1J0FA

Solution structure of the sh3 domain binding glutamic acid-rich protein like 3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
100
Chain Sequence
GSEGAATMSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATPPQIVNGNHYCGDYELFVEAVEQDTLQEFLKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the SH3 Domain Binding Glutamic Acid-rich Protein Like 3
rcsb
molecule keywords SH3 domain-binding glutamic acid-rich-like protein 3
molecule tags Structural genomics, unknown function
source organism Mus musculus
total genus 25
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04908 SH3BGR SH3-binding, glutamic acid-rich protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1j0fA00
4ECIA 1WJKA 4LMWA 4FYCA 2KOKA 3LXTA 3WGEA 3O3TA 2MBTA 1E6BA 2FWHA 2VCVA 1A0RP 4J57E 2WCIA 1MDIA 3BD2A 1GUKA 1T1VA 5CRWA 3BBYA 1EGRA 2VL2A 1F3BA 1Q98A 4ZB9A 2DMMA 3FR9A 3GN3A 2WFCA 9GSSA 2V41A 5J4UA 1VGLA 2PUKC 1GNWA 3EVIA 1R5AA 2YNXA 4MZWA 4PUFC 2DLXA 2H19A 4OO4A 1M2BA 2DSAA 2O8VB 3F3QA 2CT6A 3VPTA 1G6YA 2F8AA 2C0EA 1ZYEA 2M72A 2D2ZA 3FZAA 1M2DA 2GSSA 3UEMA 4RUVA 2LRNA 1XOBA 4ISDA 2QSIA 1TKDB 4I2UA 2A2SA 6GSSA 1ERUA 1ACVA 1UC7A 2H1GA 5IMDA 4ZL9A 1XVQA 2H74A 5ID2B 2YCDA 2FWGA 2H8LA 3QPMA 4ML1A 4GQCA 4P3YB 1HNCA 3EE2A 4JE1A 4KUNA 5ECRB 3MNGA 1OE8A 5EL8A 4HI7A 4F82A 1CQHA 1T3BA 3VWXA 5IPHA 3A2WA 2TRXA 3I6AA 5E4WA 5B7CA 3US3A 5CAXA 1QMVA 5IO0A 4JZQA 1PKZA 2LJAA 2HSHA 5EVOA 4TR1B 5IMAA 2YJ7A 5F06A 12GSA 1N8JA 2GTUA 6GSVA 2G0FA 4L0UA 5D8IA 5G5FA 1AQVA 2AYTA 3HA9A 3UBLA 1O73A 4XRDA 2FLSA 1FVJA 3HYPA 3AY8A 2IMFA 2GT5A 1GUHA 2L59A 1SL0B 4OD7A 4F0BA 2XPDA 2KUCA 3TGZA 3MWHA 1Y6EA 3HDCA 3LORA 4BVYA 2G2QA 1X5CA 1U88A 3UAPA 4LLRA 2YV7A 1B9YC 1M9AA 1A0FA 2OBKA 1KTEA 2X8GA 2H01A 5D96A 2L6DA 4KX4A 3O6TA 3N5OA 4HQSA 5D93A 4HZ2A 1X5EA 4MLYA 3E0UA 1X5DA 4MK3A 2RM6A 4ECJA 2L5OA 3TUEA 3M1GA 1K0DA 3PGTA 3F6DA 2NDOA 1JZRA 2JZRA 1EWXA 4PURA 5DCGA 1MD4A 2GQKA 1SJIA 1ML6A 2MMZA 4IKHA 4GLTA 5ECNB 4GSNA 4TXOA 4YQVA 3GX0A 5HR3A 3F9UA 1K0AA 1A24A 1QK8A 2OADA 3KEBA 1GSDA 4V2MA 3RAZA 4ID0A 2IMEA 2N5BA 3BCIA 3QOUA 1AQWA 5HQPA 5CRGA 4DSQA 4OCFA 3H1NA 3WYWA 3ZFLA 1YEPA 2JADA 3ZLPA 1TOFA 1A2LA 3DIEA 4K7NA 5G5EA 3HVSA 5INYA 3GYKA 1S3AA 6GSYA 1SJZA 8GSSA 4ZBDA 4O5RA 3ERGA 2KLXA 6GSXA 4XS4B 3ZL5A 2WB9A 1O85A 2RLIA 5ECMB 5IPGA 2K6VA 2DIYA 5DAKB 2N5FA 3SBCA 5ECKB 2DBCA 1EZKA 3IBHA 3GKMA 4ZBBA 4K8MA 2LNTA 3G7IA 3R2QA 2IMKA 3PINA 1H75A 1XWKA 3K8NA 3TRPA 1GNEA 2DJ2A 2A4VA 1PD21 4AJ6A 1XPVA 5ECHB 5B6NA 4ZB8A 4F9ZA 1WRYA 2YWNA 3F4RA 4DSSB 1T8EB 5B8BA 3VI5A 2Z9SA 5AGYA 3GSSA 2PBJA 4ULXA 3KTLA 3GA4A 2TIRA 1AQXA 4ECCA 1PL2A 1FG4A 2DJ0A 3QAVA 5F07A 2VCWA 3ZVJA 2IMDA 1ERTA 5G1KA 1AC1A 3F6FA 1K0BA 4IN0A 3F4TA 4LA1A 2ON7A 1BAYA 3L4NA 2KP1A 2LJRA 4K2DA 1FW1A 1SK1A 2DJ1A 2AHEA 2IJYA 14GSA 2YV9A 1TW9A 2YPMA 3GKXA 4POBA 1T4YA 1B4QA 2ZUPA 1JZWA 4BL7A 1XW5A 3G9BA 5AIVA 1F2EA 1FO5A 3IHQA 1XWGA 1GL8A 4E8HA 2R6KA 4RI7A 3HD5A 4MPGA 3LJRA 4G19A 4CW9A 4WETA 5DJLA 3A3TA 3S9FA 4KDYA 4BVXA 3LG6A 1SD9A 4QQ7A 3BJ5A 4WF4A 4X43A 4ZL7A 3FW2A 3TKSE 5D9XA 2LS5A 3UVTA 2CVKA 4H86A 3WGDA 1SJ6A 3RDWA 3C73A 7GSSA 3FR6A 4IJIA 2L6CA 4OWYA 2GSQA 4N11A 2HRNA 4POMA 4HUAA 3RPPA 1ABAA 2X8HA 3DD3A 1Y25A 1C72A 2PMTA 4D73B 2CA8A 3QD9A 4N0VA 4HJ2A 3QMXA 3KP8A 4ECBA 1EV4A 1THXA 5HR2A 5GZZB 4RI6A 3FYGA 1EGOA 1R7HA 3M9JA 4LL1B 5AISA 5A4UA 3D21A 2JL4A 1JLWA 3WT1A 1A8LA 1TDIA 1TK0B 2GGTA 4O7HA 1SKWB 3C71A 2V6OA 1BQ7A 5IQYA 4NHWA 4ZBAA 2OKAA 5HFGA 4PGTA 3Q19A 3QFAC 3EINA 1WMJA 3GH9A 2MYGA 2JACA 1CQGA 5H5SA 5CREA 4BWQA 1WIKA 3Q18A 4MJAA 2ZNMA 2LQOA 2VLTA 1PN9A 5CRHA 2HSYA 3M3MA 3Q74A 2GS3A 3TDGA 3Q6OA 3GKNA 1FAAA 5B6MA 1OC9A 4NAXA 1VF2A 2V2GA 1NHYA 3IAM2 1JFUA 2H76A 2O7KA 2LKUA 1ZZYA 3UVHA 2PN8A 3NOFA 1ON4A 1ST9A 1OC3A 5DBQA 1UVZA 1XVWA 2PERA 4I6XA 4POLA 5A5KA 3KH9A 4IW9A 3VPQA 4X0XA 5GAND 2VAFA 1AIUA 1B48A 2VUPA 3EURA 4KW6A 4TR4A 5KN3A 4WR5A 5DALA 1EOHA 4EE0A 1GP1A 1WOUA 5HFKA 2KHPA 2VLVA 4PQHA 3D6IA 3I43A 1R5PA 4V1Ap 2DJKA 2VCZA 4ZXGA 3KMOA 3IOSA 2PGTA 2HXKA 3FZ4A 1WE0A 4WR4A 4TR3A 4JRRA 5ECQB 4WXTA 11GSA 3IR4A 2GLRA 3GRXA 3QCPA 2F8FA 1K3LA 5G30A 3IDVA 1GWCA 1YKCA 4MJBA 2B7JA 2VCQA 2FCHA 4K7IA 2NTOA 3KH7A 3GHAA 1GSUA 3TOUA 3ZREA 3DWVA 3L0HA 2P5QA 5ENUA 3VWWA 1MEKA 2AJQB 4G9HA 2J23A 2OACA 3MSZA 5IMCA 4J56E 4MH2A 5JCWA 4FIWA 2F9SA 3CRUA 1V40A 2CVBA 1AXDA 5HR0A 2HZFA 3ZZXA 2OE3A 1YY7A 4EC0A 4KH7A 4EXJA 3APQA 2LRCA 2F51A 2WGRA 3VI7A 3HJMA 3HKRA 3FEUA 4MMMA 4EO3A 2M46A 1O81A 3CSIA 1K0CA 1B4PA 2BJXA 3CYNA 2GSRA 1SENA 2X8CA 4YAVA 4K7OA 1LJRA 1JZOA 1OAZA 3GFKA 1G6WA 1GLQA 5FWGA 3TJJA 3CTGA 5L71A 4MH3A 3UL3A 1THOA 2YJHA 1F9MA 1F6MC 2LQQA 2VCTA 2K8SA 1U3AA 3A2VA 1TTZA 1FHEA 1EEMA 1PRXA 1J9BA 4NWYA 2CZ3A 1DBYA 5JCGA 3FRCA 2X99A 1O7UA 3ZTLA 4JR4A 4JEDA 3U6VA 4NMUA 2GSTA 4HS1A 4IP6A 2ALBA 2PPTA 1HD2A 4KB3A 3H4KA 2B6MA 1K3OA 1UA5A 4K9ZA 3OR5A 2FA8A 3FK8A 4NHZA 1Z7RA 3EMXA 1O8WA 1GULA 1E2YA 3A2XA 2VO4A 1U87A 5A4VA 4KCAA 1A2JA 1S3CA 4OO5A 1XWBA 2IIYA 2P31A 1MDJA 4WEYA 3U5RE 3EYTA 1V58A 2HE3A 2PWJA 5CNWA 1YKAA 2L5LA 3IAS2 1PX7A 1NW2A 2LV3A 1Z5YE 1A2MA 3J7Yb 2FWEA 3CBUA 3LGCA 3FY7A 4KAEA 3KZQA 19GSA 4TXOB 1PQNA 5DDLA 5ECSA 4YAPA 2IPAA 3EWLA 1U6TA 1O6JA 2HFDA 3IC4A 4I97A 1GTBA 3HCZA 2B5YA 4CHSA 2WRTA 3TB2A 1T00A 1UN2A 4I5QA 3VLNA 2C3NA 3HHVA 4XS1A 5B8AA 1XWCA 3LQ7A 2O85A 2RIIA 5ECOB 2IFQA 1ERWA 1GH2A 4JU5A 4ZB6A 3KD0A 3GSTA 2REMA 3VWVA 3TJGA 2DC5A 6GSWA 4EF0A 1GTIA 1EV9A 2HT9A 20GSA 1J08A 2H1AA 1TI1A 1SK0A 4RQRA 2F3MA 3HXSA 5DJMA 16GSA 2IMIA 5D9WA 1ZGNA 1XIYA 4KGIA 1V9WA 3GKKA 5J3RA 4OFNA 2E0QA 3H8QA 1XW6A 2VCXA 2XBQA 3KP9A 4ZILA 2KP2A 1V57A 5J9CA 3W8JA 1ZCPA 2PVQA 4V1Ag 3ZIJA 1FB0A 1ERVA 1NM3A 4MDCA 3UIWA 1X9WB 1XZOA 1AUCA 3D4MA 2R5GA 2AAWA 4EKZA 4KA0A 3VURA 1Z3EA 4K0NA 1QUWA 5ELGA 2VD1A 4Q5QA 4ML6A 4BPYA 3H79A 4MP4A 5GSSA 4MZBA 2GZZA 3P7XA 1Z7PA 4JBBA 2VL3A 3QFBC 2H0IA 3HZ8A 3GL5A 3CMIA 1DUGA 1YZXA 4AGSA 2B1KA 4ILFA 2IN3A 3KM6A 6GSTA 3KJYA 4XHMA 3ZYWA 1PA3A 5KN1A 4N10A 4N30A 4PQ1A 2CQ9A 1N2AA 3KTBA 3N9JA 3WT2A 5JWRB 5G2ZA 3IK9A 2C80A 2IWTA 3F0IA 4GSTA 2XC2A 1YF1A 3F63A 4NV2A 3L9UA 5IIZA 2V32A 3TKRA 2WDUA 1TRSA 5GAPD 5DVBA 4KSOA 1MTCA 1Z6NA 1K0OA 4TXVA 2FWFA 4WBRD 4K1FA 4MZCA 4EDZA 4L5LA 2NBSA 2CAQA 1VF4A 3ZVJD 1J0FA 1HNAA 1SYXA 4Q5FA 1VF3A 2RM5A 4WKWA 2BTOT 4YQUA 1F37A 3ZITA 3O76A 5F05A 2H6XA 2YP6A 4GXZA 1LBKA 4AF2A 1M9BA 3F4SA 3FZ9A 2NVLA 2GDRA 2P5RA 1G7EA 2WZ9A 3UARA 2H6ZA 3L9SA 2MZCA 4O32A 1IYIA 1I9DA 2B5XA 2GVPA 4K0GA 2E2MA 2GZYA 3GV1A 1XBSA 3TCOA 3M8NA 2OA7A 2HLSA 1RW1A 5CYYA 4DEJA 4X1UA 1R4WA 4E8EA 1PX6A 2CX4A 4OFTA 3CXGA 2XPEA 3HVVA 1VRSD 2LRTA 2DIZA 3ZIVA 2I1UA 1URMA 4EL1A 1ILOA 2H71A 3TJFA 4HOJA 4GSSA 2DMLA 4MF6A 2LUSA 1K3YA 3DKSA 4L0WA 2ES7A 3A5WA 1ZOFA 4IJ3A 3F8UA 1OC9B 3CTFA 2VL9A 1XOAA 4N0ZA 3KCMA 1G0TA 2C0DA 5IMVA 2M80A 1PKWA 2EC4A 1GLPA 3IV4A 2FNOA 2C8UA 4YQMA 5AIXA 3ZRDA 4IP1A 1AW9A 3V1WA 2CV4A 3GNJA 1X0RA 2CX3A 2LSTA 4G10A 1F3AA 4JR6A 2XBIA 1TU8A 5CP1A 5DALB 6GSUA 1YEXA 1JHBA 2H1BA 5F8BA 2LEGA 4XIHA 3LEFA 2MMNA 5IMFA 4GF0A 3HY2A 1X9MB 1XCCA 2B1LA 3FKFA 1FB6A 5CO3A 2RUFA 1EP7A 5DQYA 3KIJA 5C00A 4IBPA 5KN0A 3IA1A 5IM9A 1PL1A 5KN2A 2NPBA 2YZHA 1M0UA 1Z9HA 1X9SB 3LYKA 1W4VA 3ZMLA 2OBIA 5CRDA 5G31A 1OC8A 4V2LA 5ECLB 3NZNA 5FHIA 3E3EA 2AB6A 1ZMAA 2R3XA 3C7MA 3D5JA 1PGTA 3TRQA 3GX8A 3MDKA 3IPZA 2C3QA 4Z7XA 2X64A 4PQIA 2GQMA 3FZ5A 2B3SA 4IVFA 5D9TA 1GUMA 1V2AA 4I8BA 3J7Yk 1EEJA 2K9FA 3KXOA 2CZ2A 1R26A 2H6YA 1OE7A 1QQ2A 2VD0A 1SKSB 2R37A 4HDEA 5C04A 4AJ7A 2C0GA 5J41A 3ME8A 5J5NA 4KE3A 2E7PA 4MABA 4LMVA 2JU5A 2HI7A 5JWOB 1OKDA 1SU9A 5AN1A 4FO5A 1KEBA 4IGJA 1TJDA 5ID2A 4IQ1A 2MBSA 1BEDA 4I2TA 1YF0A 2FHEA 2H75A 3HJPA 4TW5A 3RHBA 2I9HA 2FD3A 1EOGA 3VWUA 2L57A 1W89A 4HU7A 1MDKA 2H66A 3TKQA 4G2EA 1A23A 1M2AA 2O87A 2OE0A 3CSJA 3QAWA 3APOA 4LL4B 2P0GA 2H72A 4TR1A 4ACSA 1EP8A 1TRUA 3P90A 1M99A 1HNBA 1WP0A 3VK9A 2HNLA 1MD3A 17GSA 4FH8A 4MPFA 3F3RA 4NXIA 3ZFBA 3I9V2 1H4OA 4GWRA 4RQXA 3GIXA 1K0MA 3HJOA 3DYRA 3DVWA 2YWIA 1TRWA 2HYXA 4GQFA 4KSMA 2I4AA 2GT6A 1ZL9A 2IL3A 2JSZA 3KGKA 2A2RA 2V1MA 4ZL8A 2H0HA 4PUAA 1GSQA 2YWMA 4BA7A 2B5EA 22GSA 2C1YA 4HJMA 4KNDA 3WGXA 1HQOA 1G7OA 2C4JA 1JZDA 5F0GA 2EIQA 3GMFA 4MF5A 3UJ1A 2FUG2 3ED3A 3DMLA 4TRXA 4FYBA 3RHCA 5ABRA 2VOCA 2LTKA 3CRTA 3IRAA 1TP9A 4KDUA 3DGQA 3I69A 1LU4A 3PR8A 1HYUA 2R4VA 4EDYA 2OE1A 3LFLA 3P8WA 3LWAA 3G7YA 2N5AA 3NIVA 2AV4A 5H5QA 3RPNA 4GCIA 3SWLA 4OFMA 3G7JA 3EU4A 5H5RA 4F0CA 5J9BA 4J2FA 3KMNA 4MF7A 2HRFA 1OYJA 2JZTA 4PNGA 4EUYA 2PVOC 1JLVA 2IFQB 4TR0A 2H73A 1B9XC 3LXZA 4K6XA 4IELA 3DXBA 3LSZA 2R2JA 2GQLA 2AUVA 1I5GA 4F03A 2FY6A 2TRCP 3RBTA 5ECIB 2WJUA 3L78A 4BWSA 1XW9A 1IYHA 5LD0A 3GTUA 3TOTA 1T4ZA 1USBA 3GTUB 3IK7A 4PX1A 3EMPA 5EPFA 1O8XA 2B7KA 4WBJA 3PH9A 1GTUA 1KNGA 3D4TA 4PNFA 3D22A 3GH6A 4XS4A 1GSFA 4MA9A 1TXXA 1U3IA 1NSWA 3BOAA 3W8SA 5DAKA 2YZUA 1DSBA 3QDNA 4WF5A 4MCUA 4QL7A 4OMVA 2QC7A 5JWQB 2L4CA 2FA4A 4L8EA 1TK5B 1K0NA 4XS6A 1BYEA 2QKEA 3CSHA 4DSSA 2JSYA 2HZEA 3ERFA 2HZEB 3BCKA 2L4QA 3DRNA 1DE1A 13GSA 4XCSA 4TVEA 1NHOA 5FT3A 1XXUA 2JZSA 5D9VA 4GTUA 4F2IA 1TK8B 3TJBA 4V2NA 3FHKA 2LNSA 4L5OA 4Q5NA 4TOPA 1WWJA 1SD8A 1VF1A 2J9HA 4CDOA 1SL1B 1FVKA 1FOVA 4QL9A 4KDXA 3ME7A 3D0ZA 3WD6A 2H30A 3C1SA 3EU3A 1BJXA 2H0GA 2K8VA 1GSSA 2ON5A 2DJJA 2MMAA 2XHFA 4Q5RA 2LJKA 2O89A 2K18A 5DQSA 2OJLA 2BMXA 3DEXA 4NV5A 1XWAA 1YQ1A 2YANA 4IS0A 4O92A 5GSTA 5LCZA 4HEA2 1RQMA 5IOWA 2H1DA 2CVDA 2DJ3A 1XFLA 3APSA 3H93A 1TU7A 4DVCA 5ELAA 5HFIA 2CAIA 2I3YA 1AAZA 5D73A 4MJCA 4HQZA 3IXRA 4ZIJA 1Z6MA 3IE3A 1KBNA 5COHA 1GSYA 1OKTA 2H70A 2PU9C 1SYRA 2GZPA 3TRXA 2V6KA 4TN8A 3EC3A 2RUEA 2WS2A 3QAGA 4D73A 4DSRA 2MMOA 4OCEA 5EY6A 1PMTA 3M0FA 5A4WA 18GSA 4IHUA 4HU9A 1RK4A 3W6GA 4PXOA 10GSA 3LYPA 1BG5A 2VLUA 2VIMA 3QR6A 3VFIA 3L9VA 5IO2A 3E9JB 5DCHA 1B8XA 2QGVA 3M9KA 3TKSC 1PSQA 1GRXA 3UOMA 3MAKA 4MJEA 4EVMA 1A8YA 4HZ4A 1YJ6A 4POKA 2C0FA 2YOIA 1S3DA 5HR1A 1TI3A 1TRVA 5G1LA 4NPBA 1SL2B 4KCEA 2VM2A 5IOXA 3UBKA 5IMZA 2VL2C 2EIRA 3GL3A 3ISOA 1YDKA 1GTAA 1QGVA 2VM1A 3FR3A 3UMAA 3JCML 3ERWA 2YWOA 1OVNA 1GSEA 2I81A 4YH2A 3GURA 1SK2A 4GRFA 5E59A 2YN1A 4TKYA 5JCUA 3ZMKA 1QFNA 1M7TA 4XRAA 3C8EA 1WPIA 3TKPA 1V98A 2E2GA 3HZ4A 1ZYQB 3P2AA 1QXHA 2FGXA 1SKRB 3GUSA 2ZCTA 2WULA 3TJKA 4IQAA 3DVXA 3TKSA 5KEJA 1DE2A 2C3TA 4AJ8A 5LNKe 4XTSA 2EIOA 3C1RA 4FYUA 5ECPB 1Q4JA 3HVXA 1T7PB 1BX9A
