3A 1J8CA 4DDID 2EMSA 4WJNA 4ZDVA 3IVFA 4ANWA 4GGQA 1E8WA 3L17A 1KM7A 2BF8B 2DAFA 2M0XA 2C9WB 3PRPB 1WXAA 4LCDE 4A20A 3APDA 5D6JB 1LQBA 3DBHI 1EF5A 3V6EB 4JGHB 3B1LX 1V49A 2KKCA 3ZNHB 2C7HA 2MA9B 1Z5SB 2FCSA 3PVLA 3H7SA 3ZVVA 2WWZA 3B08A 3KYCD 5AZHA 1WE7A 2K1FA 1KLVA 1VD2A 2KWVB 2K8HA 3X23A 4DHZE 2Z59B 3NOBA 3QHTA 2AWTA 4HWIB 4BFRA 3AU5A 2IO3B 1Z2MA 4ICVA 4KDIC 1KJTA 4OVUA 4BVUC 1RRBA 1WM2A 4I6PA 2FNJB 4NJ7A 5BO4B 2R2QA 2GBRA 2K8BA 3AXCA 1WI0A 2ZNVC 1GJZA 3IG3A 2O6VD 3MHSD 4ZRKA 4KSLC 4ANXA 1XQQA 2ZEQA 1UBIA 1WMHA 3DBRI 3NHEB 4LDTD 2DZJA 3ZNZB 3AI5A 4GMVA 4EZKA 3ZKJC 1UD7A 2JWZA 3VAWA 1WYWB 1X1MA 2N4FA 2WYQA 1WXMA 2D2QA 4PS3A 5J17A 2LGDA 4WWOA 3UGBB 2GOWA 3PRZA 2KWUB 4FHKA 2GMIC 2FIDA 5EDSA 2C5LC 3R7QA 4MEMA 2NCNA 4IW0A 1GC6A 1WXVA 5CHWA 5FR6A 2XK5A 4FBJB 1Q1OA 4B95A 1E7UA 3DDCB 2RGFA 2WX0A 4ZYNA 2KHWB 2N7EA 4W9IA 3WAOA 4GDKB 1LFDA 3QX1A 4ZRIA 5CX3A 2EMTA 3H7PA 4TKNA 2LXCA 2LJ5A 4AOFA 4W9CA 3RZWC 1E7VA 3WA0A 4IM0A 1GNUA 4K7WA 4FJZA 2IO1B 3EHVA 3SU8X 3RUIB 1WM3A 1HE8A 2EKEC 4JIOU 4HK2A 2Z0EB 2ZZPB 3DVNU 2V3SA 5AEKB 3VTVA 4TQ1A 2MBHA 4NJ6A 2BKRB 3K9PB 3IFWB 4E71A 2V1YA 4JLCA 1R4NI 3ZIMA 2V4LA 4MM3A 4CYEA 2N9PC 3X0WA 2L00B 2PE6B 3HK0A 4BKGA 1OEYA 4WWNA 2N7DA 5DPSA 3T9LA 3L0WB 3ZTCA 2J7QB 2QHOA 2GBNA 1WX9A 4MGKE 1WJNA 4FN2A 4HLEA 4HVBA 2DYOA 1UBQA 3QAQA 3MJWA 4W9HA 2KFKB 5TR5A 3QARA 4JQWC 3ZRCA 2O6VB 5DCNA 1CMXB 4I6LB 1I35A 4IUMB 3DQVA 3DCGA 5LXHA 3WAPA 2KN5A 4HDQA 1P98A 1WR1A 2D11A 2PJHA 3ZTDA 2BKFA 5C1ZA 1WJ6A 3VXWA 2KMCA 2FUHB 2L05A 3LDZE 3N32A 1WXSA 2O6VA 4II2B 4B9KA 5IAAC 1E8XA 2L8JA 1V86A 3KUZA 5G55A 5LLIA 1YJ1A 1XD3B 1C3TA 3H9DA 5CHVC 2PPHA 1WX7A 4NQLB 2ZCBA 4M0WB 3NY5A 3V60A 2K8CA 2KDFB 2LASA 4FULA 3SDLC 1E90A 3PV1A 5CHFA 3L16A 3ONSA 2R2OA 4NQKE 4KZ0A 3UIPB 3KYDD 4GIVA 4I6NB 3ALBA 2ZPNA 4MGIE 2LXAA 4MJSB 4OVVA 2C7NB 2YVCA 1E5WA 2WX1A 3PT2B 2GBJA 4KV2A 1OTRB 4M8MA 2ZCCA 2GBKA 4ANUA 1ZW7A 2W9NA 4HCNB 4MJSA 1R4MI 2K39A 3OAWA 3VVWB 3WANA 3VTWA 3M95A 3CSTA 4NNJB 3AULA 2XBBC 2L3ZA 3BY4B 2XEWA 2PEAA 3VHTC 4N9F4 3D32A 2ZPYA 4GOCA 2Z0DB 3P2BA 3SD5A 1WX8A 4K7SA 2LVOA 2JPHA 1V5TA 1EF1A 4GSWA 4A3OA 4KDLB 2G4DB 2BWES 4K81A 5E6PA 3V62A 2JT4B 2M17A 3VDZA 3VQIA 5G2NA 4BKSD 1EUVB 3MTNB 4J6IA 1M94A 4MDKE 2KK8A 3ZDTA 2CHXA 2KX0A 4W9JA 3T8MA 3WALA 3HM3A 3C0RB 3K9OB 1V80A 5LXIB 2LZ6A 3A4SC 3NZSA 2D3GA 2NR2A 1LXDA 2CHWA 2Y5BB 2ZVOA 3O65B 3A9KB 2KMAA 2ZVNA 3A9JB 4G11A 3L13A 2M1MA 4NAWB 1VCBA 3EC8A 2ZNVB 2CR5A 2KVRA 3KH0A 3WIMA 4EZJA 2NVUI 3A9KA 3I3TB 3B0AA 3A9JA 4NAWA 3ZO5B 5DPRA 2K6QA 2GBMA 4BBNF 4BOZB 4F1SA 4URKA 4XX5A 1NBFC 2G3QB 3RT3B 1WGYA 2N1VA 1V9JA 4P7IA 1EO6A 4KZCA 2MBEA 1YQBA 2DHZA 2MQJA 3ECIA 3GZNI 4PYUA 4WJOA 2KQSA 4W9KA 3A1QB 4FHJA 4KSKC 4GU2A 2RD0A 1G6JA 2FCMA 3IBEA 1GG3A 2HE7A 4W9EA 2CKHB 1WH3A 3H1UA 3TCAA 3UQAA 3QWZB 3VH3B 2MLBA 3DOWA 4FA6A 5JHAA 2A5UA 3UQBA 3QQ8B 2BPSA 3RD2A 4GDKA 1E8ZA 2NBWB 4TV3A 5E6OA 3A33B 1C1YB 1P3QU 3RZFA 3W1SA 3RCZA 1ZGUB 3PS6A 3QJZA 4IWPA 4F8CB 1E8YA 3PLVA 1L7YA 2MWSB 4W9DA 3R66C 3U30A 2NBVB 1J19A 3LJ3A 3CMMB 3Q3JA 3N30A 5DPWA 3ML8A 4IWOA 4IM3A 4PYZA 3TBLD 2RR9A 3AU4A 3BINA 4G3XB 5C23A 3TL5A 3M3JA 4GB9A 4FLHA 2IZVB 4IWQA 2LD9A 1WJUA 2MW5A 4LJOB 4W9FA 4X57B 2IO0B 2M8SA 2MX2A 3ZW3A 4DDGD 2BWFA 2J0MA 1MG8A 3UIOB 4BKSA 4EOYA 1RFAA 1IP9A 1WGDA 2L76A 2KFKA 2C60A 4W9GA 5KHOA 3JYUA 2RPQA 2KJRA 2KX3A 3KUCB 4DHJD 3CSFA 4M8NA 3QC8B 3ZNGC 2MP2B 2FCNA 2LI5A 1WRDB 2RSUA 2N9XA 2LRUA 3PZDA 1V81A 2LUEA 5CTRC 1D3ZA 2UWQA 1PQSA 2MBOA 4PS8A 3ZNID 3N3KB 1GUAB 4BKTA 1QZEA 2J0JA 3APCA 4DK5A 5J18A 3TMPB 2DAJA 4AWJA 1Y8RC 2B3AA 4MGYE 2LVQA 3QA8A 4WAAA 5L95C 1KOTA 5GMVA 2OOBB 4FJVB 1S3SG 1A5RA 4XZ4A 3IHPC 5D7GA 2HTHA 1YX5B 4EUTA 4EEWA 3HIZA 4AP4C 1WZ3A 4KVGB 1YD8U 4JL9A 4NY0A 4HJKA 4MELA 4IM2A 2KLCA 2ASQA 4G0NB 3Q3FA 4DWFA 1WFYA 2HJ8A 4MSMB 5IA7A 1IYFA 2CS4A 2JRHA 3KW5B 2UYZB 2JRIB 2JXXA 2KOXA 2DYBA 2DYMA 1V5OA 3OJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZLZ A;  1RAX A;  2KC2 A;  4PS7 A;  5D94 A;  3L10 B;  1Q0W B;  1UEL A;  2FIF A;  2IBI B;  2JZ3 B;  1WF9 A;  2BYV E;  2KAN A;  2G4S A;  2D10 A;  2KFJ A;  2O2V B;  5AZF A;  1OQY A;  1TBE A;  3DVN V;  4HDO A;  2I1J A;  2L0F A;  1RLF A;  4HPL B;  3U8Z A;  2JF5 A;  3HM6 X;  1WR6 E;  4GN1 A;  4DHZ B;  2WDT B;  2O2V A;  4MGZ E;  2ZJD A;  2D07 B;  5AZG A;  4ICU A;  2KD0 A;  4A3P A;  3W1Y A;  3V61 A;  3HHM A;  4LJP B;  3ZUN A;  4K1R B;  4E74 A;  1FXT B;  5KHQ A;  1OGW A;  1TZ1 A;  1WZ0 A;  1WMH B;  2IO2 B;  2L0T A;  4TUU A;  5E6N A;  2BYE A;  2HD5 B;  4DHJ B;  1YX6 B;  3CF6 E;  4E3C A;  1GC7 A;  2IYD B;  1WIA A;  3DBS A;  4G50 A;  1T0Y A;  2DEN B;  3PLU A;  4XC2 A;  2NS5 A;  2JVC A;  3R3M A;  1H4R A;  1LM8 B;  1J0G A;  2L7R A;  2M4N A;  2MBQ A;  2MRP A;  3JVZ X;  2NPT B;  4HPM