1J7HA

Solution structure of hi0719, a hypothetical protein from haemophilus influenzae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
b'MMTQIIHTEKAPAAIGPYVQAVDLGNLVLTSGQIPVNPATGEVPADIVAQARQSLENVKAIIEKAGLTAADIVKTTVFVKDLNDFAAVNAEYERFFKENNHPNFPARSCVEVARLPKDVGLEIEAIAVRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN HI0719
publication title Solution Structure and Functional Ligand Screening of HI0719, a Highly Conserved Protein from Bacteria to Humans in the YjgF/YER057c/UK114 Family
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Unknown function
total genus 22
structure length 130
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1j7hA00
3KJKA 4ZK7A 1QD9A 2CHTA 1NQ3A 3M4SA 1UFYA 2UYKA 1XHOA 3R0PA 5HP8A 3K12A 1ONIA 2UYPA 3ZP4A 2UYNB 3V4DA 1XRGA 1QU9A 3LMEA 1J7HA 3GTZA 1UI9A 3KJJA 3LYBA 1FNKA 1ODEA 2B33A 2CWJA 2OTMA 3M1XA 4NWOB 3ZOPA 2CW4A 5HP7A 3D01A 2IG8A 2DYYA 1FNJA 1JD1A 1PF5A 2CHSA 2UYNA 3L7QA 3MQWA 3ZP7A 2CSLA 2CVLA 3ZO8A 1DBFA 1QAHA 3QUWA 3K0TA 3VCZA 1X25A 3I3FA 2EWCA 2UYJA 1COMA 3I7TA
chains in the Genus database with same CATH superfamily
3F0GA 4G4YA 3PAFA 3N2GB 3CCRF 1GO1A 3FD5A 2LBXA 1YJWF 4U3JA 2FC3A 1TVKA 3CYQA 3E22B 3MCQA 3CXCF 1W5FA 5IJ9B 1RQ2A 1CK2A 4DRXB 4ZHQA 3RYFB 3S0YA 2GLZA 2ZAUA 5AVMA 3ESJA 3U0OA 4BT3A 1KQSF 3LWRC 1VQMF 2DT4A 4G4XA 3LFOA 2Z1FA 5JH7B 1YITF 3RA5A 1ZWZA 3OW2F 2HS3A 3MCAB 4DXDA 5HY0A 2KG4A 4ZI7A 3HTNA 3VYTC 1OFUA 4C81A 3ZP4A 3HKDB 2UYNB 4O2BA 3VYSC 1VHAA 5LP6A 3JAMM 4WBNB 2KTVA 1YQNA 1R1MA 3CG6A 2ZODA 3PLAC 3DC2A 2LBTA 2L26A 3RYHA 3VTIC 3LDTA 5CA0B 3VIUA 1JD1A 2CHSA 4TV8B 3NVIB 2CZWA 3ZO8A 4ZHYB 5KMGA 1E7KA 1DBFA 3JALA 1RLGA 1T0KB 1Q82H 3NVKE 4PWTA 4O4JA 1IV1A 2R6R1 1GO0A 4YJ2B 3C9TA 1UFYA 3CC4F 3SIVA 3IKEA 2UYPA 3DDNA 2H8CA 1FSZA 3FFMA 4BVTA 1RQ7A 2HRYA 4X1KA 3RA6A 1W5BA 4B62A 3RYCA 3P0ZA 1Q8RA 1U40A 3V7EA 3EORA 4LCKA 3C8LA 2AIFA 5J2UB 5GAPK 2Q1YA 1VH8A 2ZOVA 3S0HA 5GONB 5GINC 3ZP7A 2RHLA 3MBMA 3HKCA 3B6NA 4G4WA 5HP8A 2RB9A 3K12A 2FGYA 4TUYB 3V7QA 4O2AA 4C8EA 3KJJA 3C9RA 5DCVA 1FNKA 2HX0A 