chains in the Genus database with same CATH superfamily
4ECIA 1WJKA 4LMWA 4K5SA 4FYCA 2KOKA 3LXTA 3WGEA 3O3TA 2MBTA 1E6BA 2FWHA 2VCVA 1A0RP 4J57E 2WCIA 1MDIA 3BD2A 1GUKA 1T1VA 5CRWA 3BBYA 1EGRA 2VL2A 1F3BA 1Q98A 4ZB9A 2DMMA 3FR9A 3GN3A 2WFCA 9GSSA 2V41A 5J4UA 1VGLA 2PUKC 1GNWA 3EVIA 1R5AA 2YNXA 4MZWA 4PUFC 2DLXA 2H19A 4OO4A 1M2BA 2DSAA 2O8VB 3F3QA 2CT6A 3VPTA 2A4HA 1G6YA 2F8AA 2C0EA 1ZYEA 2M72A 2D2ZA 3FZAA 1M2DA 2GSSA 3UEMA 4RUVA 2LRNA 1XOBA 4ISDA 2QSIA 1TKDB 4I2UA 2A2SA 6GSSA 1ERUA 1ACVA 1UC7A 2H1GA 5IMDA 4ZL9A 1XVQA 2H74A 5ID2B 2YCDA 2FWGA 2H8LA 3QPMA 4ML1A 4GQCA 4P3YB 1HNCA 4X4JA 3EE2A 4JE1A 4KUNA 5ECRB 3MNGA 1OE8A 5EL8A 4HI7A 4F82A 1CQHA 1T3BA 3VWXA 4EIPA 5IPHA 3A2WA 2TRXA 3I6AA 5E4WA 5B7CA 3US3A 5CAXA 1QMVA 5IO0A 4JZQA 1PKZA 2LJAA 2HSHA 5EVOA 4TR1B 5IMAA 2YJ7A 5F06A 12GSA 1N8JA 2GTUA 6GSVA 2G0FA 4L0UA 5D8IA 5G5FA 1AQVA 2AYTA 3A5IA 3HA9A 3UBLA 1O73A 4XRDA 2FLSA 1FVJA 3HYPA 3AY8A 2IMFA 2GT5A 1GUHA 2L59A 1SL0B 4OD7A 1XG8A 4F0BA 2XPDA 2KUCA 3TGZA 3MWHA 1Y6EA 3HDCA 3LORA 4BVYA 2G2QA 1X5CA 1U88A 4BVYB 3UAPA 4LLRA 2YV7A 1B9YC 1M9AA 1A0FA 2OBKA 1KTEA 2X8GA 2H01A 5D96A 2L6DA 4KX4A 3O6TA 3N5OA 4HQSA 5D93A 4HZ2A 1X5EA 4MLYA 3E0UA 1X5DA 3R3EA 4MK3A 2RM6A 4ECJA 2L5OA 3TUEA 2DKHA 3M1GA 1K0DA 3PGTA 3F6DA 2NDOA 1JZRA 2JZRA 1EWXA 4PURA 5DCGA 1MD4A 2GQKA 1SJIA 1ML6A 2MMZA 4IKHA 4GLTA 5ECNB 4GSNA 4TXOA 4YQVA 3GX0A 5HR3A 3F9UA 1K0AA 1A24A 1QK8A 2OADA 3KEBA 1GSDA 4V2MA 3RAZA 4ID0A 2IMEA 2N5BA 3BCIA 3QOUA 1AQWA 5HQPA 5CRGA 4DSQA 4OCFA 3H1NA 3WYWA 3ZFLA 1YEPA 2JADA 3ZLPA 1TOFA 1A2LA 3DIEA 4K7NA 5G5EA 3HVSA 5INYA 3GYKA 1S3AA 6GSYA 1SJZA 8GSSA 1FOHA 4ZBDA 4O5RA 3ERGA 2KLXA 6GSXA 4XS4B 4Z2UA 3ZL5A 2WB9A 1O85A 2RLIA 5ECMB 5IPGA 2K6VA 2DIYA 5DAKB 2N5FA 3SBCA 5ECKB 2DBCA 1EZKA 3IBHA 3GKMA 4ZBBA 4K8MA 2LNTA 3G7IA 3R2QA 2IMKA 3PINA 1H75A 1XWKA 3K8NA 3TRPA 2A2PA 1GNEA 2DJ2A 2A4VA 1PD21 4AJ6A 1XPVA 5ECHB 5B6NA 4ZB8A 4F9ZA 1WRYA 2YWNA 3F4RA 4DSSB 1T8EB 5B8BA 3VI5A 2Z9SA 5AGYA 3GSSA 2PBJA 4ULXA 3KTLA 3GA4A 2TIRA 1AQXA 4ECCA 1PL2A 1FG4A 2DJ0A 3QAVA 5F07A 2VCWA 3ZVJA 2IMDA 1ERTA 5G1KA 1AC1A 3F6FA 1K0BA 4IN0A 3F4TA 4LA1A 2ON7A 1BAYA 3L4NA 2KP1A 2LJRA 4K2DA 1FW1A 1SK1A 2DJ1A 2AHEA 2IJYA 14GSA 2YV9A 1TW9A 2YPMA 3GKXA 4POBA 1T4YA 1B4QA 2ZUPA 1JZWA 4BL7A 1XW5A 3G9BA 4BL7B 5AIVA 1F2EA 1FO5A 3IHQA 1XWGA 1GL8A 4E8HA 2R6KA 4RI7A 3HD5A 4MPGA 3LJRA 4G19A 4CW9A 4WETA 5DJLA 3A3TA 3S9FA 4KDYA 4BVXA 3LG6A 1SD9A 4QQ7A 3BJ5A 4WF4A 4X43A 4ZL7A 3FW2A 3TKSE 5D9XA 2LS5A 3UVTA 2CVKA 4H86A 3WGDA 1SJ6A 3RDWA 3C73A 7GSSA 3FR6A 4IJIA 2L6CA 4OWYA 2GSQA 4N11A 2HRNA 4POMA 4HUAA 3RPPA 1ABAA 2X8HA 3DD3A 1Y25A 1C72A 2PMTA 4D73B 2CA8A 3QD9A 4N0VA 4HJ2A 3QMXA 3KP8A 4ECBA 1EV4A 1THXA 5HR2A 5GZZB 4RI6A 3FYGA 1EGOA 1R7HA 3M9JA 4LL1B 5AISA 5A4UA 3D21A 2JL4A 1JLWA 3WT1A 3IC8A 1A8LA 1TDIA 1TK0B 2GGTA 4O7HA 1SKWB 3C71A 2V6OA 1BQ7A 5IQYA 4NHWA 4ZBAA 2OKAA 4G0IA 5HFGA 4PGTA 3Q19A 3QFAC 3EINA 1WMJA 3GH9A 2MYGA 2JACA 1CQGA 5H5SA 5CREA 4BWQA 1WIKA 3Q18A 4MJAA 2ZNMA 2LQOA 2VLTA 1PN9A 5CRHA 2HSYA 3M3MA 3Q74A 2GS3A 3TDGA 3Q6OA 2HRAA 3GKNA 1FAAA 4K5RA 5B6MA 1OC9A 4NAXA 1VF2A 2V2GA 1NHYA 3MYDA 3IAM2 1JFUA 2H76A 2O7KA 2LKUA 1ZZYA 3UVHA 2PN8A 3NOFA 1ON4A 1ST9A 1OC3A 5DBQA 1UVZA 1XVWA 4HSCX 5BMUA 2PERA 4I6XA 4POLA 5A5KA 3KH9A 4IW9A 3VPQA 4X0XA 5GAND 2VAFA 1PFOA 1AIUA 1B48A 2VUPA 3EURA 4KW6A 4TR4A 5KN3A 1S3RA 4WR5A 5DALA 1EOHA 4EE0A 1GP1A 1WOUA 5HFKA 2KHPA 2VLVA 4PQHA 3D6IA 3I43A 1R5PA 4O5QA 4CY8A 2HSMA 4V1Ap 2DJKA 2VCZA 4ZXGA 3KMOA 3IOSA 2PGTA 5BRTA 2HXKA 3FZ4A 1WE0A 4WR4A 4TR3A 4JRRA 5ECQB 4WXTA 11GSA 3IR4A 2GLRA 3GRXA 4EIQA 3QCPA 2R0CA 2F8FA 1K3LA 5G30A 3IDVA 1GWCA 1YKCA 4MJBA 2B7JA 2VCQA 2FCHA 4K7IA 2NTOA 3KH7A 3GHAA 1GSUA 3TOUA 3ZREA 3DWVA 3L0HA 2P5QA 5ENUA 3VWWA 1MEKA 2AJQB 4G9HA 2J23A 1PN0A 2OACA 3MSZA 5IMCA 4J56E 4MH2A 5JCWA 2R0GA 4FIWA 2F9SA 3CRUA 1V40A 2CVBA 1AXDA 5HR0A 2HZFA 3ZZXA 2OE3A 1YY7A 4EC0A 5KOXA 4KH7A 4EXJA 3APQA 2LRCA 2F51A 2WGRA 3VI7A 3HJMA 3HKRA 3FEUA 4MMMA 4EO3A 2M46A 1O81A 3CSIA 1K0CA 1B4PA 2BJXA 3CYNA 2GSRA 1SENA 2X8CA 4YAVA 4K7OA 1LJRA 1JZOA 1OAZA 3GFKA 1G6WA 1GLQA 5FWGA 3TJJA 3CTGA 5L71A 4MH3A 3UL3A 1THOA 2YJHA 1F9MA 1F6MC 2LQQA 2VCTA 1M3IA 2K8SA 1U3AA 3A2VA 1TTZA 1FHEA 1EEMA 1PRXA 1J9BA 4NWYA 2CZ3A 1DBYA 5JCGA 3FRCA 2X99A 2QA2A 1O7UA 3ZTLA 4JR4A 4JEDA 3U6VA 4NMUA 2GSTA 4HS1A 4IP6A 2ALBA 2PPTA 1HD2A 4KB3A 3H4KA 2B6MA 1K3OA 1UA5A 4K9ZA 3OR5A 2FA8A 3FK8A 4NHZA 1Z7RA 3EMXA 1O8WA 1GULA 1E2YA 3A2XA 2VO4A 1U87A 5A4VA 4KCAA 1A2JA 1S3CA 4OO5A 4Z2RA 1XWBA 2IIYA 2P31A 1MDJA 4WEYA 3U5RE 3EYTA 1V58A 2HE3A 2PWJA 5CNWA 1YKAA 2L5LA 3IAS2 1PX7A 1NW2A 2LV3A 1Z5YE 1A2MA 3J7Yb 2FWEA 3CBUA 3LGCA 3FY7A 4KAEA 3KZQA 19GSA 4TXOB 1PQNA 5DDLA 5ECSA 4YAPA 2IPAA 3EWLA 1U6TA 1O6JA 2HFDA 3IC4A 4I97A 1GTBA 3HCZA 2B5YA 3HVNA 4CHSA 2WRTA 3TB2A 1T00A 1UN2A 4I5QA 3VLNA 2C3NA 3HHVA 4XS1A 5B8AA 1XWCA 3LQ7A 2O85A 2RIIA 5ECOB 2IFQA 1ERWA 1GH2A 4JU5A 4ZB6A 3KD0A 3GSTA 2REMA 3VWVA 3TJGA 2DC5A 6GSWA 4EF0A 3CQFA 1GTIA 1EV9A 2HT9A 20GSA 1J08A 2H1AA 1TI1A 1SK0A 4RQRA 2F3MA 3HXSA 5DJMA 16GSA 2IMIA 5D9WA 1ZGNA 1XIYA 4KGIA 1V9WA 3GKKA 5J3RA 4OFNA 2E0QA 3H8QA 1XW6A 2VCXA 2XBQA 3KP9A 4ZILA 2KP2A 1V57A 5J9CA 3W8JA 1ZCPA 2PVQA 4V1Ag 3ZIJA 1FB0A 1ERVA 1NM3A 4MDCA 3UIWA 1X9WB 3MIXA 1XZOA 1AUCA 3D4MA 1ZYNA 2R5GA 2AAWA 4EKZA 4KA0A 3VURA 1Z3EA 4K0NA 4O5UA 1QUWA 5ELGA 2VD1A 4Q5QA 4ML6A 4BPYA 3H79A 4MP4A 5GSSA 4MZBA 2GZZA 3P7XA 1Z7PA 4JBBA 2VL3A 3QFBC 2H0IA 3HZ8A 3GL5A 3CMIA 1DUGA 1YZXA 4AGSA 2B1KA 4ILFA 2IN3A 3KM6A 6GSTA 3KJYA 4XHMA 3ZYWA 1PA3A 5KN1A 4N10A 4N30A 4PQ1A 2CQ9A 1N2AA 3KTBA 3N9JA 3WT2A 5JWRB 2X49A 5G2ZA 3IK9A 2C80A 2IWTA 3F0IA 4GSTA 2XC2A 1YF1A 3F63A 4NV2A 3L9UA 5IIZA 2V32A 3TKRA 2WDUA 1TRSA 5GAPD 5DVBA 4BVXB 4KSOA 1MTCA 1Z6NA 1K0OA 4TXVA 2FWFA 4WBRD 5KOWA 4K1FA 4MZCA 4EDZA 4L5LA 2NBSA 2CAQA 1VF4A 3ZVJD 1J0FA 1HNAA 1SYXA 4Q5FA 1VF3A 2RM5A 4A5PA 4WKWA 2BTOT 3LW9A 4YQUA 1F37A 3ZITA 3O76A 5F05A 2H6XA 2YP6A 4GXZA 1LBKA 4AF2A 1M9BA 3F4SA 3FZ9A 2NVLA 2GDRA 2P5RA 1G7EA 2WZ9A 3UARA 2H6ZA 3L9SA 2DKIA 2MZCA 4O32A 1IYIA 4KF9A 1I9DA 2B5XA 2GVPA 3EPTA 4K0GA 2E2MA 2GZYA 3GV1A 1XBSA 3TCOA 3M8NA 2OA7A 2HLSA 1RW1A 5CYYA 4DEJA 4X1UA 1R4WA 4E8EA 1PX6A 2CX4A 4OFTA 3CXGA 2XPEA 3HVVA 1VRSD 2LRTA 2DIZA 3ZIVA 2I1UA 1URMA 4EL1A 1ILOA 2H71A 3TJFA 4HOJA 4GSSA 2DMLA 4MF6A 2LUSA 1K3YA 3DKSA 4L0WA 2ES7A 3A5WA 1ZOFA 4IJ3A 3F8UA 1OC9B 3CTFA 2VL9A 4MNNA 1XOAA 4N0ZA 3KCMA 1G0TA 2C0DA 5IMVA 2M80A 1PKWA 2EC4A 1GLPA 3IV4A 2FNOA 2C8UA 4YQMA 5AIXA 3ZRDA 4IP1A 1AW9A 3V1WA 2CV4A 3GNJA 2HRKA 1X0RA 2CX3A 2LSTA 4G10A 1F3AA 4JR6A 2XBIA 1TU8A 5CP1A 5DALB 6GSUA 1YEXA 1JHBA 2H1BA 5F8BA 2LEGA 4XIHA 3LEFA 2MMNA 5IMFA 4GF0A 3HY2A 1X9MB 1XCCA 2B1LA 3FKFA 1FB6A 4ICYA 5CO3A 2RUFA 1EP7A 5DQYA 3KIJA 4PTSA 5C00A 4IBPA 5KN0A 3IA1A 5IM9A 1PL1A 3FMWA 5KN2A 2NPBA 2YZHA 1M0UA 1Z9HA 1X9SB 3LYKA 1W4VA 3ZMLA 2OBIA 5CRDA 5G31A 1OC8A 4V2LA 5ECLB 3NZNA 5FHIA 3E3EA 2AB6A 1ZMAA 2R3XA 3C7MA 3D5JA 1PGTA 3TRQA 3GX8A 3MDKA 3IPZA 2C3QA 4Z7XA 2X64A 4PQIA 2GQMA 3FZ5A 2B3SA 4IVFA 5D9TA 1GUMA 1V2AA 4I8BA 3J7Yk 1EEJA 2K9FA 3KXOA 2CZ2A 1R26A 2H6YA 1OE7A 1QQ2A 2VD0A 1SKSB 2R37A 4HDEA 5C04A 4AJ7A 2C0GA 5J41A 3ME8A 5J5NA 4KE3A 2E7PA 3IHGA 4MABA 4LMVA 2JU5A 2HI7A 5JWOB 4CY6A 1OKDA 1SU9A 5AN1A 2X4AA 4FO5A 1KEBA 4IGJA 1TJDA 5ID2A 4IQ1A 2MBSA 1BEDA 4I2TA 1YF0A 2FHEA 2H75A 3HJPA 4TW5A 3RHBA 2I9HA 2FD3A 1EOGA 3VWUA 2L57A 1W89A 4HU7A 1MDKA 2H66A 4USSA 4G2EA 3TKQA 1A23A 1M2AA 2O87A 2OE0A 3CSJA 2QA1A 3QAWA 3APOA 4LL4B 2P0GA 2H72A 4TR1A 4ACSA 1EP8A 1TRUA 3P90A 1M99A 1HNBA 1WP0A 3VK9A 2HNLA 1MD3A 17GSA 4FH8A 4MPFA 3F3RA 4NXIA 3ZFBA 3I9V2 1H4OA 4GWRA 4RQXA 3GIXA 1K0MA 3HJOA 3DYRA 3DVWA 2YWIA 1TRWA 2HYXA 4GQFA 4KSMA 2I4AA 2GT6A 1ZL9A 2IL3A 4YKGA 2JSZA 3KGKA 4G0LA 2A2RA 2V1MA 4ZL8A 2H0HA 4PUAA 1GSQA 2YWMA 4BA7A 2B5EA 22GSA 2C1YA 4HJMA 4KNDA 3WGXA 1HQOA 1G7OA 2C4JA 1JZDA 5F0GA 2EIQA 3GMFA 4MF5A 3UJ1A 2FUG2 3ED3A 3DMLA 4TRXA 4FYBA 3RHCA 5ABRA 2VOCA 2LTKA 3CRTA 3IRAA 1TP9A 4KDUA 3DGQA 3I69A 1LU4A 3PR8A 1HYUA 2R4VA 4EDYA 2OE1A 3LFLA 3P8WA 3LWAA 3G7YA 2N5AA 3NIVA 2AV4A 4K2XA 5H5QA 3RPNA 4GCIA 3SWLA 4OFMA 3G7JA 3EU4A 5H5RA 4F0CA 5J9BA 4J2FA 3KMNA 4MF7A 2HRFA 1OYJA 2JZTA 4PNGA 4EUYA 2PVOC 1JLVA 2IFQB 4TR0A 2H73A 1B9XC 3LXZA 4K6XA 4IELA 3DXBA 3LSZA 2R2JA 2GQLA 2AUVA 1I5GA 4F03A 2FY6A 2TRCP 3RBTA 5ECIB 2WJUA 3L78A 4BWSA 1XW9A 1IYHA 5LD0A 3GTUA 3TOTA 1T4ZA 1USBA 3GTUB 3IK7A 4PX1A 3EMPA 5EPFA 2UZ8A 1O8XA 2B7KA 4WBJA 3PH9A 