B;  1SGH A;  2VRR B;  2KWC A;  4EFO A;  2KXJ A;  4EKU A;  3H6N A;  2K25 A;  4WJQ A;  4BOS C;  2LGY A;  3UIN B;  2JY6 A;  4IC7 B;  3A1Q A;  2NPT A;  2MCN B;  2KNB A;  2KQ7 A;  5HKH A;  2XK5 B;  3PPA A;  2OJR A;  4W9L A;  4TQ0 A;  2KDI A;  3QCA A;  2NBU A;  3M62 B;  3V6C B;  4BBN C;  1TGZ B;  2K6D B;  4II3 B;  2AL6 A;  1BT0 A;  3TIX A;  3ZRF A;  4WJP A;  1V6E A;  1WJ4 A;  4DXA B;  3VFK A;  4K7U A;  3W1S C;  4FAD A;  3EEC A;  4IG7 B;  3VUY A;  3UF8 A;  1OEY J;  3H7P B;  1WE6 A;  3VUX A;  2G45 B;  4AJY B;  3M63 B;  1SIF A;  2JUO A;  1UZX B;  1F9J A;  2AL3 A;  3OLM D;  4FJY A;  3PRE A;  2KDB A;  4WQO B;  1SE9 A;  2LRW A;  1ISN A;  2KC1 A;  3DVG Y;  1WGR A;  2BGF A;  1U4A A;  3R7R A;  4HCP B;  3RYT A;  5JH5 C;  1ZKH A;  3U7D A;  2KTF A;  4GXB A;  3QIJ A;  2KLG A;  2PE9 A;  2C7M B;  2AEH A;  4ANV A;  1H8C A;  1AAR A;  1NI2 A;  3L54 A;  3PHW B;  3DBL I;  2MSE D;  1WGG A;  3S2A A;  1WGH A;  2JZZ A;  4DBG A;  5J2R A;  2J0K A;  2LWP A;  1P0R A;  3VH4 B;  3QK0 A;  1P9D U;  4AJW A;  3PGE A;  2DZI A;  2CU1 A;  4MH0 E;  3ML9 A;  1UH6 A;  4ASW C;  4F7Z A;  4RM9 A;  4KIK B;  4EZL A;  3PSE B;  3ZDM C;  3PHX B;  2KJ6 A;  3KUD B;  2KJH B;  3TJP A;  3SHQ A;  3A4R A;  2N9E B;  3NZU A;  4NPN A;  3VTU A;  2REX A;  4WWP A;  4KIK A;  2BYF A;  3APF A;  4ZRJ A;  4CHK A;  3PTF C;  5D2M B;  2MP2 A;  5DPT A;  5JZE B;  3L08 A;  3JSV B;  3DVG X;  1TTN A;  1S1Q B;  2DZM A;  3WAM A;  2DX5 B;  2AYO B;  2DZK A;  4AUQ C;  4GDL B;  4LDT B;  1NDD A;  2N1W A;  4YL8 A;  2KTR B;  3JSV A;  5JHB A;  2LVP A;  3DPD A;  2I1K A;  1Q5W B;  2MBB B;  3OJ4 B;  1JRU A;  2IY1 B;  3PRM B;  3RUL A;  1YIW A;  3VUW A;  5L83 A;  1P1A A;  3ENE A;  3EFU A;  2FAZ A;  4GDL A;  3KVF B;  4RMA A;  1XT9 B;  4RM8 A;  1L2N A;  2KTR A;  4MSQ B;  1UGM A;  2LGX A;  2IY0 B;  2KZR A;  3NS8 A;  4HXD A;  4CO7 A;  1I42 A;  3GOE A;  2KDE B;  1V2Y A;  2A4Z A;  2YLM A;  1K8R B;  1IPG A;  2FCQ A;  4B6W A;  1WY8 A;  3JW0 X;  2CHZ A;  2KO3 A;  1J8C A;  4DDI D;  2EMS A;  4WJN A;  4ZDV A;  3IVF A;  4ANW A;  4GGQ A;  1E8W A;  3L17 A;  1KM7 A;  2BF8 B;  2DAF A;  2M0X A;  2C9W B;  3PRP B;  1WXA A;  4LCD E;  4A20 A;  3APD A;  5D6J B;  1LQB A;  3DBH I;  1EF5 A;  3V6E B;  4JGH B;  3B1L X;  1V49 A;  2KKC A;  3ZNH B;  2C7H A;  2MA9 B;  1Z5S B;  2FCS A;  3PVL A;  3H7S A;  3ZVV A;  2WWZ A;  3B08 A;  3KYC D;  5AZH A;  1WE7 A;  2K1F A;  1KLV A;  1VD2 A;  2KWV B;  2K8H A;  3X23 A;  4DHZ E;  2Z59 B;  3NOB A;  3QHT A;  2AWT A;  4HWI B;  4BFR A;  3AU5 A;  2IO3 B;  1Z2M A;  4ICV A;  4KDI C;  1KJT A;  4OVU A;  4BVU C;  1RRB A;  1WM2 A;  4I6P A;  2FNJ B;  4NJ7 A;  5BO4 B;  2R2Q A;  2GBR A;  2K8B A;  3AXC A;  1WI0 A;  2ZNV C;  1GJZ A;  3IG3 A;  2O6V D;  3MHS D;  4ZRK A;  4KSL C;  4ANX A;  1XQQ A;  2ZEQ A;  1UBI A;  1WMH A;  3DBR I;  3NHE B;  4LDT D;  2DZJ A;  3ZNZ B;  3AI5 A;  4GMV A;  4EZK A;  3ZKJ C;  1UD7 A;  2JWZ A;  3VAW A;  1WYW B;  1X1M A;  2N4F A;  2WYQ A;  1WXM A;  2D2Q A;  4PS3 A;  5J17 A;  2LGD A;  4WWO A;  3UGB B;  2GOW A;  3PRZ A;  2KWU B;  4FHK A;  2GMI C;  2FID A;  5EDS A;  2C5L C;  3R7Q A;  4MEM A;  2NCN A;  4IW0 A;  1GC6 A;  1WXV A;  5CHW A;  5FR6 A;  2XK5 A;  4FBJ B;  1Q1O A;  4B95 A;  1E7U A;  3DDC B;  2RGF A;  2WX0 A;  4ZYN A;  2KHW B;  2N7E A;  4W9I A;  3WAO A;  4GDK B;  1LFD A;  3QX1 A;  4ZRI A;  5CX3 A;  2EMT A;  3H7P A;  4TKN A;  2LXC A;  2LJ5 A;  4AOF A;  4W9C A;  3RZW C;  1E7V A;  3WA0 A;  4IM0 A;  1GNU A;  4K7W A;  4FJZ A;  2IO1 B;  3EHV A;  3SU8 X;  3RUI B;  1WM3 A;  1HE8 A;  2EKE C;  4JIO U;  4HK2 A;  2Z0E B;  2ZZP B;  3DVN U;  2V3S A;  5AEK B;  3VTV A;  4TQ1 A;  2MBH A;  4NJ6 A;  2BKR B;  3K9P B;  3IFW B;  4E71 A;  2V1Y A;  4JLC A;  1R4N I;  3ZIM A;  2V4L A;  4MM3 A;  4CYE A;  2N9P C;  3X0W A;  2L00 B;  2PE6 B;  3HK0 A;  4BKG A;  1OEY A;  4WWN A;  2N7D A;  5DPS A;  3T9L A;  3L0W B;  3ZTC A;  2J7Q B;  2QHO A;  2GBN A;  1WX9 A;  4MGK E;  1WJN A;  4FN2 A;  4HLE A;  4HVB A;  2DYO A;  1UBQ A;  3QAQ A;  3MJW A;  4W9H A;  2KFK B;  5TR5 A;  3QAR A;  4JQW C;  3ZRC A;  2O6V B;  5DCN A;  1CMX B;  4I6L B;  1I35 A;  4IUM B;  3DQV A;  3DCG A;  5LXH A;  3WAP A;  2KN5 A;  4HDQ A;  1P98 A;  1WR1 A;  2D11 A;  2PJH A;  3ZTD A;  2BKF A;  5C1Z A;  1WJ6 A;  3VXW A;  2KMC A;  2FUH B;  2L05 A;  3LDZ E;  3N32 A;  1WXS A;  2O6V A;  4II2 B;  4B9K A;  5IAA C;  1E8X A;  2L8J A;  1V86 A;  3KUZ A;  5G55 A;  5LLI A;  1YJ1 A;  1XD3 B;  1C3T A;  3H9D A;  5CHV C;  2PPH A;  1WX7 A;  4NQL B;  2ZCB A;  4M0W B;  3NY5 A;  3V60 A;  2K8C A;  2KDF B;  2LAS A;  4FUL A;  3SDL C;  1E90 A;  3PV1 A;  5CHF A;  3L16 A;  3ONS A;  2R2O A;  4NQK E;  4KZ0 A;  3UIP B;  3KYD D;  4GIV A;  4I6N B;  3ALB A;  2ZPN A;  4MGI E;  2LXA A;  4MJS B;  4OVV A;  