1IY6A

Solution structure of omsvp3 variant, p14c/n39c
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
AVSVDCSEYPKCACTMEYRPLCGSDNKTYGNKCNFCCAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitory Specificity Change of Ovomucoid Third Domain of the Silver Pheasant upon Introduction of an Engineered Cys14-Cys39 Bond
pubmed doi rcsb
molecule keywords OMSVP3
molecule tags Hydrolase
source organism Lophura nycthemera
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1iy6A00
1IY5A 2JYYA 2KMRA 2BUSA 1SGDI 1OVOA 1H0ZA 2XRCA 1SGYI 2LEOA 2QQDA 3QTLD 1UUCA 1NUBA 3B4VC 1CHOI 1CT4I 1CSOI 1PJUA 1M8CA 1UVFA 1PPFI 2KMQA 5JHWC 1SGEI 2SGDI 2B0UC 1SGRI 4GI3C 2SGEI 1DS3I 3SEKC 2SGQI 2GKRI 2ARPF 2P6AC 2GKTI 1Y1CA 1HDLA 2SGFI 3OVOA 1TUSA 4HGUA 1MT1A 1Y1BA 2V53A 1CT2I 4OVOA 1TIHA 2NU4I 1M8BA 2F3CI 2KMOA 3SGBI 2KCXA 1SGNI 1UVGA 1IY6A 1HPTA 2M5XA 1FYBA 2NU1I 2ERWA 2SGPI 1CT0I 2NU3I 2KMPA 1YTPA 5DAEA 2QQCA 1TBRR 1KMAA 1LR9A 2N71A 2WCYA 1LR8A 2NU0I 1OYVI 2GKVA 3TJQA 1PCEA 1CGII 1CGJI 1IW4A 2NU2I 3SGQI 1LR7A 2JZMA 1TURA 1SGPI 1BMOA 2N17A 1BUSA 1Z7KB 1R0RI 1DS2I 1N13A 3HH2C 2N52A 2OVOA 1HJAI 2JXDA 1TGSI 1OMUA 1YU6C 1OMTA 1SGQI 4SGBI 1TBQR 1AN1I 1CE3A
chains in the Genus database with same CATH superfamily
2GVIA 1V1IA 2FNFX 1IY5A 3UFFA 1WGCA 1VDDA 2JYYA 2KMRA 2V1CA 3OXGA 1P9ZA 2BUSA 5J8CA 1SGDI 2GIVA 1OVOA 2RIJA 5E3QA 1H0ZA 2X3TA 2XRCA 4FKDA 1SGYI 1K7TA 2LEOA 2QQDA 1MJ9A 3QTLD 3R5DA 1UUCA 1NUBA 2J9RA 3B4VC 4DNCA 3UGDA 2UVOA 1CHOI 4AMLA 1CT4I 1CSOI 2CWGA 2RC4A 2OU2A 2K9HA 2N1AB 1PJUA 2L8EA 1S20A 2W0TA 3UEYA 1M8CA 4E1PA 1XA6A 1UVFA 4L9MA 3TOBA 1K7VA 1PPFI 2KMQA 3E2IA 3E59A 4UXHA 5JHWC 1XBTA 3R5CA 7WGAA 1SGEI 2LB7A 2SGDI 2B0UC 1SGRI 3OXFA 3FC3A 3RU0A 1PTRA 4A24A 1RFHA 4GI3C 1MJBA 2SGEI 1DS3I 3SEKC 3R5BA 2SGQI 5E3RA 1Y8FA 2CWHA 2GKRI 1TBOA 2ARPF 1NXUA 2QQEA 2P6AC 2GKTI 1Y1CA 1HDLA 5EX0A 3UGLA 3TO6A 1KBFA 2WGCA 1P9GA 1V1HA 2SGFI 2E5RA 3FSXA 1KBEA 2B8TA 2JA1A 3FSYA 1TUSA 3OVOA 2ODDA 2ELIA 2PQ8A 2QPOA 4HGUA 1MT1A 2OZUA 1Y1BA 2V53A 5FUYA 3TO7A 2DKVA 1CT2I 3PDNA 4OVOA 