1IY6A

Solution structure of omsvp3 variant, p14c/n39c
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
b'AVSVDCSEYPKCACTMEYRPLCGSDNKTYGNKCNFCCAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OMSVP3
publication title Inhibitory Specificity Change of Ovomucoid Third Domain of the Silver Pheasant upon Introduction of an Engineered Cys14-Cys39 Bond
pubmed doi rcsb
source organism Lophura nycthemera
molecule tags Hydrolase
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1iy6A00
1CGII 1SGQI 2SGFI 2KMPA 1UUCA 1HJAI 1Y1CA 2SGPI 1H0ZA 2GKTI 3B4VC 1IY5A 1R0RI 1CT0I 2NU1I 1CGJI 2QQCA 2ERWA 3TJQA 1SGNI 1SGEI 2N52A 1SGRI 1TUSA 1SGDI 1YU6C 2GKRI 1SGYI 1PJUA 1YTPA 2F3CI 1HDLA 1TURA 1TGSI 1TBRR 2LEOA 2JXDA 1NUBA 1BUSA 2SGEI 2WCYA 2NU2I 1AN1I 2GKVA 1CE3A 1HPTA 4HGUA 1UVFA 1LR7A 2NU3I 1Z7KB 1IW4A 2SGQI 2JZMA 1LR9A 3OVOA 1PPFI 1OVOA 2M5XA 2BUSA 2SGDI 3HH2C 1M8CA 1UVGA 2JYYA 1FYBA 1CT4I 1Y1BA 4GI3C 2ARPF 2NU4I 5DAEA 1TIHA 1CSOI 2KCXA 1IY6A 1M8BA 5JHWC 1CT2I 1KMAA 3SGBI 1LR8A 4OVOA 2OVOA 2KMOA 2N17A 2N71A 4SGBI 2KMRA 1N13A 3QTLD 2XRCA 1DS3I 1OYVI 1OMUA 1TBQR 2QQDA 2B0UC 1BMOA 2P6AC 1SGPI 3SEKC 1OMTA 2KMQA 1CHOI 2V53A 1MT1A 3SGQI 1DS2I 2NU0I 1PCEA
chains in the Genus database with same CATH superfamily
1CGII 1ULNA 3UGIA 1SGQI 2E73A 5HI7A 2OZUA 2SGFI 2KMPA 1X4SA 1UUCA 3VDUA 1HJAI 1Y1CA 2SGPI 1H0ZA 1P9GA 3TO7A 1WTJA 2GKTI 3B4VC 1TBNA 2ENNA 4UXJA 3UEJA 1IY5A 2Y0MA 2GIVA 1R0RI 1Z2IA 1CT0I 2NU1I 2V1CA 1CGJI 3FSXA 1WKXA 2QQCA 2ERWA 3TJQA 2ROWA 1SGNI 1SGEI 2N52A 2N1AB 1W4RA 3E2IA 3KY9A 2RIJA 1HEVA 2E5RA 1SGRI 4UXHA 1WGCA 2X3TA 1TUSA 2GVIA 2OU2A 5CCMA 1SGDI 1YU6C 2GKRI 2LB7A 1SGYI 4E1PA 1PJUA 1YTPA 2F3CI 2WGCA 3UGLA 1FY7A 1S20A 1HDLA 1TURA 4DNCA 1TGSI 1TBRR 2JW6A 2J9RA 1NUBA 2JXDA 2LEOA 2SGEI 4UXIA 2ORVA 1MJBA 3UFFA 1BUSA 2B8TA 2WCYA 4E1RA 1K7UA 2NU2I 3FSYA 1AN1I 2WVJA 2GKVA 1CE3A 1TBOA 3OXFA 1K7VA 5HQ8A 2UZ3A 3R5AA 1HPTA 2FNFX 3UEYA 2K9HA 2V1CC 4HGUA 1W3SA 3VE5A 2QPOA 1Y8FA 2X52A 2J87A 1UVFA 1LR7A 2ENZA 1V1IA 2NU3I 1Z7KB 5E3QA 4A24A 2DKVA 1WGTA 1IW4A 4L9MA 