2C7N B;  2YVC A;  1E5W A;  2WX1 A;  3PT2 B;  2GBJ A;  4KV2 A;  1OTR B;  4M8M A;  2ZCC A;  2GBK A;  4ANU A;  1ZW7 A;  2W9N A;  4HCN B;  4MJS A;  1R4M I;  2K39 A;  3OAW A;  3VVW B;  3WAN A;  3VTW A;  3M95 A;  3CST A;  4NNJ B;  3AUL A;  2XBB C;  2L3Z A;  3BY4 B;  2XEW A;  2PEA A;  3VHT C;  4N9F 4;  3D32 A;  2ZPY A;  4GOC A;  2Z0D B;  3P2B A;  3SD5 A;  1WX8 A;  4K7S A;  2LVO A;  2JPH A;  1V5T A;  1EF1 A;  4GSW A;  4A3O A;  4KDL B;  2G4D B;  2BWE S;  4K81 A;  5E6P A;  3V62 A;  2JT4 B;  2M17 A;  3VDZ A;  3VQI A;  5G2N A;  4BKS D;  1EUV B;  3MTN B;  4J6I A;  1M94 A;  4MDK E;  2KK8 A;  3ZDT A;  2CHX A;  2KX0 A;  4W9J A;  3T8M A;  3WAL A;  3HM3 A;  3C0R B;  3K9O B;  1V80 A;  5LXI B;  2LZ6 A;  3A4S C;  3NZS A;  2D3G A;  2NR2 A;  1LXD A;  2CHW A;  2Y5B B;  2ZVO A;  3O65 B;  3A9K B;  2KMA A;  2ZVN A;  3A9J B;  4G11 A;  3L13 A;  2M1M A;  4NAW B;  1VCB A;  3EC8 A;  2ZNV B;  2CR5 A;  2KVR A;  3KH0 A;  3WIM A;  4EZJ A;  2NVU I;  3A9K A;  3I3T B;  3B0A A;  3A9J A;  4NAW A;  3ZO5 B;  5DPR A;  2K6Q A;  2GBM A;  4BBN F;  4BOZ B;  4F1S A;  4URK A;  4XX5 A;  1NBF C;  2G3Q B;  3RT3 B;  1WGY A;  2N1V A;  1V9J A;  4P7I A;  1EO6 A;  4KZC A;  2MBE A;  1YQB A;  2DHZ A;  2MQJ A;  3ECI A;  3GZN I;  4PYU A;  4WJO A;  2KQS A;  4W9K A;  3A1Q B;  4FHJ A;  4KSK C;  4GU2 A;  2RD0 A;  1G6J A;  2FCM A;  3IBE A;  1GG3 A;  2HE7 A;  4W9E A;  2CKH B;  1WH3 A;  3H1U A;  3TCA A;  3UQA A;  3QWZ B;  3VH3 B;  2MLB A;  3DOW A;  4FA6 A;  5JHA A;  2A5U A;  3UQB A;  3QQ8 B;  2BPS A;  3RD2 A;  4GDK A;  1E8Z A;  2NBW B;  4TV3 A;  5E6O A;  3A33 B;  1C1Y B;  1P3Q U;  3RZF A;  3W1S A;  3RCZ A;  1ZGU B;  3PS6 A;  3QJZ A;  4IWP A;  4F8C B;  1E8Y A;  3PLV A;  1L7Y A;  2MWS B;  4W9D A;  3R66 C;  3U30 A;  2NBV B;  1J19 A;  3LJ3 A;  3CMM B;  3Q3J A;  3N30 A;  5DPW A;  3ML8 A;  4IWO A;  4IM3 A;  4PYZ A;  3TBL D;  2RR9 A;  3AU4 A;  3BIN A;  4G3X B;  5C23 A;  3TL5 A;  3M3J A;  4GB9 A;  4FLH A;  2IZV B;  4IWQ A;  2LD9 A;  1WJU A;  2MW5 A;  4LJO B;  4W9F A;  4X57 B;  2IO0 B;  2M8S A;  2MX2 A;  3ZW3 A;  4DDG D;  2BWF A;  2J0M A;  1MG8 A;  3UIO B;  4BKS A;  4EOY A;  1RFA A;  1IP9 A;  1WGD A;  2L76 A;  2KFK A;  2C60 A;  4W9G A;  5KHO A;  3JYU A;  2RPQ A;  2KJR A;  2KX3 A;  3KUC B;  4DHJ D;  3CSF A;  4M8N A;  3QC8 B;  3ZNG C;  2MP2 B;  2FCN A;  2LI5 A;  1WRD B;  2RSU A;  2N9X A;  2LRU A;  3PZD A;  1V81 A;  2LUE A;  5CTR C;  1D3Z A;  2UWQ A;  1PQS A;  2MBO A;  4PS8 A;  3ZNI D;  3N3K B;  1GUA B;  4BKT A;  1QZE A;  2J0J A;  3APC A;  4DK5 A;  5J18 A;  3TMP B;  2DAJ A;  4AWJ A;  1Y8R C;  2B3A A;  4MGY E;  2LVQ A;  3QA8 A;  4WAA A;  5L95 C;  1KOT A;  5GMV A;  2OOB B;  4FJV B;  1S3S G;  1A5R A;  4XZ4 A;  3IHP C;  5D7G A;  2HTH A;  1YX5 B;  4EUT A;  4EEW A;  3HIZ A;  4AP4 C;  1WZ3 A;  4KVG B;  1YD8 U;  4JL9 A;  4NY0 A;  4HJK A;  4MEL A;  4IM2 A;  2KLC A;  2ASQ A;  4G0N B;  3Q3F A;  4DWF A;  1WFY A;  2HJ8 A;  4MSM B;  5IA7 A;  1IYF A;  2CS4 A;  2JRH A;  3KW5 B;  2UYZ B;  2JRI B;  2JXX A;  2KOX A;  2DYB A;  2DYM A;  1V5O A;  3OJ3 A; 
#chains in the Genus database with same CATH topology
 2KC2 A;  4PS7 A;  2JZ3 B;  1I4R A;  2BYV E;  2KAN A;  2O2V B;  5AZF A;  4HDO A;  2JF5 A;  3HM6 X;  1ZE3 D;  2ZJD A;  4ICU A;  3AEG B;  3BYY B;  5KHQ A;  1WZ0 A;  2KT7 A;  1WMH B;  2IGD A;  3MC9 A;  1ET9 A;  4TUU A;  2BYE A;  2HD5 B;  4DHJ B;  1GC7 A;  2IYD B;  4G50 A;  1T0Y A;  2GLS A;  2NS5 A;  4USA A;  2V4I B;  2OHF A;  2VRR B;  3H6N A;  2DNF A;  4WJQ A;  4BOS C;  2LGY A;  3UIN B;  2MCN B;  2KQ7 A;  1JCK B;  2KQ4 X;  5HKH A;  3DBL B;  1I4P A;  1TGZ B;  3C19 A;  4WJP A;  1WJ4 A;  4DXA B;  1ET6 A;  1TKY A;  3VUY A;  2V9H A;  3BZD B;  3VUX A;  3PRE A;  2LRW A;  2KC1 A;  1WGR A;  2BGF A;  1U4A A;  1GAQ B;  1YJI A;  4HCP B;  3P4R B;  1RWS A;  1H8C A;  4R3D A;  2ICI A;  2JZZ A;  2J0K A;  2LWP A;  1P9D U;  3TSS A;  2DZI A;  1WRI A;  4F7Z A;  4RM9 A;  3PHX B;  2KJ6 A;  2LUM A;  1FD6 A;  3A4R A;  1C4P A;  2N9K A;  4WWP A;  1YN5 A;  2QCZ A;  3AMZ A;  2JYE A;  5JZE B;  2H89 B;  2DZM A;  3WAM A;  1FNW A;  4GDL B;  4LDT B;  1DGJ A;  1SXT A;  4YL8 A;  2LVP A;  3PRM B;  5G5G A;  3EFU A;  2FAZ A;  1XT9 B;  2BYT A;  1UGM A;  1TY2 A;  2IY0 B;  3NS8 A;  5BYQ A;  4CO7 A;  3AE2 B;  1IPG A;  1WY8 A;  1FIQ A;  2CHZ A;  2UU7 A;  4DDI D;  2KVZ A;  1HQR D;  1E8W A;  2IGG A;  1IGD A;  3L17 A;  2BF8 B;  2C9W B;  4A20 A;  2JWU A;  3V6E B;  2PLP A;  3ZVV A;  2FCS A;  1WYG A;  5EE1 A;  3HVD A;  4DHZ E;  3X23 A;  2WHI A;  2AWT A;  4RFB A;  3BII D;  2IJ0 A;  2IO3 B;  1Z2M A;  2NTT A;  4I6P A;  4NJ7 A;  2ZNV C;  3NVY A;  3MHS D;  2WU2 B;  1E7P B;  1WMH A;  4GMV A;  2K22 A;  3ZKJ C;  4MH8 A;  5BMI A;  4PS3 A;  2D2Q A;  4TMA B;  1F77 A;  1XLO A;  2GMI