4E1RA 1TIHA 3UOEA 2NU4I 1M8BA 2F3CI 2KMOA 2CWFA 3SGBI 2KCXA 3UGIA 3OL0A 1SGNI 5E3PA 3QAHA 5FUXA 1TOTA 2WVJA 1TBNA 1WGTA 1UVGA 3VDPA 1IY6A 1HPTA 2M5XA 2ORVA 2ROWA 3D00A 1UHAA 3TOAA 1FYBA 2X52A 4WP4A 2ENNA 2NU1I 2ERWA 1ULMA 2SGPI 3VDUA 1CT0I 2KMPA 2NU3I 1Z2IA 1X74A 1K7UA 1YTPA 5DAEA 1W3SA 1FARA 1MJAA 1TBRR 2CJSC 2QQCA 4JCVE 1LR9A 1KMAA 1FAQA 3CXLA 2N71A 2WCYA 1WTJA 4UXIA 3VE5A 1R79A 1LR8A 2NU0I 1Q9BA 3QWPA 5FUWA 5CCLA 1OYVI 3BJIA 1WKXA 2GKVA 3TJQA 5CCMA 1PCEA 1CGII 2VRWB 2UZ3A 4UXJA 2DIPA 1CGJI 2J87A 2QQ0A 2YUUA 2YQPA 2L7XA 1IW4A 4MPIA 1X4SA 2NU2I 3SGQI 3GOXA 2A20A 1XX6A 3R5AA 5FUVA 1HEVA 5EX3A 1LR7A 1ULKA 2V1CC 2JZMA 1TURA 1SGPI 2ORWA 2LUYA 1W4RA 5HI7A 3UEJA 5HQ8A 2JW6A 1BMOA 2N17A 2OD1A 1BUSA 1Z7KB 1R0RI 1DS2I 1ULNA 1N13A 3HH2C 1U5KA 3KY9A 2N52A 2OVOA 1HJAI 2JXDA 1PTQA 3TO9A 5J8FA 1TGSI 1OMUA 1YU6C 1OMTA 1SGQI 4SGBI 3OXLA 1TBQR 2DB6A 2Y0MA 9WGAA 1AN1I 2ENZA 3MEKA 2E73A 1CE3A 1FY7A 4B6DA
chains in the Genus database with same CATH topology
2GVIA 1V1IA 2FNFX 1IY5A 3UFFA 1VDDA 2JYYA 2KMRA 2V1CA 3OXGA 2BUSA 1SGDI 1OVOA 1H0ZA 2XRCA 4FKDA 1SGYI 2LEOA 2QQDA 3QTLD 1UUCA 1NUBA 2J9RA 3B4VC 3UGDA 1CHOI 1CT4I 1CSOI 2K9HA 2N1AB 1PJUA 2L8EA 2W0TA 3UEYA 1M8CA 4E1PA 1XA6A 1UVFA 4L9MA 1PPFI 2KMQA 3E59A 3E2IA 4UXHA 5JHWC 1XBTA 1SGEI 2SGDI 2B0UC 1SGRI 3OXFA 3FC3A 3RU0A 1PTRA 4A24A 1RFHA 4GI3C 2SGEI 1DS3I 3SEKC 2SGQI 1Y8FA 2GKRI 1TBOA 2ARPF 2QQEA 2P6AC 2GKTI 1Y1CA 1HDLA 5EX0A 3UGLA 1KBFA 5FUWA 1V1HA 2SGFI 2E5RA 3OVOA 1KBEA 2B8TA 2JA1A 1TUSA 2ODDA 2ELIA 4HGUA 2QPOA 5FUYA 1MT1A 1Y1BA 2V53A 1CT2I 3PDNA 4OVOA 4E1RA 1TIHA 2NU4I 1M8BA 2F3CI 2KMOA 3SGBI 2KCXA 3UGIA 3OL0A 1SGNI 5FUXA 1TOTA 2WVJA 1TBNA 1UVGA 3VDPA 1IY6A 1HPTA 2M5XA 2ORVA 2ROWA 3D00A 1FYBA 2ENNA 2NU1I 2ERWA 3VDUA 2SGPI 1CT0I 2KMPA 2NU3I 1X74A 1YTPA 5DAEA 1W3SA 1FARA 2QQCA 1TBRR 2CJSC 4JCVE 1KMAA 1LR9A 1FAQA 3CXLA 2N71A 2WCYA 4UXIA 3VE5A 1R79A 1LR8A 2NU0I 3QWPA 5CCLA 1OYVI 3BJIA 2GKVA 3TJQA 5CCMA 1PCEA 1CGII 2VRWB 2UZ3A 4UXJA 2DIPA 1CGJI 2J87A 2QQ0A 2YUUA 2YQPA 2L7XA 1IW4A 3GOXA 1X4SA 2NU2I 3SGQI 2A20A 