2HP0A 3CPQA 2G9IA 2NMUA 5EB0A 4G88A 1M1KH 5BMVB 3RYIB 1VQLF 3CCUF 5KX5A 3JCMM 2Z1EA 4C82A 4I50A 2VAWA 2Z1TA 5LYJA 3LWPC 5J2TB 5GANK 3KJKA 3M4SA 1PXWA 3UT5A 4IHJB 4I4TB 5EZYA 5LXTB 3G6EF 2HS0A 3CCSF 2PMPA 4BT5A 1QVGF 5CB4A 3HKBB 3GYQA 3S02A 2CW4A 3WGLA 1VQ6F 3D01A 2DYYA 4F6RA 3CMEF 4TZZA 1VQ5F 4O4HA 2H6LA 1VQ8F 2HQSC 2W8BC 3CPWF 3J7AR 1TUBB 3CCEF 3JARB 1QVFF 4B46A 1QD9A 4ZK7A 5GONA 3TD5A 2UYKA 2OHWA 3JATA 5JCOC 1T0AA 2VAMA 3HKEB 1QU9A 1SZQA 2BTUA 3IR9A 1XBIA 5A2QM 2BTOA 4X1YB 4YJ3B 1JJ2F 5LOVA 4NWOB 2IG8A 1FFXB 5IYZB 1FNJA 3VOBA 4ZHWA 4EB6B 3IMPA 3LWOC 1W3EX 2PHNA 2P6YA 2ZF8A 3KE1A 3VCZA 4B45A 4LNUA 2R751 2Z1UA 4BT2A 2CHTA 3F0EA 1XHOA 5GIOC 2GVIA 2QA4F 3F6MA 4TV9A 1K9MH 5IT9M 3N2KA 1OAPA 2F9ZC 2OTLF 3Q8HA 3JAWA 1VQNF 4O4LA 2OTMA 2VAPA 3JAKB 5LA6B 3J80M 1VQ4F 4I4TA 1PF5A 5GIPC 3SIUA 4BT4A 5IJ0A 3HKBA 3V3TA 3VOAA 3D54A 4O4IA 5FNVB 3JASB 3K0TA 4IIJA 4ZOLB 4BT7A 4FFBA 4EI9A 5JVDB 5EWRA 2HVYD 1Z5WA 5G4UC 5ITZA 5JQGB 3C9SA 4BVSA 3ON1A 1YJ9F 1N8RH 1DT9A 3ZOPA 1JFFB 5EYPB 3N2GA 1VQ7F 4BY9D 2OTJF 3VMFB 2I6RA 1Z5VA 2H8EA 2QTPA 3E22A 1JY8A 3WJRA 3NMUC 1X25A 3D00A 3KIZA 1YJNF 1W41A 2ZVZA 2IQQA 1KD1H 4I55B 5IJ9A 4DRXA 3JVHA 4X20B 3RYFA 3R0PA 3M84A 1U3LA 1H47A 3KHNA 3WPXA 1YHQF 4BT6A 1VQOF 3LMEA 1J7HA 1GZ0A 1IPAA 4G4ZA 5JH7A 3K2XA 1VQPF 1SA0B 3WJQA 1W59A 3M1XA 3LWVC 2ZVYA 2RHOA 3VYUC 4ZHVA 3HKDA 2UYNA 3FD6A 4WBNA 5EAZA 1YIJF 1TVKB 3HJWC 3CC2F 3JAKA 3VI6A 5CA0A 1VK3A 1KNKA 3OONA 4TV8A 4ZHQB 3E1YA 2IAFA 1YGYA 4RQOA 3P4EA 1CN7A 4YJ2A 1X7OA 2Z01A 2BO1A 3O85A 2VXYA 5LP6B 4O2BB 4NUTA 3RE3A 3S0WA 1W57A 3CC7F 4BVRA 4EI7A 1JFFA 3QTYA 3RYHB 2JNBA 5EIBC 5J2UA 1K73H 1RA4A 1ONIA 4G4VA 1Q81H 3AGKA 5KMGB 1U43A 3JALB 1UI9A 4C8GA 1ODEA 4O4JB 2HS4A 1S72F 1KC8H 1VQVA 5LP6C 4TUYA 5MN6A 3MQWA 3F0DA 5MN4A 2GZLA 3S03A 5HY1A 1W42A 1H48A 3WGJA 4X1KB 3WXMB 4E6EA 3RYCB 3FBAA 4HNAB 3I56F 3BYQA 3OBWA 3I7TA 2I6DA 1W2BF 3NK6A 5HWEA 5BMVA 2LCAA 3P10A 3RYIA 1W55A 3NK7A 2HP3A 2QEXF 1IV2A 3FPIA 5CA1B 4ERHA 1YI2F 3LYBA 3HKCB 5J2TA 1NJIH 4X1IB 1CLIA 3J81M 3CB2A 4IHJA 3L7QA 2RHJA 4C4WC 5JCOA 5LXTA 