C;  2FID A;  5EDS A;  4XWT A;  1GC6 A;  2EKI A;  4FBJ B;  1Q1O A;  4B95 A;  1GB4 A;  3IAS 1;  4ZYN A;  2N7E A;  5CX3 A;  2EMT A;  1ZXH A;  2IND C;  4AOF A;  4W9C A;  3MC8 A;  2LGS A;  3RZW C;  1E7V A;  1GNU A;  4K7W A;  4FJZ A;  2IO1 B;  1YN4 A;  3SU8 X;  1VR9 A;  1WM3 A;  1K50 A;  3W5U B;  2V3S A;  1BXT A;  2Y5C A;  2Z8L A;  1R4N I;  3ZXV A;  2M56 B;  1YJJ A;  4CYE A;  3Q3N C;  4BKG A;  2PE6 B;  3T9L A;  1TIF A;  3ZTC A;  2QHO A;  2WXG A;  3N9Y C;  4MGK E;  1QT9 A;  3FIL B;  4HVB A;  3QAQ A;  1UGJ A;  4JQW C;  1CMX B;  3DQV A;  5GXG B;  2KN5 A;  2WXH A;  1R4M B;  1WJ6 A;  1ESF A;  3ZYY X;  1FM0 D;  1WXS A;  3N32 A;  1YOV B;  2OED A;  1XD3 B;  5CHV C;  1V1P A;  1CJE A;  2ZCB A;  3NY5 A;  4OW0 A;  1PYW D;  3B2G A;  4XGA B;  3PV1 A;  3ONS A;  1D6E C;  4KZ0 A;  4GIV A;  2J53 A;  2ZPN A;  2WXQ A;  2WX1 A;  4KV2 A;  1OTR B;  2MJE A;  4EE2 A;  3AED B;  2W9N A;  4MJS A;  3OAW A;  5EE0 A;  3WAN A;  2AX5 A;  3AUL A;  2XBB C;  3BY4 B;  2IGH A;  2PEA A;  3VHT C;  1LO5 D;  4M00 A;  3D32 A;  1QKZ A;  2D3A A;  4XYC A;  2Z0D B;  3SD5 A;  1WX8 A;  3OG5 A;  1GB1 A;  4QAY A;  2JPH A;  4S17 A;  1EF1 A;  4WH4 A;  3V62 A;  2AQ2 B;  3BWU D;  3VQI A;  1KTK A;  1SE4 A;  4BKS D;  1EWC A;  1EUV B;  3ZXR A;  3AE1 B;  3ZDT A;  3U7Z A;  3C0R B;  2PKO A;  5LXI B;  2NR2 A;  1LXD A;  3OWE B;  3NVW A;  1L0Y B;  2D5G A;  1N61 A;  3L13 A;  3EGR A;  2KVR A;  4P6V F;  2OJW A;  4EZJ A;  2N0S B;  4RNA A;  3A9J A;  4BOZ B;  4URK A;  4XX5 A;  1WGY A;  1M4V A;  1V9J A;  4XDD A;  3GZN I;  5FK9 C;  4GU2 A;  2JXT A;  5EE3 A;  1PFD A;  4L1B A;  4W9E A;  2A5U A;  2IDY A;  3QQ8 B;  3UQB A;  3VR9 B;  3RZF A;  1T3Q A;  2INN E;  3PLV A;  2HJ1 A;  1L7Y A;  3R66 C;  2N9L A;  3CMM B;  3GE8 C;  3GE3 C;  3FKY A;  4IM3 A;  1E0Z A;  3AEA B;  4OHJ A;  1HTO A;  4G3X B;  1PUT A;  3MP9 A;  4FLH A;  2IZV B;  4WAF A;  4LJO B;  4X57 B;  4RGT A;  2BWF A;  1MG8 A;  3FIL A;  4EOY A;  1D4B A;  2L76 A;  4C00 A;  3KWV A;  4YTN B;  1DOY A;  5D3I B;  2L83 A;  2K3U A;  4A8X C;  1FO4 A;  1GUA B;  4RGM A;  3P4P B;  2YEP B;  3NG0 A;  4DK5 A;  1MHH E;  5J18 A;  2DAJ A;  1HZ6 A;  2B3A A;  3TUO A;  1QOF A;  1DOI A;  1QQR A;  1A5R A;  2HTH A;  2IPK D;  2PMV A;  3SFE B;  2QIE B;  2BS3 B;  4K3B A;  3HIZ A;  2WXL A;  1CZP A;  3MHZ A;  1T0R C;  1WZ3 A;  1YD8 U;  4YSX B;  2LJI A;  1MJD A;  4HJK A;  2WDV B;  4MEL A;  2X8X X;  5IA7 A;  2QDF A;  4REZ A;  3V05 A;  4P1C C;  1F2R C;  1V5O A;  1C77 A;  1KLG D;  5D94 A;  3L10 B;  3DHG C;  2FIF A;  1ZP0 B;  3RNF C;  2D10 A;  1OQY A;  3U8Z A;  4GN1 A;  4DHZ B;  2D07 B;  5AZG A;  2KD0 A;  4A3P A;  3H8H A;  2WXM A;  1ROE A;  3KWL A;  2E6X A;  3ZUN A;  4E74 A;  1FCC C;  2LGI A;  1MFW A;  1A70 A;  2Y3A A;  1YX6 B;  2VH2 A;  3CF6 E;  3DBS A;  2PW9 A;  4ZHP A;  3PLU A;  1RFK A;  3R3M A;  1H4R A;  1LM8 B;  2QC8 A;  2M4N A;  4S0R A;  3JVZ X;  4HPM B;  1SSN A;  4N58 A;  2KWC A;  4J3O D;  1FXI A;  2ZW0 A;  1QOB A;  4IC7 B;  2KNB A;  3BVZ A;  1QOG A;  3PZ8 A;  2KWD A;  3GP7 A;  4W9L A;  2KDI A;  2WXF A;  3QCA A;  3V6C B;  1BT0 A;  1V6E A;  4K7U A;  4MT5 A;  1SE2 A;  3EEC A;  4IG7 B;  3ZJU A;  4XE0 A;  3H7P B;  1WE6 A;  2VZK D;  4AJY B;  3OLM D;  4FJY A;  1F9J A;  2WXP A;  4HEA 1;  2JSV X;  1SF0 A;  2KDB A;  1SBB B;  1SE9 A;  1ISN A;  4KGT A;  1ZKH A;  3U7D A;  2KTF A;  4GXB A;  4RF0 A;  1AAR A;  2KYW A;  3L54 A;  3PHW B;  2MSE D;  3S2A A;  1XCQ L;  4ASW C;  1YMH E;  3ZDM C;  2WXN A;  1FMA D;  4HRS A;  1V1O A;  2REX A;  4KIK A;  3NS1 A;  4BZA A;  1D5M C;  1V8C A;  1RM6 C;  3DVG X;  4IKG A;  2AYO B;  4AUQ C;  1WWT A;  3JSV A;  3DPD A;  1Q5W B;  3OJ4 B;  4JWS C;  1YIW A;  4YSZ B;  2KTR A;  1J7C A;  2SAK A;  2KZR A;  1YN3 A;  3P63 A;  1I42 A;  2KDE B;  1V2Y A;  4UDU C;  4BAX A;  1IUE A;  4LNK A;  4KX6 B;  2AQ1 B;  1L0V B;  2WDQ B;  3P4Q B;  3TEX A;  1KM7 A;  2DAF A;  2VZK B;  3VRA B;  4FXC A;  2C7H A;  1Z5S B;  3H7S A;  2M19 A;  2WWZ A;  4YWG G;  1SJH D;  3IT6 B;  3NOB A;  3QHT A;  4M01 A;  5HFY A;  4BVU C;  1KJT A;  4OVU A;  4D2K A;  1WM2 A;  3BK2 A;  2JYT A;  2FNJ B;  2R2Q A;  2WXK A;  2K8B A;  3AXC A;  1WI0 A;  3MJ5 A;  4ZRK A;  1XQQ A;  3DBR I;  4LDT D;  3NHE B;  1SE3 A;  4MAC A;  1TS5 A;  5J17 A;  3HRD D;  4WWO A;  1PGX A;  2GOW A;  4WQM A;  3IAM 1;  2QIL A;  2WXO A;  2C5L C;  3R7Q A;  5TSS A;  4IOI E;  1MVK A;  4XDC A;  1R4N B;  5FR6 A;  2KN4 A;  1IBX A;  1VZ7 A;  4W9I A;  3LXF A;  2V0G A;  2FE8 A;  3H7P A;  2LXC A;  2LJ5 A;  4C56 C;  5AUI A;  3RUI B;  4JIO U;  4HK2 A;  2Z0E B;  2ZZP B;  2BS2 B;  1JRO A;  1K51 A;  2V1Y A;  2V4L A;  4MM3 A;  1FCL A;  2N9P C;  3IT4 B;  2GBN A;  1WX9 A;  3RPF C;  4ZRQ A;  4HLE A;  1JWA D;  4JWU C;  1RYJ A;  4W9H A;  3HVZ A;  1R7S A;  2QSD A;  3DCG