1XX6A 5FUVA 5EX3A 1LR7A 2V1CC 2JZMA 1TURA 1SGPI 2ORWA 2LUYA 1W4RA 5HI7A 3UEJA 5HQ8A 2JW6A 1BMOA 2N17A 2OD1A 1BUSA 1Z7KB 1R0RI 1DS2I 1N13A 3HH2C 1U5KA 3KY9A 2N52A 2OVOA 1HJAI 2JXDA 1PTQA 1TGSI 1OMUA 1YU6C 1OMTA 1SGQI 4SGBI 3OXLA 1TBQR 2DB6A 1AN1I 2ENZA 3MEKA 2E73A 1CE3A 4B6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IY5 A;  2JYY A;  2KMR A;  2BUS A;  1SGD I;  1OVO A;  1H0Z A;  2XRC A;  1SGY I;  2LEO A;  2QQD A;  3QTL D;  1UUC A;  1NUB A;  3B4V C;  1CHO I;  1CT4 I;  1CSO I;  1PJU A;  1M8C A;  1UVF A;  1PPF I;  2KMQ A;  5JHW C;  1SGE I;  2SGD I;  2B0U C;  1SGR I;  4GI3 C;  2SGE I;  1DS3 I;  3SEK C;  2SGQ I;  2GKR I;  2ARP F;  2P6A C;  2GKT I;  1Y1C A;  1HDL A;  2SGF I;  3OVO A;  1TUS A;  4HGU A;  1MT1 A;  1Y1B A;  2V53 A;  1CT2 I;  4OVO A;  1TIH A;  2NU4 I;  1M8B A;  2F3C I;  2KMO A;  3SGB I;  2KCX A;  1SGN I;  1UVG A;  1IY6 A;  1HPT A;  2M5X A;  1FYB A;  2NU1 I;  2ERW A;  2SGP I;  1CT0 I;  2NU3 I;  2KMP A;  1YTP A;  5DAE A;  2QQC A;  1TBR R;  1KMA A;  1LR9 A;  2N71 A;  2WCY A;  1LR8 A;  2NU0 I;  1OYV I;  2GKV A;  3TJQ A;  1PCE A;  1CGI I;  1CGJ I;  1IW4 A;  2NU2 I;  3SGQ I;  1LR7 A;  2JZM A;  1TUR A;  1SGP I;  1BMO A;  2N17 A;  1BUS A;  1Z7K B;  1R0R I;  1DS2 I;  1N13 A;  3HH2 C;  2N52 A;  2OVO A;  1HJA I;  2JXD A;  1TGS I;  1OMU A;  1YU6 C;  1OMT A;  1SGQ I;  4SGB I;  1TBQ R;  1AN1 I;  1CE3 A; 
#chains in the Genus database with same CATH topology
 2GVI A;  1V1I A;  2FNF X;  1IY5 A;  3UFF A;  1WGC A;  1VDD A;  2JYY A;  2KMR A;  2V1C A;  3OXG A;  1P9Z A;  2BUS A;  5J8C A;  1SGD I;  2GIV A;  1OVO A;  2RIJ A;  5E3Q A;  1H0Z A;  2X3T A;  2XRC A;  4FKD A;  1SGY I;  1K7T A;  2LEO A;  2QQD A;  1MJ9 A;  3QTL D;  3R5D A;  1UUC A;  1NUB A;  2J9R A;  3B4V C;  4DNC A;  3UGD A;  2UVO A;  1CHO I;  4AML A;  1CT4 I;  1CSO I;  2CWG A;  2RC4 A;  2OU2 A;  2K9H A;  2N1A B;  1PJU A;  2L8E A;  1S20 A;  2W0T A;  3UEY A;  1M8C A;  4E1P A;  1XA6 A;  1UVF A;  4L9M A;  3TOB A;  1K7V A;  1PPF I;  2KMQ A;  3E2I A;  3E59 A;  4UXH A;  5JHW C;  1XBT A;  3R5C A;  7WGA