1GTUA 1KNGA 3D4TA 4PNFA 3D22A 3GH6A 4XS4A 1GSFA 4MA9A 1TXXA 1U3IA 1NSWA 3BOAA 3W8SA 5DAKA 2YZUA 1DSBA 3QDNA 4WF5A 4MCUA 4QL7A 4OMVA 2QC7A 5JWQB 2L4CA 2FA4A 4L8EA 1TK5B 1K0NA 4XS6A 1BYEA 2QKEA 3CSHA 4DSSA 2JSYA 2HZEA 3ERFA 2HZEB 3BCKA 2L4QA 3DRNA 1DE1A 13GSA 4XCSA 4TVEA 1NHOA 5FT3A 1XXUA 2JZSA 5D9VA 4GTUA 4F2IA 1TK8B 3TJBA 4V2NA 3FHKA 2LNSA 4L5OA 4Q5NA 4TOPA 1WWJA 1SD8A 1VF1A 2J9HA 4BIKA 4CDOA 1SL1B 1FVKA 1FOVA 4QL9A 4Z2TA 4KDXA 3ME7A 3D0ZA 3WD6A 2H30A 3C1SA 3EU3A 1BJXA 2H0GA 2K8VA 1GSSA 2ON5A 2DJJA 2MMAA 2XHFA 4Q5RA 2LJKA 2O89A 2K18A 5DQSA 2OJLA 2BMXA 3DEXA 4NV5A 1XWAA 1YQ1A 2YANA 4IS0A 4O92A 5GSTA 5LCZA 4HEA2 1RQMA 5IOWA 2H1DA 2CVDA 2DJ3A 1XFLA 3APSA 1ZYPA 3H93A 1TU7A 4DVCA 5ELAA 5HFIA 2CAIA 2I3YA 1AAZA 5D73A 3PPUA 4MJCA 4HQZA 3IXRA 4ZIJA 1Z6MA 3IE3A 1KBNA 5COHA 1GSYA 1OKTA 2H70A 2PU9C 1SYRA 2GZPA 3TRXA 2V6KA 4TN8A 3EC3A 2RUEA 2WS2A 3QAGA 4D73A 4DSRA 2MMOA 4OCEA 5EY6A 1PMTA 3M0FA 5A4WA 18GSA 4IHUA 4HU9A 1RK4A 3W6GA 4PXOA 10GSA 3LYPA 1BG5A 2VLUA 2VIMA 3QR6A 3VFIA 4YKFA 3L9VA 5IO2A 3E9JB 5DCHA 1B8XA 2QGVA 3M9KA 3TKSC 1PSQA 1GRXA 3UOMA 3MAKA 4MJEA 4EVMA 1A8YA 4HZ4A 1YJ6A 4POKA 2C0FA 2YOIA 1S3DA 5HR1A 1TI3A 1TRVA 5G1LA 4NPBA 1SL2B 4KCEA 2VM2A 5IOXA 3UBKA 5IMZA 2VL2C 2EIRA 3GL3A 3ISOA 1GTAA 1YDKA 1QGVA 2VM1A 3FR3A 3UMAA 3JCML 3ERWA 2YWOA 1OVNA 1GSEA 2I81A 4YH2A 3GURA 1SK2A 4GRFA 4FQUA 5E59A 2YN1A 4TKYA 1M3JA 5JCUA 3ZMKA 2R0PA 1QFNA 1M7TA 4XRAA 3C8EA 1WPIA 3TKPA 1V98A 2E2GA 3HZ4A 4G0KA 1ZYQB 3P2AA 1QXHA 2FGXA 1SKRB 3GUSA 2ZCTA 2WULA 3TJKA 4IQAA 3DVXA 3TKSA 5KEJA 1DE2A 2C3TA 4AJ8A 5LNKe 4XTSA 2EIOA 3C1RA 4FYUA 5ECPB 1Q4JA 3HVXA 1T7PB 1BX9A
chains in the Genus database with same CATH topology
4ECIA 1WJKA 4LMWA 4K5SA 4FYCA 2KOKA 3LXTA 3WGEA 3O3TA 2MBTA 1E6BA 2FWHA 2VCVA 1A0RP 4J57E 2WCIA 1MDIA 3BD2A 1GUKA 1T1VA 5CRWA 3BBYA 1EGRA 2VL2A 1F3BA 1Q98A 4ZB9A 2DMMA 3FR9A 3GN3A 2WFCA 9GSSA 2V41A 5J4UA 1VGLA 2PUKC 1GNWA 3EVIA 1R5AA 2YNXA 4MZWA 4PUFC 2DLXA 2H19A 4OO4A 1M2BA 2DSAA 2O8VB 3F3QA 2CT6A 3VPTA 2A4HA 1G6YA 2F8AA 2C0EA 1ZYEA 2M72A 2D2ZA 3FZAA 1M2DA 2GSSA 3UEMA 4RUVA 2LRNA 1XOBA 4ISDA 2QSIA 1TKDB 4I2UA 2A2SA 6GSSA 1ERUA 1ACVA 1UC7A 2H1GA 5IMDA 4ZL9A 1XVQA 2H74A 5ID2B 2YCDA 2FWGA 2H8LA 3QPMA 4ML1A 4GQCA 4P3YB 1HNCA 4X4JA 3EE2A 4JE1A 4KUNA 5ECRB 3MNGA 1OE8A 5EL8A 4HI7A 4F82A 1CQHA 1T3BA 3VWXA 4EIPA 5IPHA 3A2WA 2TRXA 3I6AA 5E4WA 5B7CA 3US3A 5CAXA 1QMVA 5IO0A 4JZQA 1PKZA 2LJAA 2HSHA 5EVOA 4TR1B 5IMAA 2YJ7A 5F06A 12GSA 1N8JA 2GTUA 6GSVA 2G0FA 4L0UA 5D8IA 5G5FA 1AQVA 2AYTA 3A5IA 3HA9A 3UBLA 1O73A 4XRDA 2FLSA 1FVJA 3HYPA 3AY8A 2IMFA 2GT5A 1GUHA 2L59A 1SL0B 4OD7A 4F0BA 2XPDA 2KUCA 3TGZA 3MWHA 1Y6EA 3HDCA 3LORA 4BVYA 2G2QA 1X5CA 1U88A 4BVYB 3UAPA 4LLRA 2YV7A 1B9YC 1M9AA 1A0FA 2OBKA 1KTEA 2X8GA 2H01A 5D96A 2L6DA 4KX4A 3O6TA 3N5OA 4HQSA 5D93A 4HZ2A 1X5EA 4MLYA 3E0UA 1X5DA 3R3EA 4MK3A 2RM6A 4ECJA 2L5OA 3TUEA 2DKHA 3M1GA 1K0DA 3PGTA 3F6DA 2NDOA 1JZRA 2JZRA 1EWXA 4PURA 5DCGA 1MD4A 2GQKA 1SJIA 1ML6A 2MMZA 4IKHA 4GLTA 5ECNB 4GSNA 4TXOA 4YQVA 3GX0A 5HR3A 3F9UA 1K0AA 1A24A 1QK8A 2OADA 3KEBA 1GSDA 4V2MA 3RAZA 4ID0A 2IMEA 2N5BA 3BCIA 3QOUA 1AQWA 5HQPA 5CRGA 4DSQA 4OCFA 3H1NA 3WYWA 3ZFLA 1YEPA 2JADA 3ZLPA 1TOFA 1A2LA 3DIEA 4K7NA 5G5EA 3HVSA 5INYA 3GYKA 1S3AA 6GSYA 1SJZA 8GSSA 1FOHA 4ZBDA 4O5RA 3ERGA 2KLXA 6GSXA 4XS4B 4Z2UA 3ZL5A 2WB9A 1O85A 2RLIA 5ECMB 5IPGA 2K6VA 2DIYA 5DAKB 2N5FA 3SBCA 5ECKB 2DBCA 1EZKA 3IBHA 3GKMA 4ZBBA 4K8MA 2LNTA 3G7IA 3R2QA 2IMKA 3PINA 1H75A 1XWKA 3K8NA 3TRPA 2A2PA 1GNEA 2DJ2A 2A4VA 1PD21 4AJ6A 1XPVA 5ECHB 5B6NA 4ZB8A 4F9ZA 1WRYA 2YWNA 3F4RA 4DSSB 1T8EB 5B8BA 3VI5A 2Z9SA 5AGYA 3GSSA 2PBJA 4ULXA 3KTLA 3GA4A 2TIRA 1AQXA 4ECCA 1PL2A 1FG4A 2DJ0A 3QAVA 5F07A 2VCWA 3ZVJA 2IMDA 1ERTA 5G1KA 1AC1A 3F6FA 1K0BA 4IN0A 3F4TA 4LA1A 2ON7A 1BAYA 3L4NA 2KP1A 2LJRA 4K2DA 1FW1A 1SK1A 2DJ1A 2AHEA 2IJYA 14GSA 2YV9A 1TW9A 2YPMA 3GKXA 4POBA 1T4YA 1B4QA 2ZUPA 1JZWA 4BL7A 1XW5A 3G9BA 4BL7B 5AIVA 1F2EA 1FO5A 3IHQA 1XWGA 1GL8A 4E8HA 2R6KA 4RI7A 3HD5A 4MPGA 3LJRA 4G19A 4CW9A 4WETA 5DJLA 3A3TA 3S9FA 4KDYA 4BVXA 3LG6A 1SD9A 4QQ7A 3BJ5A 4WF4A 4X43A 4ZL7A 3FW2A 3TKSE 5D9XA 2LS5A 3UVTA 2CVKA 4H86A 3WGDA 1SJ6A 3RDWA 3C73A 7GSSA 3FR6A 4IJIA 2L6CA 4OWYA 2GSQA 4N11A 2HRNA 4POMA 4HUAA 3RPPA 1ABAA 2X8HA 3DD3A 1Y25A 1C72A 2PMTA 4D73B 2CA8A 3QD9A 4N0VA 4HJ2A 3QMXA 3KP8A 4ECBA 1EV4A 1THXA 5HR2A 5GZZB 4RI6A 3FYGA 1EGOA 1R7HA 3M9JA 4LL1B 5AISA 5A4UA 3D21A 2JL4A 1JLWA 3WT1A 3IC8A 1A8LA 1TDIA 1TK0B 2GGTA 4O7HA 1SKWB 3C71A 2V6OA 1BQ7A 5IQYA 4NHWA 4ZBAA 2OKAA 4G0IA 5HFGA 4PGTA 3Q19A 3QFAC 3EINA 1WMJA 3GH9A 2MYGA 2JACA 1CQGA 5H5SA 5CREA 4BWQA 1WIKA 3Q18A 4MJAA 2ZNMA 2LQOA 2VLTA 1PN9A 5CRHA 2HSYA 3M3MA 3Q74A 2GS3A 3TDGA 3Q6OA 2HRAA 3GKNA 1FAAA 4K5RA 5B6MA 1OC9A 4NAXA 1VF2A 2V2GA 1NHYA 3MYDA 3IAM2 1JFUA 2H76A 2O7KA 2LKUA 1ZZYA 3UVHA 2PN8A 3NOFA 1ON4A 1ST9A 1OC3A 5DBQA 1UVZA 1XVWA 5BMUA 2PERA 4I6XA 4POLA 5A5KA 3KH9A 4IW9A 3VPQA 4X0XA 5GAND 2VAFA 1AIUA 1B48A 2VUPA 3EURA 4KW6A 4TR4A 5KN3A 4WR5A 5DALA 1EOHA 4EE0A 1GP1A 1WOUA 5HFKA 2KHPA 2VLVA 4PQHA 3D6IA 3I43A 1R5PA 4O5QA 4CY8A 2HSMA 4V1Ap 2DJKA 2VCZA 4ZXGA 3KMOA 3IOSA 2PGTA 5BRTA 2HXKA 3FZ4A 1WE0A 4WR4A 4TR3A 4JRRA 5ECQB 4WXTA 11GSA 3IR4A 2GLRA 3GRXA 4EIQA 3QCPA 2R0CA 2F8FA 1K3LA 5G30A 3IDVA 1GWCA 1YKCA 4MJBA 2B7JA 2VCQA 2FCHA 4K7IA 2NTOA 3KH7A 3GHAA 1GSUA 3TOUA 3ZREA 3DWVA 3L0HA 2P5QA 5ENUA 3VWWA 1MEKA 2AJQB 4G9HA 2J23A 1PN0A 2OACA 3MSZA 5IMCA 4J56E 4MH2A 5JCWA 2R0GA 4FIWA 2F9SA 3CRUA 1V40A 2CVBA 1AXDA 5HR0A 2HZFA 3ZZXA 2OE3A 1YY7A 4EC0A 5KOXA 4KH7A 4EXJA 3APQA 2LRCA 2F51A 2WGRA 3VI7A 3HJMA 3HKRA 3FEUA 4MMMA 4EO3A 2M46A 1O81A 3CSIA 1K0CA 1B4PA 2BJXA 3CYNA 2GSRA 1SENA 2X8CA 4YAVA 4K7OA 1LJRA 1JZOA 1OAZA 3GFKA 1G6WA 1GLQA 5FWGA 3TJJA 3CTGA 5L71A 4MH3A 3UL3A 1THOA 2YJHA 1F9MA 1F6MC 2LQQA 2VCTA 2K8SA 1U3AA 3A2VA 1TTZA 1FHEA 1EEMA 1PRXA 1J9BA 4NWYA 2CZ3A 1DBYA 5JCGA 3FRCA 2X99A 2QA2A 1O7UA 3ZTLA 4JR4A 4JEDA 3U6VA 4NMUA 2GSTA 4HS1A 4IP6A 2ALBA 2PPTA 1HD2A 4KB3A 3H4KA 2B6MA 1K3OA 1UA5A 4K9ZA 3OR5A 2FA8A 3FK8A 4NHZA 1Z7RA 3EMXA 1O8WA 1GULA 1E2YA 3A2XA 2VO4A 1U87A 5A4VA 4KCAA 1A2JA 1S3CA 4OO5A 4Z2RA 1XWBA 2IIYA 2P31A 1MDJA 4WEYA 3U5RE 3EYTA 1V58A 2HE3A 2PWJA 5CNWA 1YKAA 2L5LA 3IAS2 1PX7A 1NW2A 2LV3A 1Z5YE 1A2MA 3J7Yb 2FWEA 3CBUA 3LGCA 3FY7A 4KAEA 3KZQA 19GSA 4TXOB 1PQNA 5DDLA 5ECSA 4YAPA 2IPAA 3EWLA 1U6TA 1O6JA 2HFDA 3IC4A 4I97A 1GTBA 3HCZA 2B5YA 4CHSA 2WRTA 3TB2A 1T00A 1UN2A 4I5QA 3VLNA 2C3NA 3HHVA 4XS1A 5B8AA 1XWCA 3LQ7A 2O85A 2RIIA 5ECOB 2IFQA 1ERWA 1GH2A 4JU5A 4ZB6A 3KD0A 3GSTA 2REMA 3VWVA 3TJGA 2DC5A 6GSWA 4EF0A 1GTIA 1EV9A 2HT9A 20GSA 1J08A 2H1AA 1TI1A 1SK0A 4RQRA 2F3MA 3HXSA 5DJMA 16GSA 2IMIA 5D9WA 1ZGNA 1XIYA 4KGIA 1V9WA 3GKKA 5J3RA 4OFNA 2E0QA 3H8QA 1XW6A 2VCXA 2XBQA 3KP9A 4ZILA 2KP2A 1V57A 5J9CA 3W8JA 1ZCPA 2PVQA 4V1Ag 3ZIJA 1FB0A 1ERVA 1NM3A 4MDCA 3UIWA 1X9WB 3MIXA 1XZOA 1AUCA 3D4MA 1ZYNA 2R5GA 2AAWA 4EKZA 4KA0A 3VURA 1Z3EA 4K0NA 4O5UA 1QUWA 5ELGA 2VD1A 4Q5QA 4ML6A 4BPYA 3H79A 4MP4A 5GSSA 4MZBA 2GZZA 3P7XA 1Z7PA 4JBBA 2VL3A 3QFBC 2H0IA 3HZ8A 3GL5A 3CMIA 1DUGA 1YZXA 4AGSA 2B1KA 4ILFA 2IN3A 3KM6A 6GSTA 3KJYA 4XHMA 3ZYWA 1PA3A 5KN1A 4N10A 4N30A 4PQ1A 2CQ9A 1N2AA 3KTBA 3N9JA 3WT2A 5JWRB 2X49A 5G2ZA 3IK9A 2C80A 2IWTA 3F0IA 4GSTA 2XC2A 1YF1A 3F63A 4NV2A 3L9UA 5IIZA 2V32A 3TKRA 2WDUA 1TRSA 5GAPD 5DVBA 4BVXB 4KSOA 1MTCA 1Z6NA 1K0OA 4TXVA 2FWFA 4WBRD 5KOWA 4K1FA 4MZCA 4EDZA 4L5LA 2NBSA 2CAQA 1VF4A 3ZVJD 1J0FA 1HNAA 1SYXA 4Q5FA 1VF3A 2RM5A 4A5PA 4WKWA 2BTOT 3LW9A 4YQUA 1F37A 3ZITA 3O76A 5F05A 2H6XA 2YP6A 4GXZA 1LBKA 4AF2A 1M9BA 3F4SA 3FZ9A 2NVLA 2GDRA 2P5RA 1G7EA 2WZ9A 3UARA 2H6ZA 3L9SA 2DKIA 2MZCA 4O32A 1IYIA 4KF9A 1I9DA 2B5XA 2GVPA 3EPTA 4K0GA 2E2MA 2GZYA 3GV1A 1XBSA 3TCOA 3M8NA 2OA7A 2HLSA 1RW1A 5CYYA 4DEJA 4X1UA 1R4WA 4E8EA 1PX6A 2CX4A 4OFTA 3CXGA 2XPEA 3HVVA 1VRSD 2LRTA 2DIZA 3ZIVA 2I1UA 1URMA 4EL1A 1ILOA 2H71A 3TJFA 4HOJA 4GSSA 2DMLA 4MF6A 2LUSA 1K3YA 3DKSA 4L0WA 2ES7A 3A5WA 1ZOFA 4IJ3A 3F8UA 1OC9B 3CTFA 2VL9A 4MNNA 1XOAA 4N0ZA 3KCMA 1G0TA 2C0DA 5IMVA 2M80A 1PKWA 2EC4A 1GLPA 3IV4A 2FNOA 2C8UA 4YQMA 5AIXA 3ZRDA 4IP1A 1AW9A 3V1WA 2CV4A 3GNJA 2HRKA 1X0RA 2CX3A 2LSTA 4G10A 1F3AA 4JR6A 2XBIA 1TU8A 5CP1A 5DALB 6GSUA 1YEXA 1JHBA 2H1BA 5F8BA 2LEGA 4XIHA 3LEFA 2MMNA 5IMFA 4GF0A 3HY2A 1X9MB 1XCCA 2B1LA 3FKFA 1FB6A 4ICYA 5CO3A 2RUFA 1EP7A 5DQYA 3KIJA 4PTSA 5C00A 4IBPA 5KN0A 3IA1A 5IM9A 1PL1A 3FMWA 5KN2A 2NPBA 2YZHA 1M0UA 1Z9HA 1X9SB 3LYKA 1W4VA 3ZMLA 2OBIA 5CRDA 5G31A 1OC8A 4V2LA 5ECLB 3NZNA 5FHIA 3E3EA 2AB6A 1ZMAA 2R3XA 3C7MA 3D5JA 1PGTA 3TRQA 3GX8A 3MDKA 3IPZA 2C3QA 4Z7XA 2X64A 4PQIA 2GQMA 3FZ5A 2B3SA 4IVFA 5D9TA 1GUMA 1V2AA 4I8BA 3J7Yk 1EEJA 2K9FA 3KXOA 2CZ2A 1R26A 2H6YA 1OE7A 1QQ2A 2VD0A 1SKSB 2R37A 4HDEA 5C04A 4AJ7A 2C0GA 5J41A 3ME8A 5J5NA 4KE3A 2E7PA 3IHGA 4MABA 4LMVA 2JU5A 2HI7A 5JWOB 4CY6A 1OKDA 1SU9A 5AN1A 2X4AA 4FO5A 1KEBA 4IGJA 1TJDA 5ID2A 4IQ1A 2MBSA 1BEDA 4I2TA 1YF0A 2FHEA 2H75A 3HJPA 4TW5A 3RHBA 2I9HA 2FD3A 1EOGA 3VWUA 2L57A 1W89A 4HU7A 1MDKA 2H66A 4USSA 4G2EA 3TKQA 1A23A 1M2AA 2O87A 2OE0A 3CSJA 2QA1A 3QAWA 3APOA 4LL4B 2P0GA 2H72A 4TR1A 4ACSA 1EP8A 1TRUA 3P90A 1M99A 1HNBA 1WP0A 3VK9A 2HNLA 1MD3A 17GSA 4FH8A 4MPFA 3F3RA 4NXIA 3ZFBA 3I9V2 1H4OA 4GWRA 4RQXA 3GIXA 1K0MA 3HJOA 3DYRA 3DVWA 2YWIA 1TRWA 2HYXA 4GQFA 4KSMA 2I4AA 2GT6A 1ZL9A 2IL3A 4YKGA 2JSZA 3KGKA 4G0LA 2A2RA 2V1MA 4ZL8A 2H0HA 4PUAA 1GSQA 