1J6TA

Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
144
structure length
144
Chain Sequence
LFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAHTTSVDEVLELLAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Phosphoryl Transfer Complex between the Cytoplasmic A Domain of the Mannitol Transporter IImannitol and HPr of the Escherichia coli Phosphotransferase System
pubmed doi rcsb
molecule keywords PTS SYSTEM, MANNITOL-SPECIFIC IIABC COMPONENT
molecule tags Transferase
source organism Escherichia coli
total genus 38
structure length 144
sequence length 144
ec nomenclature ec 2.7.1.197: Protein-N(pi)-phosphohistidine--D-mannitol phosphotransferase.
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00359 PTS_EIIA_2 Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.930.10 Alpha Beta 3-Layer(aba) Sandwich Mannitol-specific EII; Chain A Mannitol-specific EII; Chain A 1j6tA00
1A3AA 4GQXA 1A6JA 1XIZA 3LF6A 4M62S 3URRA 3T43A 2FEWA 4KY9A 2A0JA 2OQ3A 4ODXX 2OQTA 3OXPA 1J6TA 3BJVA 1HYNP 4M8QC
chains in the Genus database with same CATH superfamily
1A3AA 4GQXA 1A6JA 1XIZA 3LF6A 4M62S 3URRA 3T43A 2FEWA 4KY9A 2A0JA 2OQ3A 4ODXX 2OQTA 3OXPA 1J6TA 3BJVA 1HYNP 4M8QC
chains in the Genus database with same CATH topology
1A3AA 4GQXA 1A6JA 1XIZA 3LF6A 4M62S 3URRA 3T43A 2FEWA 4KY9A 2A0JA 2OQ3A 4ODXX 2OQTA 3OXPA 1J6TA 3BJVA 1HYNP 4M8QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3A A;  4GQX A;  1A6J A;  1XIZ A;  3LF6 A;  4M62 S;  3URR A;  3T43 A;  2FEW A;  4KY9 A;  2A0J A;  2OQ3 A;  4ODX X;  2OQT A;  3OXP A;  1J6T A;  3BJV A;  1HYN P;  4M8Q C; 
#chains in the Genus database with same CATH topology
 1A3A A;  4GQX A;  1A6J A;  1XIZ A;  3LF6 A;  4M62 S;  3URR A;  3T43 A;  2FEW A;  4KY9 A;  2A0J A;  2OQ3 A;  4ODX X;  2OQT A;  3OXP A;  1J6T A;  3BJV A;  1HYN P;  4M8Q C; 
#chains in the Genus database with same CATH homology
 1A3A A;  4GQX A;  1A6J A;  1XIZ A;  3LF6 A;  4M62 S;  3URR A;  3T43 A;  2FEW A;  4KY9 A;  2A0J A;  2OQ3 A;  4ODX X;  2OQT A;  3OXP A;  1J6T A;  3BJV A;  1HYN P;  4M8Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...