A;  3WAP A;  4C7Z A;  1P98 A;  2D11 A;  2PJH A;  3ZTD A;  2BKF A;  5C1Z A;  1V1P B;  2L05 A;  2O6V A;  1Q10 A;  1E8X A;  1NEN B;  1N6Z A;  1V86 A;  3KUZ A;  2PPH A;  1J7A A;  1SEB D;  4HKZ E;  2KDF B;  1I4X A;  2HDE A;  5CHF A;  2WQY B;  4DQO C;  5T8I A;  4MJS B;  1TS3 A;  2C7N B;  2RDB C;  2YVC A;  1XCT L;  3PT2 B;  4US9 A;  4M8M A;  1DYQ A;  2K39 A;  5IP4 D;  4YT0 B;  4LNI A;  4NNJ B;  5H92 C;  2L3Z A;  1SIJ A;  1AW7 A;  3TEW A;  2BTE A;  1NYR A;  1HEZ E;  2RDG A;  3DWM A;  3B2F A;  4A3O A;  4GSW A;  4KDL B;  1TKE A;  5G2N A;  1XLQ A;  4PT5 A;  1C78 A;  3GZN B;  2KX0 A;  3T8M A;  3NZS A;  2D3G A;  3RMK C;  1NVI D;  2Q5W D;  4B0E A;  3Q8F A;  3DHI C;  3A9J B;  2WGS A;  1TY0 A;  3WIM A;  3AE5 B;  5DPR A;  2GBM A;  4BBN F;  4F1S A;  1ZXI A;  2DWQ A;  2MQJ A;  3ECI A;  2KQS A;  4W9K A;  1L4Z B;  3IBE A;  1GG3 A;  2HE7 A;  1F0Z A;  2CKH B;  3QWZ B;  3VH3 B;  4P16 A;  2K0P A;  4FA6 A;  3NJT A;  4YXD B;  5JHA A;  2W54 A;  4TV3 A;  3A33 B;  1C1Y B;  2W3S A;  3W1S A;  3QJZ A;  4F8C B;  4IWP A;  3FAH A;  1UNS A;  1J19 A;  3N30 A;  3ML8 A;  4IWO A;  1JWB D;  4PYZ A;  3BIN A;  5C23 A;  3TL5 A;  4HKQ A;  1WJU A;  2GI9 A;  1N5W A;  2EEL A;  2IO0 B;  2M8S A;  2L32 A;  3ZW3 A;  4DDG D;  2RPV A;  3L4P A;  3R8B A;  3ZJT A;  3JYU A;  3CSF A;  2KMM A;  2MP2 B;  2FCN A;  2LI5 A;  2LRU A;  4XWW A;  5HG2 A;  1V81 A;  2LUE A;  2MBO A;  1UWX A;  3APC A;  2GRI A;  4OZC A;  1CQV A;  3DWG C;  3Q3O C;  4WAA A;  5L95 C;  4FJV B;  3RN9 C;  1S3S G;  5D7G A;  1YX5 B;  1N63 A;  3NUH B;  4EEW A;  4AP4 C;  4KVG B;  1UF0 A;  4GLS C;  2ASQ A;  3NRZ A;  2DBY A;  3Q3F A;  3KLS X;  3KW5 B;  2UYZ B;  1WGK A;  5HI1 A;  2KOX A;  2DYB A;  3OJ3 A;  4DXG A;  1VDV A;  3N1Z C;  2IBI B;  2QMT A;  1TBE A;  3DVN V;  2I1J A;  2L0F A;  4HPL B;  2BVC A;  3HHM A;  4LJP B;  1KFY B;  1FXT B;  1TZ1 A;  3AM9 A;  2L0T A;  2VH1 A;  1WIA A;  4HRO A;  2DEN B;  4XC2 A;  1FFV A;  1UUP A;  3DHH C;  2L7R A;  2MRP A;  3U2S C;  3HUI A;  4KKI A;  1SGH A;  3RNB C;  4C4V A;  2KXJ A;  2K25 A;  1YQ3 B;  2I2Y A;  3RFZ B;  4ZYS A;  2NPT A;  1FRR A;  3PPA A;  4TQ0 A;  2NBU A;  3M62 B;  2AL6 A;  4KGS A;  4FAD A;  1ZOY B;  3UF8 A;  1OEY J;  2G45 B;  3M63 B;  3SR6 A;  4ZHO A;  2JUO A;  1UZX B;  4O1N A;  5JH5 C;  1PGB A;  4K3C A;  3QIJ A;  2KLG A;  2C7M B;  2AEH A;  1NI2 A;  2X38 A;  4DBG A;  1WGH A;  2KDM A;  5J2R A;  1P0R A;  3QK0 A;  4PK1 A;  4AJW A;  3BK1 A;  2WP9 B;  3ML9 A;  4KIK B;  4EZL A;  3PSE B;  4RCO A;  2N9E B;  3NZU A;  4NPN A;  3VTU A;  3AEC B;  5I4D A;  3APF A;  4CHK A;  5D2M B;  2MP2 A;  5DPT A;  3L08 A;  1ZPS A;  3JSV B;  2V3N A;  4WIP A;  1TTN A;  5LNK 1;  5MPO A;  2DZK A;  2W55 A;  3Q2A C;  3Q3M C;  1NDD A;  2N1W A;  3EUB 2;  2KTR B;  5JHB A;  5D3D A;  3ZNH B;  3VR8 B;  2MBB B;  1SB3 C;  3ENE A;  4RMA A;  4RM8 A;  4NZL B;  1E6E B;  4MSQ B;  2N7J A;  1C9F A;  3GOE A;  2A4Z A;  4AS1 A;  1TKG A;  4B6W A;  3JW0 X;  3ZJV A;  4ZDV A;  4ITK A;  4ANW A;  2G1E A;  1F52 A;  2M0X A;  4LCD E;  1LQB A;  3DBH I;  3DBR B;  1V49 A;  5FR3 A;  5JXV A;  3PVL A;  2JZP A;  1KLV A;  2K8H A;  3FC4 A;  4ARI A;  4BFR A;  1FRD A;  4YSY B;  1WXQ A;  5BO4 B;  3CIR B;  2KAJ A;  1GJZ A;  3IG3 A;  1TJE A;  2O6V D;  4KSL C;  5FKA C;  4ANX A;  1B9R A;  2DZJ A;  3CWI A;  2PTL A;  1JW9 D;  1XLN A;  3MFG A;  2JWZ A;  1WYW B;  2CJN A;  1F2R I;  1X1M A;  2N4F A;  1WXM A;  2LGD A;  5HHD G;  4Q2J A;  1ENF A;  3UGB B;  2KWU B;  4FHK A;  2J52 A;  4MEM A;  1IBX B;  1WXV A;  2K9X A;  5CHW A;  1JWS D;  1E7U A;  3DDC B;  2W82 A;  2WX0 A;  5BMG A;  3GS2 A;  1E9M A;  3WAO A;  3W9C B;  3QX1 A;  4ZRI A;  2HTM E;  2W3R A;  3WA0 A;  4IM0 A;  3EHV A;  2EKE C;  2FUG 1;  5AEK B;  4MM3 B;  3VTV A;  1TZO A;  2BKR B;  1XEE A;  3BYT B;  1TYG B;  1EM7 A;  4JLC A;  3ZIM A;  3RI7 C;  4HPP A;  3X0W A;  2L00 B;  3HK0 A;  1OEY A;  2N7D A;  1SJE D;  5DPS A;  4RF1 A;  3L0W B;  1EU4 A;  2J7Q B;  5BYR A;  3AE3 B;  1WJN A;  4L23 A;  3U4E G;  5TR5 A;  3QAR A;  3ZRC A;  2O6V B;  4IUM B;  3Q14 C;  4HDQ A;  3P4S B;  3TEY A;  2FUH B;  2KMC A;  3R2I A;  3WCQ A;  5IAA C;  3Q8E A;  5LLI A;  1B1Z A;  1C3T A;  3H9D A;  2J42 A;  4M0W B;  2K8C A;  1HTQ A;  1E90 A;  2PIA A;  1VJK A;  4NQK E;  1UWM A;  2K5P A;  3ALB A;  4MGI E;  3RNA C;  3TEZ A;  2GBJ A;  2ZCC A;  2GBK A;  2WXJ A;  4ANU A;  4LTU A;  1ZW7 A;  4JX1 C;  2G9H D;  3VVW B;  4JE3 B;  3CST A;  3KQ4 A;  1GPX A;  2XEW A;  1KF6 B;  1PDX A;  3P2B A;  1D5X C;  1NEK B;  1C76 A;  2J4X A;  3AB5 A;  1V5T A;  1OFF A;  2G4D B;  2BWE S;  5E6P A;  2JT4 B;  3J9C A;  1JML A;  1XXG A;  2WDR B;  1M94 A;  2KK8 A;  5C2T B;  2XN9 C;  2BB6 A;  3K9O B;  1V80 A;  2LZ6 A;  2SEB D;  1AYF A;  2CHW A;  2Y5B B;  2V3P A;  2KMA A;  1OQR