3TO9A 3GOXA 2SGQI 2YUUA 2JZMA 2YQPA 1LR9A 2DIPA 2CWFA 3OVOA 1V1HA 3UOEA 9WGAA 1PPFI 4MPIA 1OVOA 1VDDA 3E59A 3VDPA 2M5XA 1FAQA 2BUSA 1UHAA 2SGDI 4B6DA 1R79A 3OL0A 5CCLA 3QAHA 1MJAA 1M8CA 1UVGA 2ORWA 3HH2C 4JCVE 2JYYA 5EX0A 1FYBA 1XA6A 2RC4A 3OXLA 1RFHA 1CT4I 1Y1BA 2L7XA 4GI3C 5FUVA 3R5DA 2ARPF 1P9ZA 2NU4I 4FKDA 3D00A 1X74A 2ODDA 3PDNA 5DAEA 1TOTA 1TIHA 1CSOI 2UVOA 3UGDA 2CWHA 5FUYA 2CJSC 2A20A 2KCXA 1IY6A 1M8BA 7WGAA 2DB6A 1CT2I 5FUXA 3TOBA 5JHWC 5EX3A 3BJIA 3SGBI 1KBFA 1KMAA 1LR8A 4OVOA 2OVOA 5E3RA 1KBEA 4WP4A 2KMOA 3TOAA 1ULKA 2CWGA 2JA1A 2N17A 1K7TA 2N71A 3OXGA 4SGBI 5J8FA 1XX6A 1ULMA 2ELIA 2OD1A 2KMRA 5FUWA 1PTQA 2PQ8A 1N13A 3QTLD 2XRCA 1DS3I 1OYVI 3MEKA 1OMUA 1TBQR 2LUYA 2QQDA 1FARA 5E3PA 3R5CA 2W0TA 2B0UC 1BMOA 5J8CA 1U5KA 2P6AC 3TO6A 1SGPI 3RU0A 3FC3A 3SEKC 1MJ9A 1OMTA 1CHOI 2KMQA 2L8EA 2V53A 2QQEA 3QWPA 1MT1A 3R5BA 1NXUA 1DS2I 1XBTA 2NU0I 2QQ0A 3CXLA 1PTRA 2VRWB 3SGQI 4AMLA 1Q9BA 1PCEA
chains in the Genus database with same CATH topology
1CGII 3UGIA 1SGQI 2E73A 5HI7A 2SGFI 2KMPA 1X4SA 1UUCA 3VDUA 1HJAI 1Y1CA 2SGPI 1H0ZA 2GKTI 3B4VC 1TBNA 2ENNA 4UXJA 3UEJA 1IY5A 1R0RI 1CT0I 2NU1I 2V1CA 1CGJI 2QQCA 2ERWA 3TJQA 2ROWA 1SGNI 1SGEI 2N52A 2N1AB 1W4RA 3E2IA 3KY9A 2E5RA 1SGRI 4UXHA 1TUSA 2GVIA 1SGDI 1YU6C 2GKRI 1SGYI 4E1PA 1PJUA 1YTPA 2F3CI 3UGLA 1HDLA 1TURA 1TGSI 1TBRR 2JW6A 2J9RA 1NUBA 2JXDA 2LEOA 2SGEI 4UXIA 2ORVA 5CCMA 3UFFA 1BUSA 2B8TA 2WCYA 4E1RA 2NU2I 1AN1I 2WVJA 2GKVA 1CE3A 1TBOA 3OXFA 5HQ8A 2UZ3A 1HPTA 2FNFX 3UEYA 2K9HA 2V1CC 4HGUA 1W3SA 3VE5A 2QPOA 1Y8FA 2J87A 1UVFA 1LR7A 2ENZA 1V1IA 2NU3I 1Z7KB 4A24A 1IW4A 4L9MA 3GOXA 2SGQI 2YUUA 2JZMA 2YQPA 1LR9A 2DIPA 3OVOA 1V1HA 1PPFI 1OVOA 1VDDA 3E59A 3VDPA 2M5XA 1FAQA 2BUSA 2SGDI 4B6DA 1R79A 3OL0A 5CCLA 3HH2C 1M8CA 1UVGA 2ORWA 4JCVE 5EX0A 2JYYA 1FYBA 1XA6A 3OXLA 1RFHA 1CT4I 1Y1BA 2L7XA 4GI3C 5FUVA 2ARPF 2NU4I 4FKDA 3D00A 1X74A 2ODDA 3PDNA 5DAEA 1TOTA 1TIHA 1CSOI 3UGDA 5FUYA 2CJSC 2A20A 2KCXA 1IY6A 1M8BA 5JHWC 2DB6A 1CT2I 5FUXA 1KBFA 1KMAA 5EX3A 3BJIA 3SGBI 1LR8A 4OVOA 2OVOA 1KBEA 2KMOA 2JA1A 2N17A 