2YWMA 4BA7A 2B5EA 22GSA 2C1YA 4HJMA 4KNDA 3WGXA 1HQOA 1G7OA 2C4JA 1JZDA 5F0GA 2EIQA 3GMFA 4MF5A 3UJ1A 2FUG2 3ED3A 3DMLA 4TRXA 4FYBA 3RHCA 5ABRA 2VOCA 2LTKA 3CRTA 3IRAA 1TP9A 4KDUA 3DGQA 3I69A 1LU4A 3PR8A 1HYUA 2R4VA 4EDYA 2OE1A 3LFLA 3P8WA 3LWAA 3G7YA 2N5AA 3NIVA 2AV4A 4K2XA 5H5QA 3RPNA 4GCIA 3SWLA 4OFMA 3G7JA 3EU4A 5H5RA 4F0CA 5J9BA 4J2FA 3KMNA 4MF7A 2HRFA 1OYJA 2JZTA 4PNGA 4EUYA 2PVOC 1JLVA 2IFQB 4TR0A 2H73A 1B9XC 3LXZA 4K6XA 4IELA 3DXBA 3LSZA 2R2JA 2GQLA 2AUVA 1I5GA 4F03A 2FY6A 2TRCP 3RBTA 5ECIB 2WJUA 3L78A 4BWSA 1XW9A 1IYHA 5LD0A 3GTUA 3TOTA 1T4ZA 1USBA 3GTUB 3IK7A 4PX1A 3EMPA 5EPFA 2UZ8A 1O8XA 2B7KA 4WBJA 3PH9A 1GTUA 1KNGA 3D4TA 4PNFA 3D22A 3GH6A 4XS4A 1GSFA 4MA9A 1TXXA 1U3IA 1NSWA 3BOAA 3W8SA 5DAKA 2YZUA 1DSBA 3QDNA 4WF5A 4MCUA 4QL7A 4OMVA 2QC7A 5JWQB 2L4CA 2FA4A 4L8EA 1TK5B 1K0NA 4XS6A 1BYEA 2QKEA 3CSHA 4DSSA 2JSYA 2HZEA 3ERFA 2HZEB 3BCKA 2L4QA 3DRNA 1DE1A 13GSA 4XCSA 4TVEA 1NHOA 5FT3A 1XXUA 2JZSA 5D9VA 4GTUA 4F2IA 1TK8B 3TJBA 4V2NA 3FHKA 2LNSA 4L5OA 4Q5NA 4TOPA 1WWJA 1SD8A 1VF1A 2J9HA 4CDOA 1SL1B 1FVKA 1FOVA 4QL9A 4Z2TA 4KDXA 3ME7A 3D0ZA 3WD6A 2H30A 3C1SA 3EU3A 1BJXA 2H0GA 2K8VA 1GSSA 2ON5A 2DJJA 2MMAA 2XHFA 4Q5RA 2LJKA 2O89A 2K18A 5DQSA 2OJLA 2BMXA 3DEXA 4NV5A 1XWAA 1YQ1A 2YANA 4IS0A 4O92A 5GSTA 5LCZA 4HEA2 1RQMA 5IOWA 2H1DA 2CVDA 2DJ3A 1XFLA 3APSA 1ZYPA 3H93A 1TU7A 4DVCA 5ELAA 5HFIA 2CAIA 2I3YA 1AAZA 5D73A 3PPUA 4MJCA 4HQZA 3IXRA 4ZIJA 1Z6MA 3IE3A 1KBNA 5COHA 1GSYA 1OKTA 2H70A 2PU9C 1SYRA 2GZPA 3TRXA 2V6KA 4TN8A 3EC3A 2RUEA 2WS2A 3QAGA 4D73A 4DSRA 2MMOA 4OCEA 5EY6A 1PMTA 3M0FA 5A4WA 18GSA 4IHUA 4HU9A 1RK4A 3W6GA 4PXOA 10GSA 3LYPA 1BG5A 2VLUA 2VIMA 3QR6A 3VFIA 4YKFA 3L9VA 5IO2A 3E9JB 5DCHA 1B8XA 2QGVA 3M9KA 3TKSC 1PSQA 1GRXA 3UOMA 3MAKA 4MJEA 4EVMA 1A8YA 4HZ4A 1YJ6A 4POKA 2C0FA 2YOIA 1S3DA 5HR1A 1TI3A 1TRVA 5G1LA 4NPBA 1SL2B 4KCEA 2VM2A 5IOXA 3UBKA 5IMZA 2VL2C 2EIRA 3GL3A 3ISOA 1YDKA 1GTAA 1QGVA 2VM1A 3FR3A 3UMAA 3JCML 3ERWA 2YWOA 1OVNA 1GSEA 2I81A 4YH2A 3GURA 1SK2A 4GRFA 4FQUA 5E59A 2YN1A 4TKYA 5JCUA 3ZMKA 2R0PA 1QFNA 1M7TA 4XRAA 3C8EA 1WPIA 3TKPA 1V98A 2E2GA 3HZ4A 4G0KA 1ZYQB 3P2AA 1QXHA 2FGXA 1SKRB 3GUSA 2ZCTA 2WULA 3TJKA 4IQAA 3DVXA 3TKSA 5KEJA 1DE2A 2C3TA 4AJ8A 5LNKe 4XTSA 2EIOA 3C1RA 4FYUA 5ECPB 1Q4JA 3HVXA 1T7PB 1BX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECI A;  1WJK A;  4LMW A;  4FYC A;  2KOK A;  3LXT A;  3WGE A;  3O3T A;  2MBT A;  1E6B A;  2FWH A;  2VCV A;  1A0R P;  4J57 E;  2WCI A;  1MDI A;  3BD2 A;  1GUK A;  1T1V A;  5CRW A;  3BBY A;  1EGR A;  2VL2 A;  1F3B A;  1Q98 A;  4ZB9 A;  2DMM A;  3FR9 A;  3GN3 A;  2WFC A;  9GSS A;  2V41 A;  5J4U A;  1VGL A;  2PUK C;  1GNW A;  3EVI A;  1R5A A;  2YNX A;  4MZW A;  4PUF C;  2DLX A;  2H19 A;  4OO4 A;  1M2B A;  2DSA A;  2O8V B;  3F3Q A;  2CT6 A;  3VPT A;  1G6Y A;  2F8A A;  2C0E A;  1ZYE A;  2M72 A;  2D2Z A;  3FZA A;  1M2D A;  2GSS A;  3UEM A;  4RUV A;  2LRN A;  1XOB A;  4ISD A;  2QSI A;  1TKD B;  4I2U A;  2A2S A;  6GSS A;  1ERU A;  1ACV A;  1UC7 A;  2H1G A;  5IMD A;  4ZL9 A;  1XVQ A;  2H74 A;  5ID2 B;  2YCD A;  2FWG A;  2H8L A;  3QPM A;  4ML1 A;  4GQC A;  4P3Y B;  1HNC A;  3EE2 A;  4JE1 A;  4KUN A;  5ECR B;  3MNG A;  1OE8 A;  5EL8 A;  4HI7 A;  4F82 A;  1CQH A;  1T3B A;  3VWX A;  5IPH A;  3A2W A;  2TRX A;  3I6A A;  5E4W A;  5B7C A;  3US3 A;  5CAX A;  1QMV A;  5IO0 A;  4JZQ A;  1PKZ A;  2LJA A;  2HSH A;  5EVO A;  4TR1 B;  5IMA A;  2YJ7 A;  5F06 A;  12GS A;  1N8J A;  2GTU A;  6GSV A;  2G0F A;  4L0U A;  5D8I A;  5G5F A;  1AQV A;  2AYT A;  3HA9 A;  3UBL A;  1O73 A;  4XRD A;  2FLS A;  1FVJ A;  3HYP A;  3AY8 A;  2IMF A;  2GT5 A;  1GUH A;  2L59 A;  1SL0 B;  4OD7 A;  4F0B A;  2XPD A;  2KUC A;  3TGZ A;  3MWH A;  1Y6E A;  3HDC A;  3LOR A;  4BVY A;  2G2Q A;  1X5C A;  1U88 A;  3UAP A;  4LLR A;  2YV7 A;  1B9Y C;  1M9A A;  1A0F A;  2OBK A;  1KTE A;  2X8G A;  2H01 A;  5D96 A;  2L6D A;  4KX4 A;  3O6T A;  3N5O A;  4HQS A;  5D93 A;  4HZ2 A;  1X5E A;  4MLY A;  3E0U A;  1X5D A;  4MK3 A;  2RM6 A;  4ECJ A;  2L5O A;  3TUE A;  3M1G A;  1K0D A;  3PGT A;  3F6D A;  2NDO A;  1JZR A;  2JZR A;  1EWX A;  4PUR A;  5DCG A;  1MD4 A;  2GQK A;  1SJI A;  1ML6 A;  2MMZ A;  4IKH A;  4GLT A;  5ECN B;  4GSN A;  4TXO A;  4YQV A;  3GX0 A;  5HR3 A;  3F9U A;  1K0A A;  1A24 A;  1QK8 A;  2OAD A;  3KEB A;  1GSD A;  4V2M A;  3RAZ A;  4ID0 A;  2IME A;  2N5B A;  3BCI A;  3QOU A;  1AQW A;  5HQP A;  5CRG A;  4DSQ A;  4OCF A;  3H1N A;  3WYW A;  3ZFL A;  1YEP A;  2JAD A;  3ZLP A;  1TOF A;  1A2L A;  3DIE A;  4K7N A;  5G5E A;  3HVS A;  5INY A;  3GYK A;  1S3A A;  6GSY A;  1SJZ A;  8GSS A;  4ZBD A;  4O5R A;  3ERG A;  2KLX A;  6GSX A;  4XS4 B;  3ZL5 A;  2WB9 A;  1O85 A;  2RLI A;  5ECM B;  5IPG A;  2K6V A;  2DIY A;  5DAK B;  2N5F A;  3SBC A;  5ECK B;  2DBC A;  1EZK A;  3IBH A;  3GKM A;  4ZBB A;  4K8M A;  2LNT A;  3G7I A;  3R2Q A;  2IMK A;  3PIN A;  1H75 A;  1XWK A;  3K8N A;  3TRP A;  1GNE A;  2DJ2 A;  2A4V A;  1PD2 1;  4AJ6 A;  1XPV A;  5ECH B;  5B6N A;  4ZB8 A;  4F9Z A;  1WRY A;  2YWN A;  3F4R A;  4DSS B;  1T8E B;  5B8B A;  3VI5 A;  2Z9S A;  5AGY A;  3GSS A;  2PBJ A;  4ULX A;  3KTL A;  3GA4 A;  2TIR A;  1AQX A;  4ECC A;  1PL2 A;  1FG4 A;  2DJ0 A;  3QAV A;  5F07 A;  2VCW A;  3ZVJ A;  2IMD A;  1ERT A;  5G1K A;  1AC1 A;  3F6F A;  1K0B A;  4IN0 A;  3F4T A;  4LA1 A;  2ON7 A;  1BAY A;  3L4N A;  2KP1 A;  2LJR A;  4K2D A;  1FW1 A;  1SK1 A;  2DJ1 A;  2AHE A;  2IJY A;  14GS A;  2YV9 A;  1TW9 A;  2YPM A;  3GKX A;  4POB A;  1T4Y A;  1B4Q A;  2ZUP A;  1JZW A;  4BL7 A;  1XW5 A;  3G9B A;  5AIV A;  1F2E A;  1FO5 A;  3IHQ A;  1XWG A;  1GL8 A;  4E8H A;  2R6K A;  4RI7 A;  3HD5 A;  4MPG A;  3LJR A;  4G19 A;  4CW9 A;  4WET A;  5DJL A;  3A3T A;  3S9F A;  4KDY A;  4BVX A;  3LG6 A;  1SD9 A;  4QQ7 A;  3BJ5 A;  4WF4 A;  4X43 A;  4ZL7 A;  3FW2 A;  3TKS E;  5D9X A;  2LS5 A;  3UVT A;  2CVK A;  4H86 A;  3WGD A;  1SJ6 A;  3RDW A;  3C73 A;  7GSS A;  3FR6 A;  4IJI A;  2L6C A;  4OWY A;  2GSQ A;  4N11 A;  2HRN A;  4POM A;  4HUA A;  3RPP A;  1ABA A;  2X8H A;  3DD3 A;  1Y25 A;  1C72 A;  2PMT A;  4D73 B;  2CA8 A;  3QD9 A;  4N0V A;  4HJ2 A;  3QMX A;  3KP8 A;  4ECB A;  1EV4 A;  1THX A;  5HR2 A;  5GZZ B;  4RI6 A;  3FYG A;  1EGO A;  1R7H A;  3M9J A;  4LL1 B;  5AIS A;  5A4U A;  3D21 A;  2JL4 A;  1JLW A;  3WT1 A;  1A8L A;  1TDI A;  1TK0 B;  2GGT A;  4O7H A;  1SKW B;  3C71 A;  2V6O A;  1BQ7 A;  5IQY A;  4NHW A;  4ZBA A;  2OKA A;  5HFG A;  4PGT A;  3Q19 A;  3QFA C;  3EIN A;  1WMJ A;  3GH9 A;  2MYG A;  2JAC A;  1CQG A;  5H5S A;  5CRE A;  4BWQ A;  1WIK A;  3Q18 A;  4MJA A;  2ZNM A;  2LQO A;  2VLT A;  1PN9 A;  5CRH A;  2HSY A;  3M3M A;  3Q74 A;  2GS3 A;  3TDG A;  3Q6O A;  3GKN A;  1FAA A;  5B6M A;  1OC9 A;  4NAX A;  1VF2 A;  2V2G A;  1NHY A;  3IAM 2;  1JFU A;  2H76 A;  2O7K A;  2LKU A;  1ZZY A;  3UVH A;  2PN8 A;  3NOF A;  1ON4 A;  1ST9 A;  1OC3 A;  5DBQ A;  1UVZ A;  1XVW A;  2PER A;  4I6X A;  4POL A;  5A5K A;  3KH9 A;  4IW9 A;  3VPQ A;  4X0X A;  5GAN D;  2VAF A;  1AIU A;  1B48 A;  2VUP A;  3EUR A;  4KW6 A;  4TR4 A;  5KN3 A;  4WR5 A;  5DAL A;  1EOH A;  4EE0 A;  1GP1 A;  1WOU A;  5HFK A;  2KHP A;  2VLV A;  4PQH A;  3D6I A;  3I43 A;  1R5P A;  4V1A p;  2DJK A;  2VCZ A;  4ZXG A;  3KMO A;  3IOS A;  2PGT A;  2HXK A;  3FZ4 A;  1WE0 A;  4WR4 A;  4TR3 A;  4JRR A;  5ECQ B;  4WXT A;  11GS A;  3IR4 A;  2GLR A;  3GRX A;  3QCP A;  2F8F A;  1K3L A;  5G30 A;  3IDV A;  1GWC A;  1YKC A;  4MJB A;  2B7J A;  2VCQ A;  2FCH A;  4K7I A;  2NTO A;  3KH7 A;  3GHA A;  1GSU A;  3TOU A;  3ZRE A;  3DWV A;  3L0H A;  2P5Q A;  5ENU A;  3VWW A;  1MEK A;  2AJQ B;  4G9H A;  2J23 A;  2OAC A;  3MSZ A;  5IMC A;  4J56 E;  4MH2 A;  5JCW A;  4FIW A;  2F9S A;  3CRU A;  1V40 A;  2CVB A;  1AXD A;  5HR0 A;  2HZF A;  3ZZX A;  2OE3 A;  1YY7 A;  4EC0 A;  4KH7 A;  4EXJ A;  3APQ A;  2LRC A;  2F51 A;  2WGR A;  3VI7 A;  3HJM A;  3HKR A;  3FEU A;  4MMM A;  4EO3 A;  2M46 A;  1O81 A;  3CSI A;  1K0C A;  1B4P A;  2BJX A;  3CYN A;  2GSR A;  1SEN A;  2X8C A;  4YAV A;  4K7O A;  1LJR A;  1JZO A;  1OAZ A;  3GFK A;  1G6W A;  1GLQ A;  5FWG A;  3TJJ A;  3CTG A;  5L71 A;  4MH3 A;  3UL3 A;  1THO A;  2YJH A;  1F9M A;  1F6M C;  2LQQ A;  2VCT A;  2K8S A;  1U3A A;  3A2V A;  1TTZ A;  1FHE A;  1EEM A;  1PRX A;  1J9B A;  4NWY A;  2CZ3 A;  1DBY A;  5JCG A;  3FRC A;  2X99 A;  1O7U A;  3ZTL A;  4JR4 A;  4JED A;  3U6V A;  4NMU A;  2GST A;  4HS1 A;  4IP6 A;  2ALB A;  2PPT A;  1HD2 A;  4KB3 A;  3H4K A;  2B6M A;  1K3O A;  1UA5 A;  4K9Z A;  3OR5 A;  2FA8 A;  3FK8 A;  4NHZ A;  1Z7R A;  3EMX A;  1O8W A;  1GUL A;  1E2Y A;  3A2X A;  2VO4 A;  1U87 A;  5A4V A;  4KCA A;  1A2J A;  1S3C A;  4OO5 A;  1XWB A;  2IIY A;  2P31 A;  1MDJ A;  4WEY A;  3U5R E;  3EYT A;  1V58 A;  2HE3 A;  2PWJ A;  5CNW A;  1YKA A;  2L5L A;  3IAS 2;  1PX7 A;  1NW2 A;  2LV3 A;  1Z5Y E;  1A2M A;  3J7Y b;  2FWE A;  3CBU A;  3LGC A;  3FY7 A;  4KAE A;  3KZQ A;  19GS A;  4TXO B;  1PQN A;  5DDL A;  5ECS A;  4YAP A;  2IPA A;  3EWL A;  1U6T A;  1O6J A;  2HFD A;  3IC4 A;  4I97 A;  1GTB A;  3HCZ A;  2B5Y A;  4CHS A;  2WRT A;  3TB2 A;  1T00 A;  1UN2 A;  4I5Q A;  3VLN A;  2C3N A;  3HHV A;  4XS1 A;  5B8A A;  1XWC A;  3LQ7 A;  2O85 A;  2RII A;  5ECO B;  2IFQ A;  1ERW A;  1GH2 A;  4JU5 A;  4ZB6 A;  3KD0 A;  3GST A;  2REM A;  3VWV A;  3TJG A;  2DC5 A;  6GSW A;  