A;  1SGE I;  2LB7 A;  2SGD I;  2B0U C;  1SGR I;  3OXF A;  3FC3 A;  3RU0 A;  1PTR A;  4A24 A;  1RFH A;  4GI3 C;  1MJB A;  2SGE I;  1DS3 I;  3SEK C;  3R5B A;  2SGQ I;  5E3R A;  1Y8F A;  2CWH A;  2GKR I;  1TBO A;  2ARP F;  1NXU A;  2QQE A;  2P6A C;  2GKT I;  1Y1C A;  1HDL A;  5EX0 A;  3UGL A;  3TO6 A;  1KBF A;  2WGC A;  1P9G A;  1V1H A;  2SGF I;  2E5R A;  3FSX A;  1KBE A;  2B8T A;  2JA1 A;  3FSY A;  1TUS A;  3OVO A;  2ODD A;  2ELI A;  2PQ8 A;  2QPO A;  4HGU A;  1MT1 A;  2OZU A;  1Y1B A;  2V53 A;  5FUY A;  3TO7 A;  2DKV A;  1CT2 I;  3PDN A;  4OVO A;  4E1R A;  1TIH A;  3UOE A;  2NU4 I;  1M8B A;  2F3C I;  2KMO A;  2CWF A;  3SGB I;  2KCX A;  3UGI A;  3OL0 A;  1SGN I;  5E3P A;  3QAH A;  5FUX A;  1TOT A;  2WVJ A;  1TBN A;  1WGT A;  1UVG A;  3VDP A;  1IY6 A;  1HPT A;  2M5X A;  2ORV A;  2ROW A;  3D00 A;  1UHA A;  3TOA A;  1FYB A;  2X52 A;  4WP4 A;  2ENN A;  2NU1 I;  2ERW A;  1ULM A;  2SGP I;  3VDU A;  1CT0 I;  2KMP A;  2NU3 I;  1Z2I A;  1X74 A;  1K7U A;  1YTP A;  5DAE A;  1W3S A;  1FAR A;  1MJA A;  1TBR R;  2CJS C;  2QQC A;  4JCV E;  1LR9 A;  1KMA A;  1FAQ A;  3CXL A;  2N71 A;  2WCY A;  1WTJ A;  4UXI A;  3VE5 A;  1R79 A;  1LR8 A;  2NU0 I;  1Q9B A;  3QWP A;  5FUW A;  5CCL A;  1OYV I;  3BJI A;  1WKX A;  2GKV A;  3TJQ A;  5CCM A;  1PCE A;  1CGI I;  2VRW B;  2UZ3 A;  4UXJ A;  2DIP A;  1CGJ I;  2J87 A;  2QQ0 A;  2YUU A;  2YQP A;  2L7X A;  1IW4 A;  4MPI A;  1X4S A;  2NU2 I;  3SGQ I;  3GOX A;  2A20 A;  1XX6 A;  3R5A A;  5FUV A;  1HEV A;  5EX3 A;  1LR7 A;  1ULK A;  2V1C C;  2JZM A;  1TUR A;  1SGP I;  2ORW A;  2LUY A;  1W4R A;  5HI7 A;  3UEJ A;  5HQ8 A;  2JW6 A;  1BMO A;  2N17 A;  2OD1 A;  1BUS A;  1Z7K B;  1R0R I;  1DS2 I;  1ULN A;  1N13 A;  3HH2 C;  1U5K A;  3KY9 A;  2N52 A;  2OVO A;  1HJA I;  2JXD A;  1PTQ A;  3TO9 A;  5J8F A;  1TGS I;  1OMU A;  1YU6 C;  1OMT A;  1SGQ I;  4SGB I;  3OXL A;  1TBQ R;  2DB6 A;  2Y0M A;  9WGA A;  1AN1 I;  2ENZ A;  3MEK A;  2E73 A;  1CE3 A;  1FY7 A;  4B6D A; 
#chains in the Genus database with same CATH homology