2N71A 3OXGA 4SGBI 1XX6A 2OD1A 2ELIA 5FUWA 2KMRA 1PTQA 1N13A 3QTLD 2XRCA 1DS3I 1OYVI 3MEKA 1OMUA 1TBQR 2LUYA 2QQDA 1FARA 2W0TA 2B0UC 1BMOA 1U5KA 2P6AC 1SGPI 3RU0A 3FC3A 3SEKC 1OMTA 2KMQA 1CHOI 2L8EA 2V53A 2QQEA 3QWPA 1MT1A 1XBTA 1DS2I 2NU0I 2QQ0A 3CXLA 3SGQI 1PTRA 2VRWB 1PCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGI I;  1SGQ I;  2SGF I;  2KMP A;  1UUC A;  1HJA I;  1Y1C A;  2SGP I;  1H0Z A;  2GKT I;  3B4V C;  1IY5 A;  1R0R I;  1CT0 I;  2NU1 I;  1CGJ I;  2QQC A;  2ERW A;  3TJQ A;  1SGN I;  1SGE I;  2N52 A;  1SGR I;  1TUS A;  1SGD I;  1YU6 C;  2GKR I;  1SGY I;  1PJU A;  1YTP A;  2F3C I;  1HDL A;  1TUR A;  1TGS I;  1TBR R;  2LEO A;  2JXD A;  1NUB A;  1BUS A;  2SGE I;  2WCY A;  2NU2 I;  1AN1 I;  2GKV A;  1CE3 A;  1HPT A;  4HGU A;  1UVF A;  1LR7 A;  2NU3 I;  1Z7K B;  1IW4 A;  2SGQ I;  2JZM A;  1LR9 A;  3OVO A;  1PPF I;  1OVO A;  2M5X A;  2BUS A;  2SGD I;  3HH2 C;  1M8C A;  1UVG A;  2JYY A;  1FYB A;  1CT4 I;  1Y1B A;  4GI3 C;  2ARP F;  2NU4 I;  5DAE A;  1TIH A;  1CSO I;  2KCX A;  1IY6 A;  1M8B A;  5JHW C;  1CT2 I;  1KMA A;  3SGB I;  1LR8 A;  4OVO A;  2OVO A;  2KMO A;  2N17 A;  2N71 A;  4SGB I;  2KMR A;  1N13 A;  3QTL D;  2XRC A;  1DS3 I;  1OYV I;  1OMU A;  1TBQ R;  2QQD A;  2B0U C;  1BMO A;  2P6A C;  1SGP I;  3SEK C;  1OMT A;  2KMQ A;  1CHO I;  2V53 A;  1MT1 A;  3SGQ I;  1DS2 I;  2NU0 I;  1PCE A; 
#chains in the Genus database with same CATH topology
 1CGI I;  1ULN A;  3UGI A;  1SGQ I;  2E73 A;  5HI7 A;  2OZU A;  2SGF I;  2KMP A;  1X4S A;  1UUC A;  3VDU A;  1HJA I;  1Y1C A;  2SGP I;  1H0Z A;  1P9G A;  3TO7 A;  1WTJ A;  2GKT I;  3B4V C;  1TBN A;  2ENN A;  4UXJ A;  3UEJ A;  1IY5 A;  2Y0M A;  2GIV A;  1R0R I;  1Z2I A;  1CT0 I;  2NU1 I;  2V1C A;  1CGJ I;  3FSX A;  1WKX A;  2QQC A;  2ERW A;  3TJQ A;  2ROW A;  1SGN I;  1SGE I;  2N52 A;  2N1A B;  1W4R A;  3E2I A;  3KY9 A;  2RIJ A;  1HEV A;  2E5R A;  1SGR I;  4UXH A;  1WGC A;  2X3T A;  1TUS A;  2GVI A;  2OU2 A;  5CCM A;  1SGD I;  1YU6 C;  2GKR I;  2LB7 A;  1SGY I;  4E1P A;  1PJU A;  1YTP A;  2F3C