4EF0 A;  1GTI A;  1EV9 A;  2HT9 A;  20GS A;  1J08 A;  2H1A A;  1TI1 A;  1SK0 A;  4RQR A;  2F3M A;  3HXS A;  5DJM A;  16GS A;  2IMI A;  5D9W A;  1ZGN A;  1XIY A;  4KGI A;  1V9W A;  3GKK A;  5J3R A;  4OFN A;  2E0Q A;  3H8Q A;  1XW6 A;  2VCX A;  2XBQ A;  3KP9 A;  4ZIL A;  2KP2 A;  1V57 A;  5J9C A;  3W8J A;  1ZCP A;  2PVQ A;  4V1A g;  3ZIJ A;  1FB0 A;  1ERV A;  1NM3 A;  4MDC A;  3UIW A;  1X9W B;  1XZO A;  1AUC A;  3D4M A;  2R5G A;  2AAW A;  4EKZ A;  4KA0 A;  3VUR A;  1Z3E A;  4K0N A;  1QUW A;  5ELG A;  2VD1 A;  4Q5Q A;  4ML6 A;  4BPY A;  3H79 A;  4MP4 A;  5GSS A;  4MZB A;  2GZZ A;  3P7X A;  1Z7P A;  4JBB A;  2VL3 A;  3QFB C;  2H0I A;  3HZ8 A;  3GL5 A;  3CMI A;  1DUG A;  1YZX A;  4AGS A;  2B1K A;  4ILF A;  2IN3 A;  3KM6 A;  6GST A;  3KJY A;  4XHM A;  3ZYW A;  1PA3 A;  5KN1 A;  4N10 A;  4N30 A;  4PQ1 A;  2CQ9 A;  1N2A A;  3KTB A;  3N9J A;  3WT2 A;  5JWR B;  5G2Z A;  3IK9 A;  2C80 A;  2IWT A;  3F0I A;  4GST A;  2XC2 A;  1YF1 A;  3F63 A;  4NV2 A;  3L9U A;  5IIZ A;  2V32 A;  3TKR A;  2WDU A;  1TRS A;  5GAP D;  5DVB A;  4KSO A;  1MTC A;  1Z6N A;  1K0O A;  4TXV A;  2FWF A;  4WBR D;  4K1F A;  4MZC A;  4EDZ A;  4L5L A;  2NBS A;  2CAQ A;  1VF4 A;  3ZVJ D;  1J0F A;  1HNA A;  1SYX A;  4Q5F A;  1VF3 A;  2RM5 A;  4WKW A;  2BTO T;  4YQU A;  1F37 A;  3ZIT A;  3O76 A;  5F05 A;  2H6X A;  2YP6 A;  4GXZ A;  1LBK A;  4AF2 A;  1M9B A;  3F4S A;  3FZ9 A;  2NVL A;  2GDR A;  2P5R A;  1G7E A;  2WZ9 A;  3UAR A;  2H6Z A;  3L9S A;  2MZC A;  4O32 A;  1IYI A;  1I9D A;  2B5X A;  2GVP A;  4K0G A;  2E2M A;  2GZY A;  3GV1 A;  1XBS A;  3TCO A;  3M8N A;  2OA7 A;  2HLS A;  1RW1 A;  5CYY A;  4DEJ A;  4X1U A;  1R4W A;  4E8E A;  1PX6 A;  2CX4 A;  4OFT A;  3CXG A;  2XPE A;  3HVV A;  1VRS D;  2LRT A;  2DIZ A;  3ZIV A;  2I1U A;  1URM A;  4EL1 A;  1ILO A;  2H71 A;  3TJF A;  4HOJ A;  4GSS A;  2DML A;  4MF6 A;  2LUS A;  1K3Y A;  3DKS A;  4L0W A;  2ES7 A;  3A5W A;  1ZOF A;  4IJ3 A;  3F8U A;  1OC9 B;  3CTF A;  2VL9 A;  1XOA A;  4N0Z A;  3KCM A;  1G0T A;  2C0D A;  5IMV A;  2M80 A;  1PKW A;  2EC4 A;  1GLP A;  3IV4 A;  2FNO A;  2C8U A;  4YQM A;  5AIX A;  3ZRD A;  4IP1 A;  1AW9 A;  3V1W A;  2CV4 A;  3GNJ A;  1X0R A;  2CX3 A;  2LST A;  4G10 A;  1F3A A;  4JR6 A;  2XBI A;  1TU8 A;  5CP1 A;  5DAL B;  6GSU A;  1YEX A;  1JHB A;  2H1B A;  5F8B A;  2LEG A;  4XIH A;  3LEF A;  2MMN A;  5IMF A;  4GF0 A;  3HY2 A;  1X9M B;  1XCC A;  2B1L A;  3FKF A;  1FB6 A;  5CO3 A;  2RUF A;  1EP7 A;  5DQY A;  3KIJ A;  5C00 A;  4IBP A;  5KN0 A;  3IA1 A;  5IM9 A;  1PL1 A;  5KN2 A;  2NPB A;  2YZH A;  1M0U A;  1Z9H A;  1X9S B;  3LYK A;  1W4V A;  3ZML A;  2OBI A;  5CRD A;  5G31 A;  1OC8 A;  4V2L A;  5ECL B;  3NZN A;  5FHI A;  3E3E A;  2AB6 A;  1ZMA A;  2R3X A;  3C7M A;  3D5J A;  1PGT A;  3TRQ A;  3GX8 A;  3MDK A;  3IPZ A;  2C3Q A;  4Z7X A;  2X64 A;  4PQI A;  2GQM A;  3FZ5 A;  2B3S A;  4IVF A;  5D9T A;  1GUM A;  1V2A A;  4I8B A;  3J7Y k;  1EEJ A;  2K9F A;  3KXO A;  2CZ2 A;  1R26 A;  2H6Y A;  1OE7 A;  1QQ2 A;  2VD0 A;  1SKS B;  2R37 A;  4HDE A;  5C04 A;  4AJ7 A;  2C0G A;  5J41 A;  3ME8 A;  5J5N A;  4KE3 A;  2E7P A;  4MAB A;  4LMV A;  2JU5 A;  2HI7 A;  5JWO B;  1OKD A;  1SU9 A;  5AN1 A;  4FO5 A;  1KEB A;  4IGJ A;  1TJD A;  5ID2 A;  4IQ1 A;  2MBS A;  1BED A;  4I2T A;  1YF0 A;  2FHE A;  2H75 A;  3HJP A;  4TW5 A;  3RHB A;  2I9H A;  2FD3 A;  1EOG A;  3VWU A;  2L57 A;  1W89 A;  4HU7 A;  1MDK A;  2H66 A;  3TKQ A;  4G2E A;  1A23 A;  1M2A A;  2O87 A;  2OE0 A;  3CSJ A;  3QAW A;  3APO A;  4LL4 B;  2P0G A;  2H72 A;  4TR1 A;  4ACS A;  1EP8 A;  1TRU A;  3P90 A;  1M99 A;  1HNB A;  1WP0 A;  3VK9 A;  2HNL A;  1MD3 A;  17GS A;  4FH8 A;  4MPF A;  3F3R A;  4NXI A;  3ZFB A;  3I9V 2;  1H4O A;  4GWR A;  4RQX A;  3GIX A;  1K0M A;  3HJO A;  3DYR A;  3DVW A;  2YWI A;  1TRW A;  2HYX A;  4GQF A;  4KSM A;  2I4A A;  2GT6 A;  1ZL9 A;  2IL3 A;  2JSZ A;  3KGK A;  2A2R A;  2V1M A;  4ZL8 A;  2H0H A;  4PUA A;  1GSQ A;  2YWM A;  4BA7 A;  2B5E A;  22GS A;  2C1Y A;  4HJM A;  4KND A;  3WGX A;  1HQO A;  1G7O A;  2C4J A;  1JZD A;  5F0G A;  2EIQ A;  3GMF A;  4MF5 A;  3UJ1 A;  2FUG 2;  3ED3 A;  3DML A;  4TRX A;  4FYB A;  3RHC A;  5ABR A;  2VOC A;  2LTK A;  3CRT A;  3IRA A;  1TP9 A;  4KDU A;  3DGQ A;  3I69 A;  1LU4 A;  3PR8 A;  1HYU A;  2R4V A;  4EDY A;  2OE1 A;  3LFL A;  3P8W A;  3LWA A;  3G7Y A;  2N5A A;  3NIV A;  2AV4 A;  5H5Q A;  3RPN A;  4GCI A;  3SWL A;  4OFM A;  3G7J A;  3EU4 A;  5H5R A;  4F0C A;  5J9B A;  4J2F A;  3KMN A;  4MF7 A;  2HRF A;  1OYJ A;  2JZT A;  4PNG A;  4EUY A;  2PVO C;  1JLV A;  2IFQ B;  4TR0 A;  2H73 A;  1B9X C;  3LXZ A;  4K6X A;  4IEL A;  3DXB A;  3LSZ A;  2R2J A;  2GQL A;  2AUV A;  1I5G A;  4F03 A;  2FY6 A;  2TRC P;  3RBT A;  5ECI B;  2WJU A;  3L78 A;  4BWS A;  1XW9 A;  1IYH A;  5LD0 A;  3GTU A;  3TOT A;  1T4Z A;  1USB A;  3GTU B;  3IK7 A;  4PX1 A;  3EMP A;  5EPF A;  1O8X A;  2B7K A;  4WBJ A;  3PH9 A;  1GTU A;  1KNG A;  3D4T A;  4PNF A;  3D22 A;  3GH6 A;  4XS4 A;  1GSF A;  4MA9 A;  1TXX A;  1U3I A;  1NSW A;  3BOA A;  3W8S A;  5DAK A;  2YZU A;  1DSB A;  3QDN A;  4WF5 A;  4MCU A;  4QL7 A;  4OMV A;  2QC7 A;  5JWQ B;  2L4C A;  2FA4 A;  4L8E A;  1TK5 B;  1K0N A;  4XS6 A;  1BYE A;  2QKE A;  3CSH A;  4DSS A;  2JSY A;  2HZE A;  3ERF A;  2HZE B;  3BCK A;  2L4Q A;  3DRN A;  1DE1 A;  13GS A;  4XCS A;  4TVE A;  1NHO A;  5FT3 A;  1XXU A;  2JZS A;  5D9V A;  4GTU A;  4F2I A;  1TK8 B;  3TJB A;  4V2N A;  3FHK A;  2LNS A;  4L5O A;  4Q5N A;  4TOP A;  1WWJ A;  1SD8 A;  1VF1 A;  2J9H A;  4CDO A;  1SL1 B;  1FVK A;  1FOV A;  4QL9 A;  4KDX A;  3ME7 A;  3D0Z A;  3WD6 A;  2H30 A;  3C1S A;  3EU3 A;  1BJX A;  2H0G A;  2K8V A;  1GSS A;  2ON5 A;  2DJJ A;  2MMA A;  2XHF A;  4Q5R A;  2LJK A;  2O89 A;  2K18 A;  5DQS A;  2OJL A;  2BMX A;  3DEX A;  4NV5 A;  1XWA A;  1YQ1 A;  2YAN A;  4IS0 A;  4O92 A;  5GST A;  5LCZ A;  4HEA 2;  1RQM A;  5IOW A;  2H1D A;  2CVD A;  2DJ3 A;  1XFL A;  3APS A;  3H93 A;  1TU7 A;  4DVC A;  5ELA A;  5HFI A;  2CAI A;  2I3Y A;  1AAZ A;  5D73 A;  4MJC A;  4HQZ A;  3IXR A;  4ZIJ A;  1Z6M A;  3IE3 A;  1KBN A;  5COH A;  1GSY A;  1OKT A;  2H70 A;  2PU9 C;  1SYR A;  2GZP A;  3TRX A;  2V6K A;  4TN8 A;  3EC3 A;  2RUE A;  2WS2 A;  3QAG A;  4D73 A;  4DSR A;  2MMO A;  4OCE A;  5EY6 A;  1PMT A;  3M0F A;  5A4W A;  18GS A;  4IHU A;  4HU9 A;  1RK4 A;  3W6G A;  4PXO A;  10GS A;  3LYP A;  1BG5 A;  2VLU A;  2VIM A;  3QR6 A;  3VFI A;  3L9V A;  5IO2 A;  3E9J B;  5DCH A;  1B8X A;  2QGV A;  3M9K A;  3TKS C;  1PSQ A;  1GRX A;  3UOM A;  3MAK A;  4MJE A;  4EVM A;  1A8Y A;  4HZ4 A;  1YJ6 A;  4POK A;  2C0F A;  2YOI A;  1S3D A;  5HR1 A;  1TI3 A;  1TRV A;  5G1L A;  4NPB A;  1SL2 B;  4KCE A;  2VM2 A;  5IOX A;  3UBK A;  5IMZ A;  2VL2 C;  2EIR A;  3GL3 A;  3ISO A;  1YDK A;  1GTA A;  1QGV A;  2VM1 A;  3FR3 A;  3UMA A;  3JCM L;  3ERW A;  2YWO A;  1OVN A;  1GSE A;  2I81 A;  4YH2 A;  3GUR A;  1SK2 A;  4GRF A;  5E59 A;  2YN1 A;  4TKY A;  5JCU A;  3ZMK A;  1QFN A;  1M7T A;  4XRA A;  3C8E A;  1WPI A;  3TKP A;  1V98 A;  2E2G A;  3HZ4 A;  1ZYQ B;  3P2A A;  1QXH A;  2FGX A;  1SKR B;  3GUS A;  2ZCT A;  2WUL A;  3TJK A;  4IQA A;  3DVX A;  3TKS A;  5KEJ A;  1DE2 A;  2C3T A;  4AJ8 A;  5LNK e;  4XTS A;  2EIO A;  3C1R A;  4FYU A;  5ECP B;  1Q4J A;  3HVX A;  1T7P B;  1BX9 A; 
#chains in the Genus database with same CATH topology
 4ECI A;  1WJK A;  4LMW A;  4K5S A;  4FYC A;  2KOK A;  3LXT A;  3WGE A;  3O3T A;  2MBT A;  1E6B A;  2FWH A;  2VCV A;  1A0R P;  4J57 E;  2WCI A;  1MDI A;  3BD2 A;  1GUK A;  1T1V A;  5CRW A;  3BBY A;  1EGR A;  2VL2 A;  1F3B A;  1Q98 A;  4ZB9 A;  2DMM A;  3FR9 A;  3GN3 A;  2WFC A;  9GSS A;  2V41 A;  5J4U A;  1VGL A;  2PUK C;  1GNW A;  3EVI A;  1R5A A;  2YNX A;  4MZW A;  4PUF C;  2DLX A;  2H19 A;  4OO4 A;  1M2B A;  2DSA A;  2O8V B;  3F3Q A;  2CT6 A;  3VPT A;  2A4H A;  1G6Y A;  2F8A A;  2C0E A;  1ZYE A;  2M72 A;  2D2Z A;  3FZA A;  1M2D A;  2GSS A;  3UEM A;  4RUV A;  2LRN A;  1XOB A;  4ISD A;  2QSI A;  1TKD B;  4I2U A;  2A2S A;  6GSS A;  1ERU A;  1ACV A;  1UC7 A;  2H1G A;  5IMD A;  4ZL9 A;  1XVQ A;  2H74 A;  5ID2 B;  2YCD A;  2FWG A;  2H8L A;  3QPM A;  4ML1 A;  4GQC A;  4P3Y B;  1HNC A;  4X4J A;  3EE2 A;  4JE1 A;  4KUN A;  5ECR B;  3MNG A;  1OE8 A;  5EL8 A;  4HI7 A;  4F82 A;  1CQH A;  1T3B A;  3VWX A;  4EIP A;  5IPH A;  3A2W A;  2TRX A;  3I6A A;  5E4W A;  5B7C A;  3US3 A;  5CAX A;  1QMV A;  5IO0 A;  4JZQ A;  1PKZ A;  2LJA A;  2HSH A;  5EVO A;  4TR1 B;  5IMA A;  2YJ7 A;  5F06 A;  12GS A;  1N8J A;  2GTU A;  6GSV A;  2G0F A;  4L0U A;  5D8I A;  5G5F A;  1AQV A;  2AYT A;  3A5I A;  3HA9 A;  3UBL A;  1O73 A;  4XRD A;  2FLS A;  1FVJ A;  3HYP A;  3AY8 A;  2IMF A;  2GT5 A;  1GUH A;  2L59 A;  1SL0 B;  4OD7 A;  1XG8 A;  4F0B A;  2XPD A;  2KUC A;  3TGZ A;  3MWH A;  1Y6E A;  3HDC A;  3LOR A;  4BVY A;  2G2Q A;  1X5C A;  1U88 A;  4BVY B;  3UAP A;  4LLR A;  2YV7 A;  1B9Y C;  1M9A A;  1A0F A;  2OBK A;  1KTE A;  2X8G A;  2H01 A;  5D96 A;  2L6D A;  4KX4 A;  3O6T A;  3N5O A;  4HQS A;  5D93 A;  4HZ2 A;  1X5E A;  4MLY A;  3E0U A;  1X5D A;  3R3E A;  4MK3 A;  2RM6 A;  4ECJ A;  2L5O A;  3TUE A;  2DKH A;  3M1G A;  1K0D A;  3PGT A;  3F6D A;  2NDO A;  1JZR A;  2JZR A;  1EWX A;  4PUR A;  5DCG A;  1MD4 A;  2GQK A;  1SJI A;  1ML6 A;  2MMZ A;  4IKH A;  4GLT A;  5ECN B;  