2Q1XA 2ALEA 1SDSA 2AMTA 2RHHA 4O2AB 3OBYA 3E20B 3LWQC 4X3LA 2EWCA 3F0FA 2VGMA 1COMA 2KGWA 2AIZP 2HP0B 1XV2A 1Q86H 3ERNA 2KTUA 3ELCA 1W581 5KX5B 4EI8A 2MQEA 3C9UA 1W5EA 1TUBA 3JARA 4I50B 5EO3A 5LYJB 2LBWA 3S06A 5HP7A 3CMAF 3UT5B 2CVLA 2K1SA 3HKEA 5EZYB 3GHZA 1NMUB 1KNJA 1QAHA 1VQKF 5CB4B 4X1YA 4YJ3A 5HY4A 3IKFA 3VO8A 5FJ4C 2VGNA 1FFXA 5IYZA 5HXUA 4F6RB 2YXZA 4EB6A 1IV3A 5HXZA 4XCQA 3K14A 3MDOA 4O4HB 3GTZA 5C8YB 4BW0B 4HNAA 3G71F 3CCLF 3CCQF 3WJPA 2B33A 2CWJA 3CCMF 3WGMA 1GX1A 1JN1A 1M90H 3JATB 3CYPB 5CA1A 4U3JB 3I55F 2YYEA 1X52A 4R40B 4X1IA 3IEQA 2UYJA 5LOVB 5LA6A 3N4YA 3T80A 5HY2A 2HRUA 3IEWA 5FLXM 1XRGA 5EIBD 5FNVA 2N48A 3JASA 4KWEA 2UZHA 4ZOLA 5MN5A 1IV4A 1H7MA 5JVDA 3CD6F 3HWUA 4LNUB 5B8FA 1VQ9F 3CCVF 4ZI7B 5JQGA 1K8AH 3TD4A 2CSLA 4X3MA 4TV9B 5G4VC 3N2KB 4NQ3A 3JAWB 3I3FA 4O4LB 1X7PA 3TD3A 5EYPA 3WGKA 1NQ3A 4RHAA 4BVQA 3V4DA 3WGNA 2QI2A 5IJ0B 3QHDA 1Q7YH 4O4IB 4IIJB 2V9YA 3CCJF 3HAXD 4I55A 2WALA 5EB1B 4FFBB 4X20A 1W5AA 4U39A 3G4SF 4M8IA 4B5CA 5ITZB 5C8YA 1W40A 2BTQB 3QUWA 2OZBA 1SA0A 3WPWA 3N4ZA 1RLUA 1U3PA 4C8IA
chains in the Genus database with same CATH topology
3KJKA 4ZK7A 1QD9A 2CHTA 1NQ3A 3M4SA 1UFYA 2UYKA 1XHOA 3R0PA 5HP8A 3K12A 1ONIA 2UYPA 3ZP4A 2UYNB 3V4DA 1XRGA 1QU9A 3LMEA 1J7HA 3GTZA 1UI9A 3KJJA 3LYBA 1FNKA 1ODEA 2B33A 2CWJA 2OTMA 3M1XA 4NWOB 3ZOPA 2CW4A 5HP7A 3D01A 2IG8A 2DYYA 1FNJA 1JD1A 1PF5A 2CHSA 2UYNA 3L7QA 3MQWA 3ZP7A 2CSLA 2CVLA 3ZO8A 1DBFA 1QAHA 3QUWA 3K0TA 3VCZA 1X25A 3I3FA 2EWCA 2UYJA 1COMA 3I7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJK A;  4ZK7 A;  1QD9 A;  2CHT A;  1NQ3 A;  3M4S A;  1UFY A;  2UYK A;  1XHO A;  3R0P A;  5HP8 A;  3K12 A;  1ONI A;  2UYP A;  3ZP4 A;  2UYN B;  3V4D A;  1XRG A;  1QU9 A;  3LME A;  1J7H A;  3GTZ A;  1UI9 A;  3KJJ A;  3LYB A;  1FNK A;  1ODE A;  2B33 A;  2CWJ A;  2OTM A;  3M1X A;  4NWO B;  3ZOP A;  2CW4 A;  5HP7 A;  3D01 A;  2IG8 A;  2DYY A;  1FNJ A;  1JD1 A;  1PF5 A;  2CHS A;  2UYN A;  3L7Q A;  3MQW A;  3ZP7 A;  2CSL A;  2CVL A;  3ZO8 A;  1DBF A;  1QAH A;  3QUW A;  3K0T A;  3VCZ A;  1X25 A;  3I3F A;  2EWC A;  2UYJ A;  1COM A;  3I7T A; 