I;  2WGC A;  3UGL A;  1FY7 A;  1S20 A;  1HDL A;  1TUR A;  4DNC A;  1TGS I;  1TBR R;  2JW6 A;  2J9R A;  1NUB A;  2JXD A;  2LEO A;  2SGE I;  4UXI A;  2ORV A;  1MJB A;  3UFF A;  1BUS A;  2B8T A;  2WCY A;  4E1R A;  1K7U A;  2NU2 I;  3FSY A;  1AN1 I;  2WVJ A;  2GKV A;  1CE3 A;  1TBO A;  3OXF A;  1K7V A;  5HQ8 A;  2UZ3 A;  3R5A A;  1HPT A;  2FNF X;  3UEY A;  2K9H A;  2V1C C;  4HGU A;  1W3S A;  3VE5 A;  2QPO A;  1Y8F A;  2X52 A;  2J87 A;  1UVF A;  1LR7 A;  2ENZ A;  1V1I A;  2NU3 I;  1Z7K B;  5E3Q A;  4A24 A;  2DKV A;  1WGT A;  1IW4 A;  4L9M A;  3TO9 A;  3GOX A;  2SGQ I;  2YUU A;  2JZM A;  2YQP A;  1LR9 A;  2DIP A;  2CWF A;  3OVO A;  1V1H A;  3UOE A;  9WGA A;  1PPF I;  4MPI A;  1OVO A;  1VDD A;  3E59 A;  3VDP A;  2M5X A;  1FAQ A;  2BUS A;  1UHA A;  2SGD I;  4B6D A;  1R79 A;  3OL0 A;  5CCL A;  3QAH A;  1MJA A;  1M8C A;  1UVG A;  2ORW A;  3HH2 C;  4JCV E;  2JYY A;  5EX0 A;  1FYB A;  1XA6 A;  2RC4 A;  3OXL A;  1RFH A;  1CT4 I;  1Y1B A;  2L7X A;  4GI3 C;  5FUV A;  3R5D A;  2ARP F;  1P9Z A;  2NU4 I;  4FKD A;  3D00 A;  1X74 A;  2ODD A;  3PDN A;  5DAE A;  1TOT A;  1TIH A;  1CSO I;  2UVO A;  3UGD A;  2CWH A;  5FUY A;  2CJS C;  2A20 A;  2KCX A;  1IY6 A;  1M8B A;  7WGA A;  2DB6 A;  1CT2 I;  5FUX A;  3TOB A;  5JHW C;  5EX3 A;  3BJI A;  3SGB I;  1KBF A;  1KMA A;  1LR8 A;  4OVO A;  2OVO A;  5E3R A;  1KBE A;  4WP4 A;  2KMO A;  3TOA A;  1ULK A;  2CWG A;  2JA1 A;  2N17 A;  1K7T A;  2N71 A;  3OXG A;  4SGB I;  5J8F A;  1XX6 A;  1ULM A;  2ELI A;  2OD1 A;  2KMR A;  5FUW A;  1PTQ A;  2PQ8 A;  1N13 A;  3QTL D;  2XRC A;  1DS3 I;  1OYV I;  3MEK A;  1OMU A;  1TBQ R;  2LUY A;  2QQD A;  1FAR A;  5E3P A;  3R5C A;  2W0T A;  2B0U C;  1BMO A;  5J8C A;  1U5K A;  2P6A C;  3TO6 A;  1SGP I;  3RU0 A;  3FC3 A;  3SEK C;  1MJ9 A;  1OMT A;  1CHO I;  2KMQ A;  2L8E A;  2V53 A;  2QQE A;  3QWP A;  1MT1 A;  3R5B A;  1NXU A;  1DS2 I;  1XBT A;  2NU0 I;  2QQ0 A;  3CXL A;  1PTR A;  2VRW B;  3SGQ I;  4AML A;  1Q9B A;  1PCE A; 
#chains in the Genus database with same CATH homology