4GSN A;  4TXO A;  4YQV A;  3GX0 A;  5HR3 A;  3F9U A;  1K0A A;  1A24 A;  1QK8 A;  2OAD A;  3KEB A;  1GSD A;  4V2M A;  3RAZ A;  4ID0 A;  2IME A;  2N5B A;  3BCI A;  3QOU A;  1AQW A;  5HQP A;  5CRG A;  4DSQ A;  4OCF A;  3H1N A;  3WYW A;  3ZFL A;  1YEP A;  2JAD A;  3ZLP A;  1TOF A;  1A2L A;  3DIE A;  4K7N A;  5G5E A;  3HVS A;  5INY A;  3GYK A;  1S3A A;  6GSY A;  1SJZ A;  8GSS A;  1FOH A;  4ZBD A;  4O5R A;  3ERG A;  2KLX A;  6GSX A;  4XS4 B;  4Z2U A;  3ZL5 A;  2WB9 A;  1O85 A;  2RLI A;  5ECM B;  5IPG A;  2K6V A;  2DIY A;  5DAK B;  2N5F A;  3SBC A;  5ECK B;  2DBC A;  1EZK A;  3IBH A;  3GKM A;  4ZBB A;  4K8M A;  2LNT A;  3G7I A;  3R2Q A;  2IMK A;  3PIN A;  1H75 A;  1XWK A;  3K8N A;  3TRP A;  2A2P A;  1GNE A;  2DJ2 A;  2A4V A;  1PD2 1;  4AJ6 A;  1XPV A;  5ECH B;  5B6N A;  4ZB8 A;  4F9Z A;  1WRY A;  2YWN A;  3F4R A;  4DSS B;  1T8E B;  5B8B A;  3VI5 A;  2Z9S A;  5AGY A;  3GSS A;  2PBJ A;  4ULX A;  3KTL A;  3GA4 A;  2TIR A;  1AQX A;  4ECC A;  1PL2 A;  1FG4 A;  2DJ0 A;  3QAV A;  5F07 A;  2VCW A;  3ZVJ A;  2IMD A;  1ERT A;  5G1K A;  1AC1 A;  3F6F A;  1K0B A;  4IN0 A;  3F4T A;  4LA1 A;  2ON7 A;  1BAY A;  3L4N A;  2KP1 A;  2LJR A;  4K2D A;  1FW1 A;  1SK1 A;  2DJ1 A;  2AHE A;  2IJY A;  14GS A;  2YV9 A;  1TW9 A;  2YPM A;  3GKX A;  4POB A;  1T4Y A;  1B4Q A;  2ZUP A;  1JZW A;  4BL7 A;  1XW5 A;  3G9B A;  4BL7 B;  5AIV A;  1F2E A;  1FO5 A;  3IHQ A;  1XWG A;  1GL8 A;  4E8H A;  2R6K A;  4RI7 A;  3HD5 A;  4MPG A;  3LJR A;  4G19 A;  4CW9 A;  4WET A;  5DJL A;  3A3T A;  3S9F A;  4KDY A;  4BVX A;  3LG6 A;  1SD9 A;  4QQ7 A;  3BJ5 A;  4WF4 A;  4X43 A;  4ZL7 A;  3FW2 A;  3TKS E;  5D9X A;  2LS5 A;  3UVT A;  2CVK A;  4H86 A;  3WGD A;  1SJ6 A;  3RDW A;  3C73 A;  7GSS A;  3FR6 A;  4IJI A;  2L6C A;  4OWY A;  2GSQ A;  4N11 A;  2HRN A;  4POM A;  4HUA A;  3RPP A;  1ABA A;  2X8H A;  3DD3 A;  1Y25 A;  1C72 A;  2PMT A;  4D73 B;  2CA8 A;  3QD9 A;  4N0V A;  4HJ2 A;  3QMX A;  3KP8 A;  4ECB A;  1EV4 A;  1THX A;  5HR2 A;  5GZZ B;  4RI6 A;  3FYG A;  1EGO A;  1R7H A;  3M9J A;  4LL1 B;  5AIS A;  5A4U A;  3D21 A;  2JL4 A;  1JLW A;  3WT1 A;  3IC8 A;  1A8L A;  1TDI A;  1TK0 B;  2GGT A;  4O7H A;  1SKW B;  3C71 A;  2V6O A;  1BQ7 A;  5IQY A;  4NHW A;  4ZBA A;  2OKA A;  4G0I A;  5HFG A;  4PGT A;  3Q19 A;  3QFA C;  3EIN A;  1WMJ A;  3GH9 A;  2MYG A;  2JAC A;  1CQG A;  5H5S A;  5CRE A;  4BWQ A;  1WIK A;  3Q18 A;  4MJA A;  2ZNM A;  2LQO A;  2VLT A;  1PN9 A;  5CRH A;  2HSY A;  3M3M A;  3Q74 A;  2GS3 A;  3TDG A;  3Q6O A;  2HRA A;  3GKN A;  1FAA A;  4K5R A;  5B6M A;  1OC9 A;  4NAX A;  1VF2 A;  2V2G A;  1NHY A;  3MYD A;  3IAM 2;  1JFU A;  2H76 A;  2O7K A;  2LKU A;  1ZZY A;  3UVH A;  2PN8 A;  3NOF A;  1ON4 A;  1ST9 A;  1OC3 A;  5DBQ A;  1UVZ A;  1XVW A;  4HSC X;  5BMU A;  2PER A;  4I6X A;  4POL A;  5A5K A;  3KH9 A;  4IW9 A;  3VPQ A;  4X0X A;  5GAN D;  2VAF A;  1PFO A;  1AIU A;  1B48 A;  2VUP A;  3EUR A;  4KW6 A;  4TR4 A;  5KN3 A;  1S3R A;  4WR5 A;  5DAL A;  1EOH A;  4EE0 A;  1GP1 A;  1WOU A;  5HFK A;  2KHP A;  2VLV A;  4PQH A;  3D6I A;  3I43 A;  1R5P A;  4O5Q A;  4CY8 A;  2HSM A;  4V1A p;  2DJK A;  2VCZ A;  4ZXG A;  3KMO A;  3IOS A;  2PGT A;  5BRT A;  2HXK A;  3FZ4 A;  1WE0 A;  4WR4 A;  4TR3 A;  4JRR A;  5ECQ B;  4WXT A;  11GS A;  3IR4 A;  2GLR A;  3GRX A;  4EIQ A;  3QCP A;  2R0C A;  2F8F A;  1K3L A;  5G30 A;  3IDV A;  1GWC A;  1YKC A;  4MJB A;  2B7J A;  2VCQ A;  2FCH A;  4K7I A;  2NTO A;  3KH7 A;  3GHA A;  1GSU A;  3TOU A;  3ZRE A;  3DWV A;  3L0H A;  2P5Q A;  5ENU A;  3VWW A;  1MEK A;  2AJQ B;  4G9H A;  2J23 A;  1PN0 A;  2OAC A;  3MSZ A;  5IMC A;  4J56 E;  4MH2 A;  5JCW A;  2R0G A;  4FIW A;  2F9S A;  3CRU A;  1V40 A;  2CVB A;  1AXD A;  5HR0 A;  2HZF A;  3ZZX A;  2OE3 A;  1YY7 A;  4EC0 A;  5KOX A;  4KH7 A;  4EXJ A;  3APQ A;  2LRC A;  2F51 A;  2WGR A;  3VI7 A;  3HJM A;  3HKR A;  3FEU A;  4MMM A;  4EO3 A;  2M46 A;  1O81 A;  3CSI A;  1K0C A;  1B4P A;  2BJX A;  3CYN A;  2GSR A;  1SEN A;  2X8C A;  4YAV A;  4K7O A;  1LJR A;  1JZO A;  1OAZ A;  3GFK A;  1G6W A;  1GLQ A;  5FWG A;  3TJJ A;  3CTG A;  5L71 A;  4MH3 A;  3UL3 A;  1THO A;  2YJH A;  1F9M A;  1F6M C;  2LQQ A;  2VCT A;  1M3I A;  2K8S A;  1U3A A;  3A2V A;  1TTZ A;  1FHE A;  1EEM A;  1PRX A;  1J9B A;  4NWY A;  2CZ3 A;  1DBY A;  5JCG A;  3FRC A;  2X99 A;  2QA2 A;  1O7U A;  3ZTL A;  4JR4 A;  4JED A;  3U6V A;  4NMU A;  2GST A;  4HS1 A;  4IP6 A;  2ALB A;  2PPT A;  1HD2 A;  4KB3 A;  3H4K A;  2B6M A;  1K3O A;  1UA5 A;  4K9Z A;  3OR5 A;  2FA8 A;  3FK8 A;  4NHZ A;  1Z7R A;  3EMX A;  1O8W A;  1GUL A;  1E2Y A;  3A2X A;  2VO4 A;  1U87 A;  5A4V A;  4KCA A;  1A2J A;  1S3C A;  4OO5 A;  4Z2R A;  1XWB A;  2IIY A;  2P31 A;  1MDJ A;  4WEY A;  3U5R E;  3EYT A;  1V58 A;  2HE3 A;  2PWJ A;  5CNW A;  1YKA A;  2L5L A;  3IAS 2;  1PX7 A;  1NW2 A;  2LV3 A;  1Z5Y E;  1A2M A;  3J7Y b;  2FWE A;  3CBU A;  3LGC A;  3FY7 A;  4KAE A;  3KZQ A;  19GS A;  4TXO B;  1PQN A;  5DDL A;  5ECS A;  4YAP A;  2IPA A;  3EWL A;  1U6T A;  1O6J A;  2HFD A;  3IC4 A;  4I97 A;  1GTB A;  3HCZ A;  2B5Y A;  3HVN A;  4CHS A;  2WRT A;  3TB2 A;  1T00 A;  1UN2 A;  4I5Q A;  3VLN A;  2C3N A;  3HHV A;  4XS1 A;  5B8A A;  1XWC A;  3LQ7 A;  2O85 A;  2RII A;  5ECO B;  2IFQ A;  1ERW A;  1GH2 A;  4JU5 A;  4ZB6 A;  3KD0 A;  3GST A;  2REM A;  3VWV A;  3TJG A;  2DC5 A;  6GSW A;  4EF0 A;  3CQF A;  1GTI A;  1EV9 A;  2HT9 A;  20GS A;  1J08 A;  2H1A A;  1TI1 A;  1SK0 A;  4RQR A;  2F3M A;  3HXS A;  5DJM A;  16GS A;  2IMI A;  5D9W A;  1ZGN A;  1XIY A;  4KGI A;  1V9W A;  3GKK A;  5J3R A;  4OFN A;  2E0Q A;  3H8Q A;  1XW6 A;  2VCX A;  2XBQ A;  3KP9 A;  4ZIL A;  2KP2 A;  1V57 A;  5J9C A;  3W8J A;  1ZCP A;  2PVQ A;  4V1A g;  3ZIJ A;  1FB0 A;  1ERV A;  1NM3 A;  4MDC A;  3UIW A;  1X9W B;  3MIX A;  1XZO A;  1AUC A;  3D4M A;  1ZYN A;  2R5G A;  2AAW A;  4EKZ A;  4KA0 A;  3VUR A;  1Z3E A;  4K0N A;  4O5U A;  1QUW A;  5ELG A;  2VD1 A;  4Q5Q A;  4ML6 A;  4BPY A;  3H79 A;  4MP4 A;  5GSS A;  4MZB A;  2GZZ A;  3P7X A;  1Z7P A;  4JBB A;  2VL3 A;  3QFB C;  2H0I A;  3HZ8 A;  3GL5 A;  3CMI A;  1DUG A;  1YZX A;  4AGS A;  2B1K A;  4ILF A;  2IN3 A;  3KM6 A;  6GST A;  3KJY A;  4XHM A;  3ZYW A;  1PA3 A;  5KN1 A;  4N10 A;  4N30 A;  4PQ1 A;  2CQ9 A;  1N2A A;  3KTB A;  3N9J A;  3WT2 A;  5JWR B;  2X49 A;  5G2Z A;  3IK9 A;  2C80 A;  2IWT A;  3F0I A;  4GST A;  2XC2 A;  1YF1 A;  3F63 A;  4NV2 A;  3L9U A;  5IIZ A;  2V32 A;  3TKR A;  2WDU A;  1TRS A;  5GAP D;  5DVB A;  4BVX B;  4KSO A;  1MTC A;  1Z6N A;  1K0O A;  4TXV A;  2FWF A;  4WBR D;  5KOW A;  4K1F A;  4MZC A;  4EDZ A;  4L5L A;  2NBS A;  2CAQ A;  1VF4 A;  3ZVJ D;  1J0F A;  1HNA A;  1SYX A;  4Q5F A;  1VF3 A;  2RM5 A;  4A5P A;  4WKW A;  2BTO T;  3LW9 A;  4YQU A;  1F37 A;  3ZIT A;  3O76 A;  5F05 A;  2H6X A;  2YP6 A;  4GXZ A;  1LBK A;  4AF2 A;  1M9B A;  3F4S A;  3FZ9 A;  2NVL A;  2GDR A;  2P5R A;  1G7E A;  2WZ9 A;  3UAR A;  2H6Z A;  3L9S A;  2DKI A;  2MZC A;  4O32 A;  1IYI A;  4KF9 A;  1I9D A;  2B5X A;  2GVP A;  3EPT A;  4K0G A;  2E2M A;  2GZY A;  3GV1 A;  1XBS A;  3TCO A;  3M8N A;  2OA7 A;  2HLS A;  1RW1 A;  5CYY A;  4DEJ A;  4X1U A;  1R4W A;  4E8E A;  1PX6 A;  2CX4 A;  4OFT A;  3CXG A;  2XPE A;  3HVV A;  1VRS D;  2LRT A;  2DIZ A;  3ZIV A;  2I1U A;  1URM A;  4EL1 A;  1ILO A;  2H71 A;  3TJF A;  4HOJ A;  4GSS A;  2DML A;  4MF6 A;  2LUS A;  1K3Y A;  3DKS A;  4L0W A;  2ES7 A;  3A5W A;  1ZOF A;  4IJ3 A;  3F8U A;  1OC9 B;  3CTF A;  2VL9 A;  4MNN A;  1XOA A;  4N0Z A;  3KCM A;  1G0T A;  2C0D A;  5IMV A;  2M80 A;  1PKW A;  2EC4 A;  1GLP A;  3IV4 A;  2FNO A;  2C8U A;  4YQM A;  5AIX A;  3ZRD A;  4IP1 A;  1AW9 A;  3V1W A;  2CV4 A;  3GNJ A;  2HRK A;  1X0R A;  2CX3 A;  2LST A;  4G10 A;  1F3A A;  4JR6 A;  2XBI A;  1TU8 A;  5CP1 A;  5DAL B;  6GSU A;  1YEX A;  1JHB A;  2H1B A;  5F8B A;  2LEG A;  4XIH A;  3LEF A;  2MMN A;  5IMF A;  4GF0 A;  3HY2 A;  1X9M B;  1XCC A;  2B1L A;  3FKF A;  1FB6 A;  4ICY A;  5CO3 A;  2RUF A;  1EP7 A;  5DQY A;  3KIJ A;  4PTS A;  5C00 A;  4IBP A;  5KN0 A;  3IA1 A;  5IM9 A;  1PL1 A;  3FMW A;  5KN2 A;  2NPB A;  2YZH A;  1M0U A;  1Z9H A;  1X9S B;  3LYK A;  1W4V A;  3ZML A;  2OBI A;  5CRD A;  5G31 A;  1OC8 A;  4V2L A;  5ECL B;  3NZN A;  5FHI A;  3E3E A;  2AB6 A;  1ZMA A;  2R3X A;  3C7M A;  3D5J A;  1PGT A;  3TRQ A;  3GX8 A;  3MDK A;  3IPZ A;  2C3Q A;  4Z7X A;  2X64 A;  4PQI A;  2GQM A;  3FZ5 A;  2B3S A;  4IVF A;  5D9T A;  1GUM A;  1V2A A;  4I8B A;  3J7Y k;  1EEJ A;  2K9F A;  3KXO A;  2CZ2 A;  1R26 A;  2H6Y A;  1OE7 A;  1QQ2 A;  2VD0 A;  1SKS B;  2R37 A;  4HDE A;  5C04 A;  4AJ7 A;  2C0G A;  5J41 A;  3ME8 A;  5J5N A;  4KE3 A;  2E7P A;  3IHG A;  4MAB A;  4LMV A;  2JU5 A;  2HI7 A;  5JWO B;  4CY6 A;  1OKD A;  1SU9 A;  5AN1 A;  2X4A A;  4FO5 A;  1KEB A;  4IGJ A;  1TJD A;  5ID2 A;  4IQ1 A;  2MBS A;  1BED A;  4I2T A;  1YF0 A;  2FHE A;  2H75 A;  3HJP A;  4TW5 A;  3RHB A;  2I9H A;  2FD3 A;  1EOG A;  3VWU A;  2L57 A;  1W89 A;  4HU7 A;  1MDK A;  2H66 A;  4USS A;  4G2E A;  3TKQ A;  1A23 A;  1M2A A;  2O87 A;  2OE0 A;  3CSJ A;  2QA1 A;  3QAW A;  3APO A;  4LL4 B;  2P0G A;  2H72 A;  4TR1 A;  4ACS A;  1EP8 A;  1TRU A;  3P90 A;  1M99 A;  1HNB A;  1WP0 A;  3VK9 A;  2HNL A;  1MD3 A;  17GS A;  4FH8 A;  4MPF A;  3F3R A;  4NXI A;  3ZFB A;  3I9V 2;  1H4O A;  4GWR A;  4RQX A;  3GIX A;  