A;  1KRH A;  2ZNV B;  1QOA A;  2RDH A;  3A9K A;  4NAW A;  3ZO5 B;  2K6Q A;  1FFU A;  1NBF C;  1VLB A;  2G3Q B;  3RT3 B;  2N1V A;  1EO6 A;  1YNT E;  4WJO A;  3N1X C;  3A1Q B;  4FHJ A;  4WUR A;  2RD0 A;  1G6J A;  2B76 B;  2MHJ A;  1WH3 A;  3TCA A;  2MLB A;  3DOW A;  1N5X A;  2FBW B;  1P3Q U;  4AQ7 A;  3R2T A;  1FEH A;  1E8Y A;  2BQQ A;  2MWS B;  4W9D A;  3U30 A;  2NBV B;  3LJ3 A;  5DPW A;  3ZQ4 A;  2RR9 A;  4WWM A;  3NZ3 A;  4LLG M;  4GB9 A;  1P7E A;  1C4C A;  1YQ4 B;  2MX2 A;  3Q8A A;  3IXS A;  3N1Y C;  1HA5 A;  1N62 A;  1IP9 A;  4LNF A;  2C60 A;  3T3O A;  2KJR A;  2KX3 A;  2MEK A;  3KUC B;  1FNU A;  4A55 A;  1I7H A;  3ZNG C;  3W2D A;  5E6J A;  1BUI C;  3I9V 1;  3PZD A;  4YTP B;  1L0X B;  5CTR C;  1D3Z A;  3U52 E;  2UWQ A;  4HJG E;  2KAC A;  4BKT A;  1QZE A;  2H88 B;  2J0J A;  4TSS A;  4M0W A;  3AE8 B;  3ABV B;  4OZB A;  3TMP B;  4AWJ A;  5IO9 A;  5C3J B;  2LVQ A;  3QA8 A;  5GMV A;  2OOB B;  2BW2 A;  3BVM A;  4KKJ A;  4EUT A;  2ACZ B;  1EWY C;  3EA6 A;  2PVG C;  3RNE C;  2Y5P A;  4A9A A;  3AEF B;  2NMQ A;  2KLC A;  5BMH A;  4G0N B;  4DWF A;  1WFY A;  2HJ8 A;  4MSM B;  1IYF A;  3W5V B;  2JRH A;  3AE9 B;  2DYM A;  3N20 C;  2BBC A;  3LB8 C;  3AV8 A;  2L1A A;  3ZLZ A;  1RAX A;  3SEB A;  2M0A A;  1Q0W B;  1UEL A;  2KFJ A;  1QF6 A;  1WF9 A;  2G4S A;  1RLF A;  3O13 A;  2WLB A;  1WR6 E;  2WDT B;  2O2V A;  4MGZ E;  3Q6B A;  2TSS A;  3W1Y A;  3V61 A;  2BB5 A;  4K1R B;  1OGW A;  2IO2 B;  5E6N A;  4E3C A;  2JVC A;  4C4V B;  1J0G A;  1VZ6 A;  2MBQ A;  2NPT B;  4EFO A;  4EKU A;  1ZDV A;  3E9S A;  2JY6 A;  3A1Q A;  2I38 A;  1I4G A;  1V97 A;  2XK5 B;  3AE4 B;  2OJR A;  4BBN C;  1MI0 A;  1WSP A;  2BT6 A;  2K6D B;  4II3 B;  3TIX A;  3ZRF A;  3VFK A;  3W1S C;  3I57 A;  1T0S C;  3GB1 A;  4ZRP A;  1SIF A;  2AL3 A;  1VRA B;  4WQO B;  3DVG Y;  1OQQ A;  1STE A;  3R7R A;  3RYT A;  3ETR A;  2PE9 A;  1J7B A;  5EE9 A;  1AWD A;  1MHX A;  4ANV A;  1L4D B;  3DBL I;  2PVO D;  1WGG A;  3VH4 B;  2INP E;  3PGE A;  4MH0 E;  2CU1 A;  1UH6 A;  2L52 A;  3KUD B;  4OZA A;  1HZ5 A;  2KJH B;  3TJP A;  3SHQ A;  1PGA A;  1FXA A;  2WU5 B;  4RH6 A;  2BYF A;  4NAM A;  4ZRJ A;  2MH7 A;  3PTF C;  5G5H A;  1S1Q B;  2DX5 B;  1ZUD 2;  1TS4 A;  3DBH B;  5AUK A;  1L5P A;  2I1K A;  5L83 A;  1JRU A;  2IY1 B;  3RUL A;  3VUW A;  1P1A A;  4GDL A;  1L2N A;  3KVF B;  1T5X D;  2WS3 B;  2LGX A;  4HXD A;  2LFI A;  3NVZ A;  1JWM D;  2YLM A;  1K8R B;  2FCQ A;  1KH0 A;  1Y56 A;  2KO3 A;  1J8C A;  2EMS A;  4OVZ A;  4WJN A;  1T0Q C;  3IVF A;  4GGQ A;  3PRP B;  1WXA A;  3C8Y A;  3APD A;  2AQ3 B;  5D6J B;  4ACF A;  1EF5 A;  4JGH B;  3B1L X;  2KKC A;  4L2Y A;  2MA9 B;  3URY A;  3B08 A;  3KYC D;  3PO0 A;  5AZH A;  1WE7 A;  2K1F A;  2QEJ C;  1VD2 A;  2KWV B;  2Z59 B;  1F1H A;  4HWI B;  2XNA C;  4N59 A;  1ZDX A;  3AU5 A;  4ICV A;  4KDI C;  1RRB A;  3V3X A;  3EFC A;  3Q69 A;  2GBR A;  3PZ7 A;  1QLB B;  2ZEQ A;  1UBI A;  3ZNZ B;  1JQ4 A;  3LYY A;  3AI5 A;  4EZK A;  1UD7 A;  3MC0 B;  3VAW A;  2GB1 A;  4C7Y A;  2WYQ A;  3PRZ A;  2D3C A;  2D3B A;  2NCN A;  4IW0 A;  2WNM A;  1D5Z C;  2XK5 A;  4N6E B;  2BS4 B;  2E3T A;  2RGF A;  2KHW B;  1JWU D;  4GDK B;  1LFD A;  1TS2 A;  4TKN A;  2LHD A;  4LNO A;  1HE8 A;  1T6B X;  5IN7 A;  3DVN U;  3RNC C;  4TQ1 A;  2MBH A;  4NJ6 A;  3K9P B;  3IFW B;  4E71 A;  2WXR A;  4DXF A;  3UI3 A;  4LNN A;  4LK0 M;  4WWN A;  4M02 A;  4FN2 A;  3E56 A;  2DYO A;  2JQR B;  1UBQ A;  4B0M A;  3MJW A;  2KFK B;  1LGR A;  5DCN A;  4I6L B;  1I35 A;  5LXH A;  1WR1 A;  3AE6 B;  4C80 A;  3VXW A;  3LDZ E;  4B9K A;  4II2 B;  4RGO S;  4ARC A;  2L8J A;  5G55 A;  1YJ1 A;  1WX7 A;  4NQL B;  4A90 A;  3V60 A;  4FUL A;  2LAS A;  3SDL C;  3Q8C A;  1AN8 A;  4A6Q A;  3L16 A;  2R2O A;  1ACC A;  3UIP B;  3KYD D;  4I6N B;  1MPE A;  5IOI A;  2LXA A;  1FNV A;  4OVV A;  1E5W A;  1QIL A;  1XF5 L;  4HCN B;  1R4M I;  3VTW A;  3M95 A;  1N60 A;  4YTM B;  2R61 A;  1P7F A;  1EU3 A;  4N9F 4;  2ZPY A;  4GOC A;  1MG4 A;  4K7S A;  3NVV A;  2LVO A;  4CQN A;  4K81 A;  4P1B C;  2M17 A;  3VDZ A;  2INC C;  3MTN B;  4J6I A;  5IKC M;  4MDK E;  2CHX A;  4W9J A;  3WAL A;  3ZGZ A;  3HM3 A;  4NJC A;  3A4S C;  1CK1 A;  1DOX A;  2ZVO A;  3O65 B;  2CU3 A;  1K53 A;  3A9K B;  4G11 A;  2ZVN A;  4NAW B;  2DLB A;  4RGN A;  2M1M A;  1VCB A;  3EC8 A;  2LMC A;  1E10 A;  2CR5 A;  3KH0 A;  1FPY A;  2NVU I;  3I3T B;  3B0A A;  1K52 A;  4ZOH C;  4P7I A;  4KZC A;  2MBE A;  1YQB A;  2DHZ A;  4PYU A;  3P1M A;  1GOZ A;  3Q8B A;  1I4Q A;  2WXI A;  4KSK C;  1HXY D;  2FCM A;  3VRB B;  3I5J C;  1JAL A;  3H1U A;  3UQA A;  2LEK A;  3P42 A;  2BPS A;  4IDI A;  3B9J A;  2ZW1 A;  4GDK A;  3RD2 A;  3AH7 A;  1E8Z A;  2NBW B;  5E6O A;  1C4A A;  2MJ3 A;  3RCZ A;  