 1CGI I;  3UGI A;  1SGQ I;  2E73 A;  5HI7 A;  2SGF I;  2KMP A;  1X4S A;  1UUC A;  3VDU A;  1HJA I;  1Y1C A;  2SGP I;  1H0Z A;  2GKT I;  3B4V C;  1TBN A;  2ENN A;  4UXJ A;  3UEJ A;  1IY5 A;  1R0R I;  1CT0 I;  2NU1 I;  2V1C A;  1CGJ I;  2QQC A;  2ERW A;  3TJQ A;  2ROW A;  1SGN I;  1SGE I;  2N52 A;  2N1A B;  1W4R A;  3E2I A;  3KY9 A;  2E5R A;  1SGR I;  4UXH A;  1TUS A;  2GVI A;  1SGD I;  1YU6 C;  2GKR I;  1SGY I;  4E1P A;  1PJU A;  1YTP A;  2F3C I;  3UGL A;  1HDL A;  1TUR A;  1TGS I;  1TBR R;  2JW6 A;  2J9R A;  1NUB A;  2JXD A;  2LEO A;  2SGE I;  4UXI A;  2ORV A;  5CCM A;  3UFF A;  1BUS A;  2B8T A;  2WCY A;  4E1R A;  2NU2 I;  1AN1 I;  2WVJ A;  2GKV A;  1CE3 A;  1TBO A;  3OXF A;  5HQ8 A;  2UZ3 A;  1HPT A;  2FNF X;  3UEY A;  2K9H A;  2V1C C;  4HGU A;  1W3S A;  3VE5 A;  2QPO A;  1Y8F A;  2J87 A;  1UVF A;  1LR7 A;  2ENZ A;  1V1I A;  2NU3 I;  1Z7K B;  4A24 A;  1IW4 A;  4L9M A;  3GOX A;  2SGQ I;  2YUU A;  2JZM A;  2YQP A;  1LR9 A;  2DIP A;  3OVO A;  1V1H A;  1PPF I;  1OVO A;  1VDD A;  3E59 A;  3VDP A;  2M5X A;  1FAQ A;  2BUS A;  2SGD I;  4B6D A;  1R79 A;  3OL0 A;  5CCL A;  3HH2 C;  1M8C A;  1UVG A;  2ORW A;  4JCV E;  5EX0 A;  2JYY A;  1FYB A;  1XA6 A;  3OXL A;  1RFH A;  1CT4 I;  1Y1B A;  2L7X A;  4GI3 C;  5FUV A;  2ARP F;  2NU4 I;  4FKD A;  3D00 A;  1X74 A;  2ODD A;  3PDN A;  5DAE A;  1TOT A;  1TIH A;  1CSO I;  3UGD A;  5FUY A;  2CJS C;  2A20 A;  2KCX A;  1IY6 A;  1M8B A;  5JHW C;  2DB6 A;  1CT2 I;  5FUX A;  1KBF A;  1KMA A;  5EX3 A;  3BJI A;  3SGB I;  1LR8 A;  4OVO A;  2OVO A;  1KBE A;  2KMO A;  2JA1 A;  2N17 A;  2N71 A;  3OXG A;  4SGB I;  1XX6 A;  2OD1 A;  2ELI A;  5FUW A;  2KMR A;  1PTQ A;  1N13 A;  3QTL D;  2XRC A;  1DS3 I;  1OYV I;  3MEK A;  1OMU A;  1TBQ R;  2LUY A;  2QQD A;  1FAR A;  2W0T A;  2B0U C;  1BMO A;  1U5K A;  2P6A C;  1SGP I;  3RU0 A;  3FC3 A;  3SEK C;  1OMT A;  2KMQ A;  1CHO I;  2L8E A;  2V53 A;  2QQE A;  3QWP A;  1MT1 A;  1XBT A;  1DS2 I;  2NU0 I;  2QQ0 A;  3CXL A;  3SGQ I;  1PTR A;  2VRW B;  1PCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...