1K0M A;  3HJO A;  3DYR A;  3DVW A;  2YWI A;  1TRW A;  2HYX A;  4GQF A;  4KSM A;  2I4A A;  2GT6 A;  1ZL9 A;  2IL3 A;  4YKG A;  2JSZ A;  3KGK A;  4G0L A;  2A2R A;  2V1M A;  4ZL8 A;  2H0H A;  4PUA A;  1GSQ A;  2YWM A;  4BA7 A;  2B5E A;  22GS A;  2C1Y A;  4HJM A;  4KND A;  3WGX A;  1HQO A;  1G7O A;  2C4J A;  1JZD A;  5F0G A;  2EIQ A;  3GMF A;  4MF5 A;  3UJ1 A;  2FUG 2;  3ED3 A;  3DML A;  4TRX A;  4FYB A;  3RHC A;  5ABR A;  2VOC A;  2LTK A;  3CRT A;  3IRA A;  1TP9 A;  4KDU A;  3DGQ A;  3I69 A;  1LU4 A;  3PR8 A;  1HYU A;  2R4V A;  4EDY A;  2OE1 A;  3LFL A;  3P8W A;  3LWA A;  3G7Y A;  2N5A A;  3NIV A;  2AV4 A;  4K2X A;  5H5Q A;  3RPN A;  4GCI A;  3SWL A;  4OFM A;  3G7J A;  3EU4 A;  5H5R A;  4F0C A;  5J9B A;  4J2F A;  3KMN A;  4MF7 A;  2HRF A;  1OYJ A;  2JZT A;  4PNG A;  4EUY A;  2PVO C;  1JLV A;  2IFQ B;  4TR0 A;  2H73 A;  1B9X C;  3LXZ A;  4K6X A;  4IEL A;  3DXB A;  3LSZ A;  2R2J A;  2GQL A;  2AUV A;  1I5G A;  4F03 A;  2FY6 A;  2TRC P;  3RBT A;  5ECI B;  2WJU A;  3L78 A;  4BWS A;  1XW9 A;  1IYH A;  5LD0 A;  3GTU A;  3TOT A;  1T4Z A;  1USB A;  3GTU B;  3IK7 A;  4PX1 A;  3EMP A;  5EPF A;  2UZ8 A;  1O8X A;  2B7K A;  4WBJ A;  3PH9 A;  1GTU A;  1KNG A;  3D4T A;  4PNF A;  3D22 A;  3GH6 A;  4XS4 A;  1GSF A;  4MA9 A;  1TXX A;  1U3I A;  1NSW A;  3BOA A;  3W8S A;  5DAK A;  2YZU A;  1DSB A;  3QDN A;  4WF5 A;  4MCU A;  4QL7 A;  4OMV A;  2QC7 A;  5JWQ B;  2L4C A;  2FA4 A;  4L8E A;  1TK5 B;  1K0N A;  4XS6 A;  1BYE A;  2QKE A;  3CSH A;  4DSS A;  2JSY A;  2HZE A;  3ERF A;  2HZE B;  3BCK A;  2L4Q A;  3DRN A;  1DE1 A;  13GS A;  4XCS A;  4TVE A;  1NHO A;  5FT3 A;  1XXU A;  2JZS A;  5D9V A;  4GTU A;  4F2I A;  1TK8 B;  3TJB A;  4V2N A;  3FHK A;  2LNS A;  4L5O A;  4Q5N A;  4TOP A;  1WWJ A;  1SD8 A;  1VF1 A;  2J9H A;  4BIK A;  4CDO A;  1SL1 B;  1FVK A;  1FOV A;  4QL9 A;  4Z2T A;  4KDX A;  3ME7 A;  3D0Z A;  3WD6 A;  2H30 A;  3C1S A;  3EU3 A;  1BJX A;  2H0G A;  2K8V A;  1GSS A;  2ON5 A;  2DJJ A;  2MMA A;  2XHF A;  4Q5R A;  2LJK A;  2O89 A;  2K18 A;  5DQS A;  2OJL A;  2BMX A;  3DEX A;  4NV5 A;  1XWA A;  1YQ1 A;  2YAN A;  4IS0 A;  4O92 A;  5GST A;  5LCZ A;  4HEA 2;  1RQM A;  5IOW A;  2H1D A;  2CVD A;  2DJ3 A;  1XFL A;  3APS A;  1ZYP A;  3H93 A;  1TU7 A;  4DVC A;  5ELA A;  5HFI A;  2CAI A;  2I3Y A;  1AAZ A;  5D73 A;  3PPU A;  4MJC A;  4HQZ A;  3IXR A;  4ZIJ A;  1Z6M A;  3IE3 A;  1KBN A;  5COH A;  1GSY A;  1OKT A;  2H70 A;  2PU9 C;  1SYR A;  2GZP A;  3TRX A;  2V6K A;  4TN8 A;  3EC3 A;  2RUE A;  2WS2 A;  3QAG A;  4D73 A;  4DSR A;  2MMO A;  4OCE A;  5EY6 A;  1PMT A;  3M0F A;  5A4W A;  18GS A;  4IHU A;  4HU9 A;  1RK4 A;  3W6G A;  4PXO A;  10GS A;  3LYP A;  1BG5 A;  2VLU A;  2VIM A;  3QR6 A;  3VFI A;  4YKF A;  3L9V A;  5IO2 A;  3E9J B;  5DCH A;  1B8X A;  2QGV A;  3M9K A;  3TKS C;  1PSQ A;  1GRX A;  3UOM A;  3MAK A;  4MJE A;  4EVM A;  1A8Y A;  4HZ4 A;  1YJ6 A;  4POK A;  2C0F A;  2YOI A;  1S3D A;  5HR1 A;  1TI3 A;  1TRV A;  5G1L A;  4NPB A;  1SL2 B;  4KCE A;  2VM2 A;  5IOX A;  3UBK A;  5IMZ A;  2VL2 C;  2EIR A;  3GL3 A;  3ISO A;  1GTA A;  1YDK A;  1QGV A;  2VM1 A;  3FR3 A;  3UMA A;  3JCM L;  3ERW A;  2YWO A;  1OVN A;  1GSE A;  2I81 A;  4YH2 A;  3GUR A;  1SK2 A;  4GRF A;  4FQU A;  5E59 A;  2YN1 A;  4TKY A;  1M3J A;  5JCU A;  3ZMK A;  2R0P A;  1QFN A;  1M7T A;  4XRA A;  3C8E A;  1WPI A;  3TKP A;  1V98 A;  2E2G A;  3HZ4 A;  4G0K A;  1ZYQ B;  3P2A A;  1QXH A;  2FGX A;  1SKR B;  3GUS A;  2ZCT A;  2WUL A;  3TJK A;  4IQA A;  3DVX A;  3TKS A;  5KEJ A;  1DE2 A;  2C3T A;  4AJ8 A;  5LNK e;  4XTS A;  2EIO A;  3C1R A;  4FYU A;  5ECP B;  1Q4J A;  3HVX A;  1T7P B;  1BX9 A; 
#chains in the Genus database with same CATH homology
 4ECI A;  1WJK A;  4LMW A;  4K5S A;  4FYC A;  2KOK A;  3LXT A;  3WGE A;  3O3T A;  2MBT A;  1E6B A;  2FWH A;  2VCV A;  1A0R P;  4J57 E;  2WCI A;  1MDI A;  3BD2 A;  1GUK A;  1T1V A;  5CRW A;  3BBY A;  1EGR A;  2VL2 A;  1F3B A;  1Q98 A;  4ZB9 A;  2DMM A;  3FR9 A;  3GN3 A;  2WFC A;  9GSS A;  2V41 A;  5J4U A;  1VGL A;  2PUK C;  1GNW A;  3EVI A;  1R5A A;  2YNX A;  4MZW A;  4PUF C;  2DLX A;  2H19 A;  4OO4 A;  1M2B A;  2DSA A;  2O8V B;  3F3Q A;  2CT6 A;  3VPT A;  2A4H A;  1G6Y A;  2F8A A;  2C0E A;  1ZYE A;  2M72 A;  2D2Z A;  3FZA A;  1M2D A;  2GSS A;  3UEM A;  4RUV A;  2LRN A;  1XOB A;  4ISD A;  2QSI A;  1TKD B;  4I2U A;  2A2S A;  6GSS A;  1ERU A;  1ACV A;  1UC7 A;  2H1G A;  5IMD A;  4ZL9 A;  1XVQ A;  2H74 A;  5ID2 B;  2YCD A;  2FWG A;  2H8L A;  3QPM A;  4ML1 A;  4GQC A;  4P3Y B;  1HNC A;  4X4J A;  3EE2 A;  4JE1 A;  4KUN A;  5ECR B;  3MNG A;  1OE8 A;  5EL8 A;  4HI7 A;  4F82 A;  1CQH A;  1T3B A;  3VWX A;  4EIP A;  5IPH A;  3A2W A;  2TRX A;  3I6A A;  5E4W A;  5B7C A;  3US3 A;  5CAX A;  1QMV A;  5IO0 A;  4JZQ A;  1PKZ A;  2LJA A;  2HSH A;  5EVO A;  4TR1 B;  5IMA A;  2YJ7 A;  5F06 A;  12GS A;  1N8J A;  2GTU A;  6GSV A;  2G0F A;  4L0U A;  5D8I A;  5G5F A;  1AQV A;  2AYT A;  3A5I A;  3HA9 A;  3UBL A;  1O73 A;  4XRD A;  2FLS A;  1FVJ A;  3HYP A;  3AY8 A;  2IMF A;  2GT5 A;  1GUH A;  2L59 A;  1SL0 B;  4OD7 A;  4F0B A;  2XPD A;  2KUC A;  3TGZ A;  3MWH A;  1Y6E A;  3HDC A;  3LOR A;  4BVY A;  2G2Q A;  1X5C A;  1U88 A;  4BVY B;  3UAP A;  4LLR A;  2YV7 A;  1B9Y C;  1M9A A;  1A0F A;  2OBK A;  1KTE A;  2X8G A;  2H01 A;  5D96 A;  2L6D A;  4KX4 A;  3O6T A;  3N5O A;  4HQS A;  5D93 A;  4HZ2 A;  1X5E A;  4MLY A;  3E0U A;  1X5D A;  3R3E A;  4MK3 A;  2RM6 A;  4ECJ A;  2L5O A;  3TUE A;  2DKH A;  3M1G A;  1K0D A;  3PGT A;  3F6D A;  2NDO A;  1JZR A;  2JZR A;  1EWX A;  4PUR A;  5DCG A;  1MD4 A;  2GQK A;  1SJI A;  1ML6 A;  2MMZ A;  4IKH A;  4GLT A;  5ECN B;  4GSN A;  4TXO A;  4YQV A;  3GX0 A;  5HR3 A;  3F9U A;  1K0A A;  1A24 A;  1QK8 A;  2OAD A;  3KEB A;  1GSD A;  4V2M A;  3RAZ A;  4ID0 A;  2IME A;  2N5B A;  3BCI A;  3QOU A;  1AQW A;  5HQP A;  5CRG A;  4DSQ A;  4OCF A;  3H1N A;  3WYW A;  3ZFL A;  1YEP A;  2JAD A;  3ZLP A;  1TOF A;  1A2L A;  3DIE A;  4K7N A;  5G5E A;  3HVS A;  5INY A;  3GYK A;  1S3A A;  6GSY A;  1SJZ A;  8GSS A;  1FOH A;  4ZBD A;  4O5R A;  3ERG A;  2KLX A;  6GSX A;  4XS4 B;  4Z2U A;  3ZL5 A;  2WB9 A;  1O85 A;  2RLI A;  5ECM B;  5IPG A;  2K6V A;  2DIY A;  5DAK B;  2N5F A;  3SBC A;  5ECK B;  2DBC A;  1EZK A;  3IBH A;  3GKM A;  4ZBB A;  4K8M A;  2LNT A;  3G7I A;  3R2Q A;  2IMK A;  3PIN A;  1H75 A;  1XWK A;  3K8N A;  3TRP A;  2A2P A;  1GNE A;  2DJ2 A;  2A4V A;  1PD2 1;  4AJ6 A;  1XPV A;  5ECH B;  5B6N A;  4ZB8 A;  4F9Z A;  1WRY A;  2YWN A;  3F4R A;  4DSS B;  1T8E B;  5B8B A;  3VI5 A;  2Z9S A;  5AGY A;  3GSS A;  2PBJ A;  4ULX A;  3KTL A;  3GA4 A;  2TIR A;  1AQX A;  4ECC A;  1PL2 A;  1FG4 A;  2DJ0 A;  3QAV A;  5F07 A;  2VCW A;  3ZVJ A;  2IMD A;  1ERT A;  5G1K A;  1AC1 A;  3F6F A;  1K0B A;  4IN0 A;  3F4T A;  4LA1 A;  2ON7 A;  1BAY A;  3L4N A;  2KP1 A;  2LJR A;  4K2D A;  1FW1 A;  1SK1 A;  2DJ1 A;  2AHE A;  2IJY A;  14GS A;  2YV9 A;  1TW9 A;  2YPM A;  3GKX A;  4POB A;  1T4Y A;  1B4Q A;  2ZUP A;  1JZW A;  4BL7 A;  1XW5 A;  3G9B A;  4BL7 B;  5AIV A;  1F2E A;  1FO5 A;  3IHQ A;  1XWG A;  1GL8 A;  4E8H A;  2R6K A;  4RI7 A;  3HD5 A;  4MPG A;  3LJR A;  4G19 A;  4CW9 A;  4WET A;  5DJL A;  3A3T A;  3S9F A;  4KDY A;  4BVX A;  3LG6 A;  1SD9 A;  4QQ7 A;  3BJ5 A;  4WF4 A;  4X43 A;  4ZL7 A;  3FW2 A;  3TKS E;  5D9X A;  2LS5 A;  3UVT A;  2CVK A;  4H86 A;  3WGD A;  1SJ6 A;  3RDW A;  3C73 A;  7GSS A;  3FR6 A;  4IJI A;  2L6C A;  4OWY A;  2GSQ A;  4N11 A;  2HRN A;  4POM A;  4HUA A;  3RPP A;  1ABA A;  2X8H A;  3DD3 A;  1Y25 A;  1C72 A;  2PMT A;  4D73 B;  2CA8 A;  3QD9 A;  4N0V A;  4HJ2 A;  3QMX A;  3KP8 A;  4ECB A;  1EV4 A;  1THX A;  5HR2 A;  5GZZ B;  4RI6 A;  3FYG A;  1EGO A;  1R7H A;  3M9J A;  4LL1 B;  5AIS A;  5A4U A;  3D21 A;  2JL4 A;  1JLW A;  3WT1 A;  3IC8 A;  1A8L A;  1TDI A;  1TK0 B;  2GGT A;  4O7H A;  1SKW B;  3C71 A;  2V6O A;  1BQ7 A;  5IQY A;  4NHW A;  4ZBA A;  2OKA A;  4G0I A;  5HFG A;  4PGT A;  3Q19 A;  3QFA C;  3EIN A;  1WMJ A;  3GH9 A;  2MYG A;  2JAC A;  1CQG A;  5H5S A;  5CRE A;  4BWQ A;  1WIK A;  3Q18 A;  4MJA A;  2ZNM A;  2LQO A;  2VLT A;  1PN9 A;  5CRH A;  2HSY A;  3M3M A;  3Q74 A;  2GS3 A;  3TDG A;  3Q6O A;  2HRA A;  3GKN A;  1FAA A;  4K5R A;  5B6M A;  1OC9 A;  4NAX A;  1VF2 A;  2V2G A;  1NHY A;  3MYD A;  3IAM 2;  1JFU A;  2H76 A;  2O7K A;  2LKU A;  1ZZY A;  3UVH A;  2PN8 A;  3NOF A;  1ON4 A;  1ST9 A;  1OC3 A;  5DBQ A;  1UVZ A;  1XVW A;  5BMU A;  2PER A;  4I6X A;  4POL A;  5A5K A;  3KH9 A;  4IW9 A;  3VPQ A;  4X0X A;  5GAN D;  2VAF A;  1AIU A;  1B48 A;  2VUP A;  3EUR A;  4KW6 A;  4TR4 A;  5KN3 A;  4WR5 A;  5DAL A;  1EOH A;  4EE0 A;  1GP1 A;  1WOU A;  5HFK A;  2KHP A;  2VLV A;  4PQH A;  3D6I A;  3I43 A;  1R5P A;  4O5Q A;  4CY8 A;  2HSM A;  4V1A p;  2DJK A;  2VCZ A;  4ZXG A;  3KMO A;  3IOS A;  2PGT A;  5BRT A;  2HXK A;  3FZ4 A;  1WE0 A;  4WR4 A;  4TR3 A;  4JRR A;  5ECQ B;  4WXT A;  11GS A;  3IR4 A;  2GLR A;  3GRX A;  4EIQ A;  3QCP A;  2R0C A;  2F8F A;  1K3L A;  5G30 A;  3IDV A;  1GWC A;  1YKC A;  4MJB A;  2B7J A;  2VCQ A;  2FCH A;  4K7I A;  2NTO A;  3KH7 A;  3GHA A;  1GSU A;  3TOU A;  3ZRE A;  3DWV A;  3L0H A;  2P5Q A;  5ENU A;  3VWW A;  1MEK A;  2AJQ B;  4G9H A;  2J23 A;  1PN0 A;  2OAC A;  3MSZ A;  5IMC A;  4J56 E;  4MH2 A;  5JCW A;  2R0G A;  4FIW