 2GVI A;  1V1I A;  2FNF X;  1IY5 A;  3UFF A;  1VDD A;  2JYY A;  2KMR A;  2V1C A;  3OXG A;  2BUS A;  1SGD I;  1OVO A;  1H0Z A;  2XRC A;  4FKD A;  1SGY I;  2LEO A;  2QQD A;  3QTL D;  1UUC A;  1NUB A;  2J9R A;  3B4V C;  3UGD A;  1CHO I;  1CT4 I;  1CSO I;  2K9H A;  2N1A B;  1PJU A;  2L8E A;  2W0T A;  3UEY A;  1M8C A;  4E1P A;  1XA6 A;  1UVF A;  4L9M A;  1PPF I;  2KMQ A;  3E59 A;  3E2I A;  4UXH A;  5JHW C;  1XBT A;  1SGE I;  2SGD I;  2B0U C;  1SGR I;  3OXF A;  3FC3 A;  3RU0 A;  1PTR A;  4A24 A;  1RFH A;  4GI3 C;  2SGE I;  1DS3 I;  3SEK C;  2SGQ I;  1Y8F A;  2GKR I;  1TBO A;  2ARP F;  2QQE A;  2P6A C;  2GKT I;  1Y1C A;  1HDL A;  5EX0 A;  3UGL A;  1KBF A;  5FUW A;  1V1H A;  2SGF I;  2E5R A;  3OVO A;  1KBE A;  2B8T A;  2JA1 A;  1TUS A;  2ODD A;  2ELI A;  4HGU A;  2QPO A;  5FUY A;  1MT1 A;  1Y1B A;  2V53 A;  1CT2 I;  3PDN A;  4OVO A;  4E1R A;  1TIH A;  2NU4 I;  1M8B A;  2F3C I;  2KMO A;  3SGB I;  2KCX A;  3UGI A;  3OL0 A;  1SGN I;  5FUX A;  1TOT A;  2WVJ A;  1TBN A;  1UVG A;  3VDP A;  1IY6 A;  1HPT A;  2M5X A;  2ORV A;  2ROW A;  3D00 A;  1FYB A;  2ENN A;  2NU1 I;  2ERW A;  3VDU A;  2SGP I;  1CT0 I;  2KMP A;  2NU3 I;  1X74 A;  1YTP A;  5DAE A;  1W3S A;  1FAR A;  2QQC A;  1TBR R;  2CJS C;  4JCV E;  1KMA A;  1LR9 A;  1FAQ A;  3CXL A;  2N71 A;  2WCY A;  4UXI A;  3VE5 A;  1R79 A;  1LR8 A;  2NU0 I;  3QWP A;  5CCL A;  1OYV I;  3BJI A;  2GKV A;  3TJQ A;  5CCM A;  1PCE A;  1CGI I;  2VRW B;  2UZ3 A;  4UXJ A;  2DIP A;  1CGJ I;  2J87 A;  2QQ0 A;  2YUU A;  2YQP A;  2L7X A;  1IW4 A;  3GOX A;  1X4S A;  2NU2 I;  3SGQ I;  2A20 A;  1XX6 A;  5FUV A;  5EX3 A;  1LR7 A;  2V1C C;  2JZM A;  1TUR A;  1SGP I;  2ORW A;  2LUY A;  1W4R A;  5HI7 A;  3UEJ A;  5HQ8 A;  2JW6 A;  1BMO A;  2N17 A;  2OD1 A;  1BUS A;  1Z7K B;  1R0R I;  1DS2 I;  1N13 A;  3HH2 C;  1U5K A;  3KY9 A;  2N52 A;  2OVO A;  1HJA I;  2JXD A;  1PTQ A;  1TGS I;  1OMU A;  1YU6 C;  1OMT A;  1SGQ I;  4SGB I;  3OXL A;  1TBQ R;  2DB6 A;  1AN1 I;  2ENZ A;  3MEK A;  2E73 A;  1CE3 A;  4B6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...