1J6TB

Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
85
structure length
85
Chain Sequence
b'MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PTS SYSTEM, MANNITOL-SPECIFIC IIABC COMPONENT
publication title Solution Structure of the Phosphoryl Transfer Complex between the Cytoplasmic A Domain of the Mannitol Transporter IImannitol and HPr of the Escherichia coli Phosphotransferase System
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 19
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00381 PTS-HPr PTS HPr component phosphorylation site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1340.10 Alpha Beta 2-Layer Sandwich Histidine-containing Protein; Chain: A; HPr-like 1j6tB00
2JELP 4XWJB 5T17A 3LE5A 1PFHA 1PTFA 1Y51A 1J6TB 3OQMD 2HIDA 1QFRA 1JEMA 1CM2A 3CCDA 3EZEB 2LRKD 1CM3A 1TXEA 1KKMH 1KA5A 2XDFC 1GGRB 1QR5A 1HDNA 3LNWA 2OENL 2AK7A 2FEPS 5T1OA 1K1CA 1Y4YA 1KKLH 1OPDA 2LRLD 1POHA 3LE3A 1MU4A 1MO1B 1PCHA 3IHSA 2NZUL 1RZRL 3LFGA 1FU0A 2NZVL 1ZVVJ 1VRCC 3EZBB 3EZAB 1MO1A 1SPHA 2RLZA 5T1NA 1Y50A 3OQOD 2HPRA 3OQND 3LE1A
chains in the Genus database with same CATH superfamily
2JELP 4XWJB 5T17A 3LE5A 1PFHA 1PTFA 1Y51A 1J6TB 3OQMD 2HIDA 1QFRA 1JEMA 1CM2A 3CCDA 3EZEB 2LRKD 1CM3A 1TXEA 1KKMH 1KA5A 2XDFC 1GGRB 1QR5A 1HDNA 1J5YA 2OENL 3LNWA 2AK7A 2FEPS 5T1OA 1K1CA 1Y4YA 1KKLH 1OPDA 2LRLD 1POHA 3LE3A 1MU4A 1MO1B 1PCHA 3IHSA 2NZUL 1RZRL 3LFGA 1FU0A 2NZVL 1ZVVJ 1VRCC 3EZBB 3EZAB 1MO1A 1SPHA 2RLZA 5T1NA 1Y50A 3OQOD 2HPRA 3OQND 3LE1A
chains in the Genus database with same CATH topology
2JELP 4XWJB 5T17A 3LE5A 1PFHA 1PTFA 1Y51A 1J6TB 3OQMD 2HIDA 1QFRA 1JEMA 1CM2A 3CCDA 3EZEB 2LRKD 1CM3A 1TXEA 1KKMH 1KA5A 2XDFC 1GGRB 1QR5A 1HDNA 3LNWA 2OENL 2AK7A 2FEPS 5T1OA 1K1CA 1Y4YA 1KKLH 1OPDA 2LRLD 1POHA 3LE3A 1MU4A 1MO1B 1PCHA 3IHSA 2NZUL 1RZRL 3LFGA 1FU0A 2NZVL 1ZVVJ 1VRCC 3EZBB 3EZAB 1MO1A 1SPHA 2RLZA 5T1NA 1Y50A 3OQOD 2HPRA 3OQND 3LE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEL P;  4XWJ B;  5T17 A;  3LE5 A;  1PFH A;  1PTF A;  1Y51 A;  1J6T B;  3OQM D;  2HID A;  1QFR A;  1JEM A;  1CM2 A;  3CCD A;  3EZE B;  2LRK D;  1CM3 A;  1TXE A;  1KKM H;  1KA5 A;  2XDF C;  1GGR B;  1QR5 A;  1HDN A;  3LNW A;  2OEN L;  2AK7 A;  2FEP S;  5T1O A;  1K1C A;  1Y4Y A;  1KKL H;  1OPD A;  2LRL D;  1POH A;  3LE3 A;  1MU4 A;  1MO1 B;  1PCH A;  3IHS A;  2NZU L;  1RZR L;  3LFG A;  1FU0 A;  2NZV L;  1ZVV J;  1VRC C;  3EZB B;  3EZA B;  1MO1 A;  1SPH A;  2RLZ A;  5T1N A;  1Y50 A;  3OQO D;  2HPR A;  3OQN D;  3LE1 A; 
#chains in the Genus database with same CATH topology
 2JEL P;  4XWJ B;  5T17 A;  3LE5 A;  1PFH A;  1PTF A;  1Y51 A;  1J6T B;  3OQM D;  2HID A;  1QFR A;  1JEM A;  1CM2 A;  3CCD A;  3EZE B;  2LRK D;  1CM3 A;  1TXE A;  1KKM H;  1KA5 A;  2XDF C;  1GGR B;  1QR5 A;  1HDN A;  1J5Y A;  2OEN L;  3LNW A;  2AK7 A;  2FEP S;  5T1O A;  1K1C A;  1Y4Y A;  1KKL H;  1OPD A;  2LRL D;  1POH A;  3LE3 A;  1MU4 A;  1MO1 B;  1PCH A;  3IHS A;  2NZU L;  1RZR L;  3LFG A;  1FU0 A;  2NZV L;  1ZVV J;  1VRC C;  3EZB B;  3EZA B;  1MO1 A;  1SPH A;  2RLZ A;  5T1N A;  1Y50 A;  3OQO D;  2HPR A;  3OQN D;  3LE1 A; 
#chains in the Genus database with same CATH homology
 2JEL P;  4XWJ B;  5T17 A;  3LE5 A;  1PFH A;  1PTF A;  1Y51 A;  1J6T B;  3OQM D;  2HID A;  1QFR A;  1JEM A;  1CM2 A;  3CCD A;  3EZE B;  2LRK D;  1CM3 A;  1TXE A;  1KKM H;  1KA5 A;  2XDF C;  1GGR B;  1QR5 A;  1HDN A;  3LNW A;  2OEN L;  2AK7 A;  2FEP S;  5T1O A;  1K1C A;  1Y4Y A;  1KKL H;  1OPD A;  2LRL D;  1POH A;  3LE3 A;  1MU4 A;  1MO1 B;  1PCH A;  3IHS A;  2NZU L;  1RZR L;  3LFG A;  1FU0 A;  2NZV L;  1ZVV J;  1VRC C;  3EZB B;  3EZA B;  1MO1 A;  1SPH A;  2RLZ A;  5T1N A;  1Y50 A;  3OQO D;  2HPR A;  3OQN D;  3LE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...