1ZGU B;  3PS6 A;  3BVG A;  3SFD B;  2QJL A;  4JPS A;  1VZ8 A;  3Q3J A;  2ONQ A;  1L6U A;  3TBL D;  1XLP A;  4US8 A;  3AU4 A;  2NTS A;  3M3J A;  4IWQ A;  2LD9 A;  2MW5 A;  4W9F A;  2J0M A;  3UIO B;  4BKS A;  1RFA A;  1KLU D;  1IGC A;  1WGD A;  2KFK A;  4W9G A;  1L6V A;  5KHO A;  2RPQ A;  2YEP F;  4DHJ D;  2ON8 A;  1BML C;  4M8N A;  3QC8 B;  1NYQ A;  3AE7 B;  1WRD B;  2RSU A;  2N9X A;  5H8Y E;  5BYS A;  2MJD A;  4PS8 A;  1PQS A;  2LHE A;  3ZNI D;  3N3K B;  3RNG C;  3AEB B;  1JRP A;  1Y8R C;  1XO3 A;  3T3N A;  4MGY E;  1I4H A;  2RMM A;  1KOT A;  2CJO A;  4XZ4 A;  3I63 C;  3IHP C;  1C79 A;  1NI3 A;  3AEE B;  4H2A A;  2JX5 A;  4JL9 A;  2JU6 X;  4NY0 A;  4IM2 A;  2CS4 A;  2JRI B;  1TT5 B;  2JXX A;  3AN1 A;  4KGR A; 
#chains in the Genus database with same CATH homology
 3ZLZ A;  1RAX A;  2KC2 A;  4PS7 A;  5D94 A;  3L10 B;  1Q0W B;  1UEL A;  2FIF A;  2IBI B;  2JZ3 B;  1WF9 A;  2BYV E;  2KAN A;  2G4S A;  2D10 A;  2KFJ A;  2O2V B;  5AZF A;  1OQY A;  1TBE A;  3DVN V;  4HDO A;  2I1J A;  2L0F A;  1RLF A;  4HPL B;  3U8Z A;  2JF5 A;  3HM6 X;  1WR6 E;  4GN1 A;  4DHZ B;  2WDT B;  2O2V A;  4MGZ E;  2ZJD A;  2D07 B;  5AZG A;  4ICU A;  2KD0 A;  4A3P A;  3W1Y A;  3V61 A;  3HHM A;  4LJP B;  3ZUN A;  4K1R B;  4E74 A;  1FXT B;  5KHQ A;  1OGW A;  1TZ1 A;  1WZ0 A;  1WMH B;  2IO2 B;  2L0T A;  4TUU A;  5E6N A;  2BYE A;  2HD5 B;  4DHJ B;  1YX6 B;  3CF6 E;  4E3C A;  1GC7 A;  2IYD B;  1WIA A;  3DBS A;  4G50 A;  1T0Y A;  2DEN B;  3PLU A;  4XC2 A;  2NS5 A;  2JVC A;  3R3M A;  1H4R A;  1LM8 B;  1J0G A;  2L7R A;  2M4N A;  2MBQ A;  2MRP A;  3JVZ X;  2NPT B;  4HPM B;  1SGH A;  2VRR B;  2KWC A;  4EFO A;  2KXJ A;  4EKU A;  3H6N A;  2K25 A;  4WJQ A;  4BOS C;  2LGY A;  3UIN B;  2JY6 A;  4IC7 B;  3A1Q A;  2NPT A;  2MCN B;  2KNB A;  2KQ7 A;  5HKH A;  2XK5 B;  3PPA A;  2OJR A;  4W9L A;  4TQ0 A;  2KDI A;  3QCA A;  2NBU A;  3M62 B;  3V6C B;  4BBN C;  1TGZ B;  2K6D B;  4II3 B;  2AL6 A;  1BT0 A;  3TIX A;  3ZRF A;  4WJP A;  1V6E A;  1WJ4 A;  4DXA B;  3VFK A;  4K7U A;  3W1S C;  4FAD A;  3EEC A;  4IG7 B;  3VUY A;  3UF8 A;  1OEY J;  3H7P B;  1WE6 A;  3VUX A;  2G45 B;  4AJY B;  3M63 B;  1SIF A;  2JUO A;  1UZX B;  1F9J A;  2AL3 A;  3OLM D;  4FJY A;  3PRE A;  2KDB A;  4WQO B;  1SE9 A;  2LRW A;  1ISN A;  2KC1 A;  3DVG Y;  1WGR A;  2BGF A;  1U4A A;  3R7R A;  4HCP B;  3RYT A;  5JH5 C;  1ZKH A;  3U7D A;  2KTF A;  4GXB A;  3QIJ A;  2KLG A;  2PE9 A;  2C7M B;  2AEH A;  4ANV A;  1H8C A;  1AAR A;  1NI2 A;  3L54 A;  3PHW B;  3DBL I;  2MSE D;  1WGG A;  3S2A A;  1WGH A;  2JZZ A;  4DBG A;  5J2R A;  2J0K A;  2LWP A;  1P0R A;  3VH4 B;  3QK0 A;  1P9D U;  4AJW A;  3PGE A;  2DZI A;  2CU1 A;  4MH0 E;  3ML9 A;  1UH6 A;  4ASW C;  4F7Z A;  4RM9 A;  4KIK B;  4EZL A;  3PSE B;  3ZDM C;  3PHX B;  2KJ6 A;  3KUD B;  2KJH B;  3TJP A;  3SHQ A;  3A4R A;  2N9E B;  3NZU A;  4NPN A;  3VTU A;  2REX A;  4WWP A;  4KIK A;  2BYF A;  3APF A;  4ZRJ A;  4CHK A;  3PTF C;  5D2M B;  2MP2 A;  5DPT A;  5JZE B;  3L08 A;  3JSV B;  3DVG X;  1TTN A;  1S1Q B;  2DZM A;  3WAM A;  2DX5 B;  2AYO B;  2DZK A;  4AUQ C;  4GDL B;  4LDT B;  1NDD A;  2N1W A;  4YL8 A;  2KTR B;  3JSV A;  5JHB A;  2LVP A;  3DPD A;  2I1K A;  1Q5W B;  2MBB B;  3OJ4 B;  1JRU A;  2IY1 B;  3PRM B;  3RUL A;  1YIW A;  3VUW A;  5L83 A;  1P1A A;  3ENE A;  3EFU A;  2FAZ A;  4GDL A;  3KVF B;  4RMA A;  1XT9 B;  4RM8 A;  1L2N A;  2KTR A;  4MSQ B;  1UGM A;  2LGX A;  2IY0 B;  2KZR A;  3NS8 A;  4HXD A;  4CO7 A;  1I42 A;  3GOE A;  2KDE B;  1V2Y A;  2A4Z A;  2YLM A;  1K8R B;  1IPG A;  2FCQ A;  4B6W A;  1WY8 A;  3JW0 X;  2CHZ A;  2KO3 A;  1J8C A;  4DDI D;  2EMS A;  4WJN A;  4ZDV A;  3IVF A;  4ANW A;  4GGQ A;  1E8W A;  3L17 A;  1KM7 A;  2BF8 B;  2DAF A;  2M0X A;  2C9W B;  3PRP B;  1WXA A;  4LCD E;  4A20 A;  3APD A;  5D6J B;  1LQB A;  3DBH I;  1EF5 A;  3V6E B;  4JGH B;  3B1L X;  1V49 A;  2KKC A;  3ZNH B;  2C7H A;  2MA9 B;  1Z5S B;  2FCS A;  3PVL A;  3H7S A;  3ZVV A;  2WWZ A;  3B08 A;  3KYC D;  5AZH A;  1WE7 A;  2K1F A;  1KLV A;  1VD2 A;  2KWV B;  2K8H A;  3X23 A;  4DHZ E;  2Z59 B;  3NOB A;  3QHT A;  2AWT A;  4HWI B;  4BFR A;  3AU5 A;  2IO3 B;  1Z2M A;  4ICV A;  4KDI C;  1KJT A;  4OVU A;  4BVU C;  1RRB A;  1WM2 A;  4I6P A;  2FNJ B;  4NJ7 A;  5BO4 B;  2R2Q A;  2GBR A;  2K8B A;  3AXC A;  1WI0 A;  2ZNV C;  1GJZ A;  3IG3 A;  2O6V D;  3MHS D;  4ZRK A;  4KSL C;  4ANX A;  1XQQ A;  2ZEQ A;  1UBI A;  1WMH A;  3DBR I;  3NHE B;  4LDT D;  2DZJ A;  3ZNZ B;  3AI5 A;  4GMV A;  4EZK A;  3ZKJ C;  1UD7 A;  2JWZ A;  3VAW A;  1WYW B;  1X1M A;  2N4F A;  2WYQ A;  1WXM A;  2D2Q A;  4PS3 A;  5J17 A;  2LGD A;  4WWO A;  3UGB B;  2GOW A;  3PRZ A;  2KWU B;  4FHK A;  2GMI C;  2FID A;  5EDS A;  2C5L C;  3R7Q