A;  2F9S A;  3CRU A;  1V40 A;  2CVB A;  1AXD A;  5HR0 A;  2HZF A;  3ZZX A;  2OE3 A;  1YY7 A;  4EC0 A;  5KOX A;  4KH7 A;  4EXJ A;  3APQ A;  2LRC A;  2F51 A;  2WGR A;  3VI7 A;  3HJM A;  3HKR A;  3FEU A;  4MMM A;  4EO3 A;  2M46 A;  1O81 A;  3CSI A;  1K0C A;  1B4P A;  2BJX A;  3CYN A;  2GSR A;  1SEN A;  2X8C A;  4YAV A;  4K7O A;  1LJR A;  1JZO A;  1OAZ A;  3GFK A;  1G6W A;  1GLQ A;  5FWG A;  3TJJ A;  3CTG A;  5L71 A;  4MH3 A;  3UL3 A;  1THO A;  2YJH A;  1F9M A;  1F6M C;  2LQQ A;  2VCT A;  2K8S A;  1U3A A;  3A2V A;  1TTZ A;  1FHE A;  1EEM A;  1PRX A;  1J9B A;  4NWY A;  2CZ3 A;  1DBY A;  5JCG A;  3FRC A;  2X99 A;  2QA2 A;  1O7U A;  3ZTL A;  4JR4 A;  4JED A;  3U6V A;  4NMU A;  2GST A;  4HS1 A;  4IP6 A;  2ALB A;  2PPT A;  1HD2 A;  4KB3 A;  3H4K A;  2B6M A;  1K3O A;  1UA5 A;  4K9Z A;  3OR5 A;  2FA8 A;  3FK8 A;  4NHZ A;  1Z7R A;  3EMX A;  1O8W A;  1GUL A;  1E2Y A;  3A2X A;  2VO4 A;  1U87 A;  5A4V A;  4KCA A;  1A2J A;  1S3C A;  4OO5 A;  4Z2R A;  1XWB A;  2IIY A;  2P31 A;  1MDJ A;  4WEY A;  3U5R E;  3EYT A;  1V58 A;  2HE3 A;  2PWJ A;  5CNW A;  1YKA A;  2L5L A;  3IAS 2;  1PX7 A;  1NW2 A;  2LV3 A;  1Z5Y E;  1A2M A;  3J7Y b;  2FWE A;  3CBU A;  3LGC A;  3FY7 A;  4KAE A;  3KZQ A;  19GS A;  4TXO B;  1PQN A;  5DDL A;  5ECS A;  4YAP A;  2IPA A;  3EWL A;  1U6T A;  1O6J A;  2HFD A;  3IC4 A;  4I97 A;  1GTB A;  3HCZ A;  2B5Y A;  4CHS A;  2WRT A;  3TB2 A;  1T00 A;  1UN2 A;  4I5Q A;  3VLN A;  2C3N A;  3HHV A;  4XS1 A;  5B8A A;  1XWC A;  3LQ7 A;  2O85 A;  2RII A;  5ECO B;  2IFQ A;  1ERW A;  1GH2 A;  4JU5 A;  4ZB6 A;  3KD0 A;  3GST A;  2REM A;  3VWV A;  3TJG A;  2DC5 A;  6GSW A;  4EF0 A;  1GTI A;  1EV9 A;  2HT9 A;  20GS A;  1J08 A;  2H1A A;  1TI1 A;  1SK0 A;  4RQR A;  2F3M A;  3HXS A;  5DJM A;  16GS A;  2IMI A;  5D9W A;  1ZGN A;  1XIY A;  4KGI A;  1V9W A;  3GKK A;  5J3R A;  4OFN A;  2E0Q A;  3H8Q A;  1XW6 A;  2VCX A;  2XBQ A;  3KP9 A;  4ZIL A;  2KP2 A;  1V57 A;  5J9C A;  3W8J A;  1ZCP A;  2PVQ A;  4V1A g;  3ZIJ A;  1FB0 A;  1ERV A;  1NM3 A;  4MDC A;  3UIW A;  1X9W B;  3MIX A;  1XZO A;  1AUC A;  3D4M A;  1ZYN A;  2R5G A;  2AAW A;  4EKZ A;  4KA0 A;  3VUR A;  1Z3E A;  4K0N A;  4O5U A;  1QUW A;  5ELG A;  2VD1 A;  4Q5Q A;  4ML6 A;  4BPY A;  3H79 A;  4MP4 A;  5GSS A;  4MZB A;  2GZZ A;  3P7X A;  1Z7P A;  4JBB A;  2VL3 A;  3QFB C;  2H0I A;  3HZ8 A;  3GL5 A;  3CMI A;  1DUG A;  1YZX A;  4AGS A;  2B1K A;  4ILF A;  2IN3 A;  3KM6 A;  6GST A;  3KJY A;  4XHM A;  3ZYW A;  1PA3 A;  5KN1 A;  4N10 A;  4N30 A;  4PQ1 A;  2CQ9 A;  1N2A A;  3KTB A;  3N9J A;  3WT2 A;  5JWR B;  2X49 A;  5G2Z A;  3IK9 A;  2C80 A;  2IWT A;  3F0I A;  4GST A;  2XC2 A;  1YF1 A;  3F63 A;  4NV2 A;  3L9U A;  5IIZ A;  2V32 A;  3TKR A;  2WDU A;  1TRS A;  5GAP D;  5DVB A;  4BVX B;  4KSO A;  1MTC A;  1Z6N A;  1K0O A;  4TXV A;  2FWF A;  4WBR D;  5KOW A;  4K1F A;  4MZC A;  4EDZ A;  4L5L A;  2NBS A;  2CAQ A;  1VF4 A;  3ZVJ D;  1J0F A;  1HNA A;  1SYX A;  4Q5F A;  1VF3 A;  2RM5 A;  4A5P A;  4WKW A;  2BTO T;  3LW9 A;  4YQU A;  1F37 A;  3ZIT A;  3O76 A;  5F05 A;  2H6X A;  2YP6 A;  4GXZ A;  1LBK A;  4AF2 A;  1M9B A;  3F4S A;  3FZ9 A;  2NVL A;  2GDR A;  2P5R A;  1G7E A;  2WZ9 A;  3UAR A;  2H6Z A;  3L9S A;  2DKI A;  2MZC A;  4O32 A;  1IYI A;  4KF9 A;  1I9D A;  2B5X A;  2GVP A;  3EPT A;  4K0G A;  2E2M A;  2GZY A;  3GV1 A;  1XBS A;  3TCO A;  3M8N A;  2OA7 A;  2HLS A;  1RW1 A;  5CYY A;  4DEJ A;  4X1U A;  1R4W A;  4E8E A;  1PX6 A;  2CX4 A;  4OFT A;  3CXG A;  2XPE A;  3HVV A;  1VRS D;  2LRT A;  2DIZ A;  3ZIV A;  2I1U A;  1URM A;  4EL1 A;  1ILO A;  2H71 A;  3TJF A;  4HOJ A;  4GSS A;  2DML A;  4MF6 A;  2LUS A;  1K3Y A;  3DKS A;  4L0W A;  2ES7 A;  3A5W A;  1ZOF A;  4IJ3 A;  3F8U A;  1OC9 B;  3CTF A;  2VL9 A;  4MNN A;  1XOA A;  4N0Z A;  3KCM A;  1G0T A;  2C0D A;  5IMV A;  2M80 A;  1PKW A;  2EC4 A;  1GLP A;  3IV4 A;  2FNO A;  2C8U A;  4YQM A;  5AIX A;  3ZRD A;  4IP1 A;  1AW9 A;  3V1W A;  2CV4 A;  3GNJ A;  2HRK A;  1X0R A;  2CX3 A;  2LST A;  4G10 A;  1F3A A;  4JR6 A;  2XBI A;  1TU8 A;  5CP1 A;  5DAL B;  6GSU A;  1YEX A;  1JHB A;  2H1B A;  5F8B A;  2LEG A;  4XIH A;  3LEF A;  2MMN A;  5IMF A;  4GF0 A;  3HY2 A;  1X9M B;  1XCC A;  2B1L A;  3FKF A;  1FB6 A;  4ICY A;  5CO3 A;  2RUF A;  1EP7 A;  5DQY A;  3KIJ A;  4PTS A;  5C00 A;  4IBP A;  5KN0 A;  3IA1 A;  5IM9 A;  1PL1 A;  3FMW A;  5KN2 A;  2NPB A;  2YZH A;  1M0U A;  1Z9H A;  1X9S B;  3LYK A;  1W4V A;  3ZML A;  2OBI A;  5CRD A;  5G31 A;  1OC8 A;  4V2L A;  5ECL B;  3NZN A;  5FHI A;  3E3E A;  2AB6 A;  1ZMA A;  2R3X A;  3C7M A;  3D5J A;  1PGT A;  3TRQ A;  3GX8 A;  3MDK A;  3IPZ A;  2C3Q A;  4Z7X A;  2X64 A;  4PQI A;  2GQM A;  3FZ5 A;  2B3S A;  4IVF A;  5D9T A;  1GUM A;  1V2A A;  4I8B A;  3J7Y k;  1EEJ A;  2K9F A;  3KXO A;  2CZ2 A;  1R26 A;  2H6Y A;  1OE7 A;  1QQ2 A;  2VD0 A;  1SKS B;  2R37 A;  4HDE A;  5C04 A;  4AJ7 A;  2C0G A;  5J41 A;  3ME8 A;  5J5N A;  4KE3 A;  2E7P A;  3IHG A;  4MAB A;  4LMV A;  2JU5 A;  2HI7 A;  5JWO B;  4CY6 A;  1OKD A;  1SU9 A;  5AN1 A;  2X4A A;  4FO5 A;  1KEB A;  4IGJ A;  1TJD A;  5ID2 A;  4IQ1 A;  2MBS A;  1BED A;  4I2T A;  1YF0 A;  2FHE A;  2H75 A;  3HJP A;  4TW5 A;  3RHB A;  2I9H A;  2FD3 A;  1EOG A;  3VWU A;  2L57 A;  1W89 A;  4HU7 A;  1MDK A;  2H66 A;  4USS A;  4G2E A;  3TKQ A;  1A23 A;  1M2A A;  2O87 A;  2OE0 A;  3CSJ A;  2QA1 A;  3QAW A;  3APO A;  4LL4 B;  2P0G A;  2H72 A;  4TR1 A;  4ACS A;  1EP8 A;  1TRU A;  3P90 A;  1M99 A;  1HNB A;  1WP0 A;  3VK9 A;  2HNL A;  1MD3 A;  17GS A;  4FH8 A;  4MPF A;  3F3R A;  4NXI A;  3ZFB A;  3I9V 2;  1H4O A;  4GWR A;  4RQX A;  3GIX A;  1K0M A;  3HJO A;  3DYR A;  3DVW A;  2YWI A;  1TRW A;  2HYX A;  4GQF A;  4KSM A;  2I4A A;  2GT6 A;  1ZL9 A;  2IL3 A;  4YKG A;  2JSZ A;  3KGK A;  4G0L A;  2A2R A;  2V1M A;  4ZL8 A;  2H0H A;  4PUA A;  1GSQ A;  2YWM A;  4BA7 A;  2B5E A;  22GS A;  2C1Y A;  4HJM A;  4KND A;  3WGX A;  1HQO A;  1G7O A;  2C4J A;  1JZD A;  5F0G A;  2EIQ A;  3GMF A;  4MF5 A;  3UJ1 A;  2FUG 2;  3ED3 A;  3DML A;  4TRX A;  4FYB A;  3RHC A;  5ABR A;  2VOC A;  2LTK A;  3CRT A;  3IRA A;  1TP9 A;  4KDU A;  3DGQ A;  3I69 A;  1LU4 A;  3PR8 A;  1HYU A;  2R4V A;  4EDY A;  2OE1 A;  3LFL A;  3P8W A;  3LWA A;  3G7Y A;  2N5A A;  3NIV A;  2AV4 A;  4K2X A;  5H5Q A;  3RPN A;  4GCI A;  3SWL A;  4OFM A;  3G7J A;  3EU4 A;  5H5R A;  4F0C A;  5J9B A;  4J2F A;  3KMN A;  4MF7 A;  2HRF A;  1OYJ A;  2JZT A;  4PNG A;  4EUY A;  2PVO C;  1JLV A;  2IFQ B;  4TR0 A;  2H73 A;  1B9X C;  3LXZ A;  4K6X A;  4IEL A;  3DXB A;  3LSZ A;  2R2J A;  2GQL A;  2AUV A;  1I5G A;  4F03 A;  2FY6 A;  2TRC P;  3RBT A;  5ECI B;  2WJU A;  3L78 A;  4BWS A;  1XW9 A;  1IYH A;  5LD0 A;  3GTU A;  3TOT A;  1T4Z A;  1USB A;  3GTU B;  3IK7 A;  4PX1 A;  3EMP A;  5EPF A;  2UZ8 A;  1O8X A;  2B7K A;  4WBJ A;  3PH9 A;  1GTU A;  1KNG A;  3D4T A;  4PNF A;  3D22 A;  3GH6 A;  4XS4 A;  1GSF A;  4MA9 A;  1TXX A;  1U3I A;  1NSW A;  3BOA A;  3W8S A;  5DAK A;  2YZU A;  1DSB A;  3QDN A;  4WF5 A;  4MCU A;  4QL7 A;  4OMV A;  2QC7 A;  5JWQ B;  2L4C A;  2FA4 A;  4L8E A;  1TK5 B;  1K0N A;  4XS6 A;  1BYE A;  2QKE A;  3CSH A;  4DSS A;  2JSY A;  2HZE A;  3ERF A;  2HZE B;  3BCK A;  2L4Q A;  3DRN A;  1DE1 A;  13GS A;  4XCS A;  4TVE A;  1NHO A;  5FT3 A;  1XXU A;  2JZS A;  5D9V A;  4GTU A;  4F2I A;  1TK8 B;  3TJB A;  4V2N A;  3FHK A;  2LNS A;  4L5O A;  4Q5N A;  4TOP A;  1WWJ A;  1SD8 A;  1VF1 A;  2J9H A;  4CDO A;  1SL1 B;  1FVK A;  1FOV A;  4QL9 A;  4Z2T A;  4KDX A;  3ME7 A;  3D0Z A;  3WD6 A;  2H30 A;  3C1S A;  3EU3 A;  1BJX A;  2H0G A;  2K8V A;  1GSS A;  2ON5 A;  2DJJ A;  2MMA A;  2XHF A;  4Q5R A;  2LJK A;  2O89 A;  2K18 A;  5DQS A;  2OJL A;  2BMX A;  3DEX A;  4NV5 A;  1XWA A;  1YQ1 A;  2YAN A;  4IS0 A;  4O92 A;  5GST A;  5LCZ A;  4HEA 2;  1RQM A;  5IOW A;  2H1D A;  2CVD A;  2DJ3 A;  1XFL A;  3APS A;  1ZYP A;  3H93 A;  1TU7 A;  4DVC A;  5ELA A;  5HFI A;  2CAI A;  2I3Y A;  1AAZ A;  5D73 A;  3PPU A;  4MJC A;  4HQZ A;  3IXR A;  4ZIJ A;  1Z6M A;  3IE3 A;  1KBN A;  5COH A;  1GSY A;  1OKT A;  2H70 A;  2PU9 C;  1SYR A;  2GZP A;  3TRX A;  2V6K A;  4TN8 A;  3EC3 A;  2RUE A;  2WS2 A;  3QAG A;  4D73 A;  4DSR A;  2MMO A;  4OCE A;  5EY6 A;  1PMT A;  3M0F A;  5A4W A;  18GS A;  4IHU A;  4HU9 A;  1RK4 A;  3W6G A;  4PXO A;  10GS A;  3LYP A;  1BG5 A;  2VLU A;  2VIM A;  3QR6 A;  3VFI A;  4YKF A;  3L9V A;  5IO2 A;  3E9J B;  5DCH A;  1B8X A;  2QGV A;  3M9K A;  3TKS C;  1PSQ A;  1GRX A;  3UOM A;  3MAK A;  4MJE A;  4EVM A;  1A8Y A;  4HZ4 A;  1YJ6 A;  4POK A;  2C0F A;  2YOI A;  1S3D A;  5HR1 A;  1TI3 A;  1TRV A;  5G1L A;  4NPB A;  1SL2 B;  4KCE A;  2VM2 A;  5IOX A;  3UBK A;  5IMZ A;  2VL2 C;  2EIR A;  3GL3 A;  3ISO A;  1YDK A;  1GTA A;  1QGV A;  2VM1 A;  3FR3 A;  3UMA A;  3JCM L;  3ERW A;  2YWO A;  1OVN A;  1GSE A;  2I81 A;  4YH2 A;  3GUR A;  1SK2 A;  4GRF A;  4FQU A;  5E59 A;  2YN1 A;  4TKY A;  5JCU A;  3ZMK A;  2R0P A;  1QFN A;  1M7T A;  4XRA A;  3C8E A;  1WPI A;  3TKP A;  1V98 A;  2E2G A;  3HZ4 A;  4G0K A;  1ZYQ B;  3P2A A;  1QXH A;  2FGX A;  1SKR B;  3GUS A;  2ZCT A;  2WUL A;  3TJK A;  4IQA A;  3DVX A;  3TKS A;  5KEJ A;  1DE2 A;  2C3T A;  4AJ8 A;  5LNK e;  4XTS A;  2EIO A;  3C1R A;  4FYU A;  5ECP B;  1Q4J A;  3HVX A;  1T7P B;  1BX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...