1J0TA

The solution structure of molt-inhibiting hormone from the kuruma prawn
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
ASFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords MOLT-INHIBITING HORMONE
publication title The solution structure of molt-inhibiting hormone from the Kuruma prawn Marsupenaeus japonicus
pubmed doi rcsb
source organism Marsupenaeus japonicus
total genus 17
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01147 Crust_neurohorm Crustacean CHH/MIH/GIH neurohormone family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.2010.10 Mainly Alpha Orthogonal Bundle Crustacean CHH/MIH/GIH neurohormone Crustacean CHH/MIH/GIH neurohormone 1j0tA00
1J0TA
chains in the Genus database with same CATH superfamily
1J0TA 2KSLA
chains in the Genus database with same CATH topology
1J0TA 2KSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J0T A; 
#chains in the Genus database with same CATH topology
 1J0T A;  2KSL A; 
#chains in the Genus database with same CATH homology
 1J0T A;  2KSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...