A;  4MEM A;  2NCN A;  4IW0 A;  1GC6 A;  1WXV A;  5CHW A;  5FR6 A;  2XK5 A;  4FBJ B;  1Q1O A;  4B95 A;  1E7U A;  3DDC B;  2RGF A;  2WX0 A;  4ZYN A;  2KHW B;  2N7E A;  4W9I A;  3WAO A;  4GDK B;  1LFD A;  3QX1 A;  4ZRI A;  5CX3 A;  2EMT A;  3H7P A;  4TKN A;  2LXC A;  2LJ5 A;  4AOF A;  4W9C A;  3RZW C;  1E7V A;  3WA0 A;  4IM0 A;  1GNU A;  4K7W A;  4FJZ A;  2IO1 B;  3EHV A;  3SU8 X;  3RUI B;  1WM3 A;  1HE8 A;  2EKE C;  4JIO U;  4HK2 A;  2Z0E B;  2ZZP B;  3DVN U;  2V3S A;  5AEK B;  3VTV A;  4TQ1 A;  2MBH A;  4NJ6 A;  2BKR B;  3K9P B;  3IFW B;  4E71 A;  2V1Y A;  4JLC A;  1R4N I;  3ZIM A;  2V4L A;  4MM3 A;  4CYE A;  2N9P C;  3X0W A;  2L00 B;  2PE6 B;  3HK0 A;  4BKG A;  1OEY A;  4WWN A;  2N7D A;  5DPS A;  3T9L A;  3L0W B;  3ZTC A;  2J7Q B;  2QHO A;  2GBN A;  1WX9 A;  4MGK E;  1WJN A;  4FN2 A;  4HLE A;  4HVB A;  2DYO A;  1UBQ A;  3QAQ A;  3MJW A;  4W9H A;  2KFK B;  5TR5 A;  3QAR A;  4JQW C;  3ZRC A;  2O6V B;  5DCN A;  1CMX B;  4I6L B;  1I35 A;  4IUM B;  3DQV A;  3DCG A;  5LXH A;  3WAP A;  2KN5 A;  4HDQ A;  1P98 A;  1WR1 A;  2D11 A;  2PJH A;  3ZTD A;  2BKF A;  5C1Z A;  1WJ6 A;  3VXW A;  2KMC A;  2FUH B;  2L05 A;  3LDZ E;  3N32 A;  1WXS A;  2O6V A;  4II2 B;  4B9K A;  5IAA C;  1E8X A;  2L8J A;  1V86 A;  3KUZ A;  5G55 A;  5LLI A;  1YJ1 A;  1XD3 B;  1C3T A;  3H9D A;  5CHV C;  2PPH A;  1WX7 A;  4NQL B;  2ZCB A;  4M0W B;  3NY5 A;  3V60 A;  2K8C A;  2KDF B;  2LAS A;  4FUL A;  3SDL C;  1E90 A;  3PV1 A;  5CHF A;  3L16 A;  3ONS A;  2R2O A;  4NQK E;  4KZ0 A;  3UIP B;  3KYD D;  4GIV A;  4I6N B;  3ALB A;  2ZPN A;  4MGI E;  2LXA A;  4MJS B;  4OVV A;  2C7N B;  2YVC A;  1E5W A;  2WX1 A;  3PT2 B;  2GBJ A;  4KV2 A;  1OTR B;  4M8M A;  2ZCC A;  2GBK A;  4ANU A;  1ZW7 A;  2W9N A;  4HCN B;  4MJS A;  1R4M I;  2K39 A;  3OAW A;  3VVW B;  3WAN A;  3VTW A;  3M95 A;  3CST A;  4NNJ B;  3AUL A;  2XBB C;  2L3Z A;  3BY4 B;  2XEW A;  2PEA A;  3VHT C;  4N9F 4;  3D32 A;  2ZPY A;  4GOC A;  2Z0D B;  3P2B A;  3SD5 A;  1WX8 A;  4K7S A;  2LVO A;  2JPH A;  1V5T A;  1EF1 A;  4GSW A;  4A3O A;  4KDL B;  2G4D B;  2BWE S;  4K81 A;  5E6P A;  3V62 A;  2JT4 B;  2M17 A;  3VDZ A;  3VQI A;  5G2N A;  4BKS D;  1EUV B;  3MTN B;  4J6I A;  1M94 A;  4MDK E;  2KK8 A;  3ZDT A;  2CHX A;  2KX0 A;  4W9J A;  3T8M A;  3WAL A;  3HM3 A;  3C0R B;  3K9O B;  1V80 A;  5LXI B;  2LZ6 A;  3A4S C;  3NZS A;  2D3G A;  2NR2 A;  1LXD A;  2CHW A;  2Y5B B;  2ZVO A;  3O65 B;  3A9K B;  2KMA A;  2ZVN A;  3A9J B;  4G11 A;  3L13 A;  2M1M A;  4NAW B;  1VCB A;  3EC8 A;  2ZNV B;  2CR5 A;  2KVR A;  3KH0 A;  3WIM A;  4EZJ A;  2NVU I;  3A9K A;  3I3T B;  3B0A A;  3A9J A;  4NAW A;  3ZO5 B;  5DPR A;  2K6Q A;  2GBM A;  4BBN F;  4BOZ B;  4F1S A;  4URK A;  4XX5 A;  1NBF C;  2G3Q B;  3RT3 B;  1WGY A;  2N1V A;  1V9J A;  4P7I A;  1EO6 A;  4KZC A;  2MBE A;  1YQB A;  2DHZ A;  2MQJ A;  3ECI A;  3GZN I;  4PYU A;  4WJO A;  2KQS A;  4W9K A;  3A1Q B;  4FHJ A;  4KSK C;  4GU2 A;  2RD0 A;  1G6J A;  2FCM A;  3IBE A;  1GG3 A;  2HE7 A;  4W9E A;  2CKH B;  1WH3 A;  3H1U A;  3TCA A;  3UQA A;  3QWZ B;  3VH3 B;  2MLB A;  3DOW A;  4FA6 A;  5JHA A;  2A5U A;  3UQB A;  3QQ8 B;  2BPS A;  3RD2 A;  4GDK A;  1E8Z A;  2NBW B;  4TV3 A;  5E6O A;  3A33 B;  1C1Y B;  1P3Q U;  3RZF A;  3W1S A;  3RCZ A;  1ZGU B;  3PS6 A;  3QJZ A;  4IWP A;  4F8C B;  1E8Y A;  3PLV A;  1L7Y A;  2MWS B;  4W9D A;  3R66 C;  3U30 A;  2NBV B;  1J19 A;  3LJ3 A;  3CMM B;  3Q3J A;  3N30 A;  5DPW A;  3ML8 A;  4IWO A;  4IM3 A;  4PYZ A;  3TBL D;  2RR9 A;  3AU4 A;  3BIN A;  4G3X B;  5C23 A;  3TL5 A;  3M3J A;  4GB9 A;  4FLH A;  2IZV B;  4IWQ A;  2LD9 A;  1WJU A;  2MW5 A;  4LJO B;  4W9F A;  4X57 B;  2IO0 B;  2M8S A;  2MX2 A;  3ZW3 A;  4DDG D;  2BWF A;  2J0M A;  1MG8 A;  3UIO B;  4BKS A;  4EOY A;  1RFA A;  1IP9 A;  1WGD A;  2L76 A;  2KFK A;  2C60 A;  4W9G A;  5KHO A;  3JYU A;  2RPQ A;  2KJR A;  2KX3 A;  3KUC B;  4DHJ D;  3CSF A;  4M8N A;  3QC8 B;  3ZNG C;  2MP2 B;  2FCN A;  2LI5 A;  1WRD B;  2RSU A;  2N9X A;  2LRU A;  3PZD A;  1V81 A;  2LUE A;  5CTR C;  1D3Z A;  2UWQ A;  1PQS A;  2MBO A;  4PS8 A;  3ZNI D;  3N3K B;  1GUA B;  4BKT A;  1QZE A;  2J0J A;  3APC A;  4DK5 A;  5J18 A;  3TMP B;  2DAJ A;  4AWJ A;  1Y8R C;  2B3A A;  4MGY E;  2LVQ A;  3QA8 A;  4WAA A;  5L95 C;  1KOT A;  5GMV A;  2OOB B;  4FJV B;  1S3S G;  1A5R A;  4XZ4 A;  3IHP C;  5D7G A;  2HTH A;  1YX5 B;  4EUT A;  4EEW A;  3HIZ A;  4AP4 C;  1WZ3 A;  4KVG B;  1YD8 U;  4JL9 A;  4NY0 A;  4HJK A;  4MEL A;  4IM2 A;  2KLC A;  2ASQ A;  4G0N B;  3Q3F A;  4DWF A;  1WFY A;  2HJ8 A;  4MSM B;  5IA7 A;  1IYF A;  2CS4 A;  2JRH A;  3KW5 B;  2UYZ B;  2JRI B;  2JXX A;  2KOX A;  2DYB A;  2DYM A;  1V5O A;  3OJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...