#chains in the Genus database with same CATH topology
 3F0G A;  4G4Y A;  3PAF A;  3N2G B;  3CCR F;  1GO1 A;  3FD5 A;  2LBX A;  1YJW F;  4U3J A;  2FC3 A;  1TVK A;  3CYQ A;  3E22 B;  3MCQ A;  3CXC F;  1W5F A;  5IJ9 B;  1RQ2 A;  1CK2 A;  4DRX B;  4ZHQ A;  3RYF B;  3S0Y A;  2GLZ A;  2ZAU A;  5AVM A;  3ESJ A;  3U0O A;  4BT3 A;  1KQS F;  3LWR C;  1VQM F;  2DT4 A;  4G4X A;  3LFO A;  2Z1F A;  5JH7 B;  1YIT F;  3RA5 A;  1ZWZ A;  3OW2 F;  2HS3 A;  3MCA B;  4DXD A;  5HY0 A;  2KG4 A;  4ZI7 A;  3HTN A;  3VYT C;  1OFU A;  4C81 A;  3ZP4 A;  3HKD B;  2UYN B;  4O2B A;  3VYS C;  1VHA A;  5LP6 A;  3JAM M;  4WBN B;  2KTV A;  1YQN A;  1R1M A;  3CG6 A;  2ZOD A;  3PLA C;  3DC2 A;  2LBT A;  2L26 A;  3RYH A;  3VTI C;  3LDT A;  5CA0 B;  3VIU A;  1JD1 A;  2CHS A;  4TV8 B;  3NVI B;  2CZW A;  3ZO8 A;  4ZHY B;  5KMG A;  1E7K A;  1DBF A;  3JAL A;  1RLG A;  1T0K B;  1Q82 H;  3NVK E;  4PWT A;  4O4J A;  1IV1 A;  2R6R 1;  1GO0 A;  4YJ2 B;  3C9T A;  1UFY A;  3CC4 F;  3SIV A;  3IKE A;  2UYP A;  3DDN A;  2H8C A;  1FSZ A;  3FFM A;  4BVT A;  1RQ7 A;  2HRY A;  4X1K A;  3RA6 A;  1W5B A;  4B62 A;  3RYC A;  3P0Z A;  1Q8R A;  1U40 A;  3V7E A;  3EOR A;  4LCK A;  3C8L A;  2AIF A;  5J2U B;  5GAP K;  2Q1Y A;  1VH8 A;  2ZOV A;  3S0H A;  5GON B;  5GIN C;  3ZP7 A;  2RHL A;  3MBM A;  3HKC A;  3B6N A;  4G4W A;  5HP8 A;  2RB9 A;  3K12 A;  2FGY A;  4TUY B;  3V7Q A;  4O2A A;  4C8E A;  3KJJ A;  3C9R A;  5DCV A;  1FNK A;  2HX0 A;  2HP0 A;  3CPQ A;  2G9I A;  2NMU A;  5EB0 A;  4G88 A;  1M1K H;  5BMV B;  3RYI B;  1VQL F;  3CCU F;  5KX5 A;  3JCM M;  2Z1E A;  4C82 A;  4I50 A;  2VAW A;  2Z1T A;  5LYJ A;  3LWP C;  5J2T B;  5GAN K;  3KJK A;  3M4S A;  1PXW A;  3UT5 A;  4IHJ B;  4I4T B;  5EZY A;  5LXT B;  3G6E F;  2HS0 A;  3CCS F;  2PMP A;  4BT5 A;  1QVG F;  5CB4 A;  3HKB B;  3GYQ A;  3S02 A;  2CW4 A;  3WGL A;  1VQ6 F;  3D01 A;  2DYY A;  4F6R A;  3CME F;  4TZZ A;  1VQ5 F;  4O4H A;  2H6L A;  1VQ8 F;  2HQS C;  2W8B C;  3CPW F;  3J7A R;  1TUB B;  3CCE F;  3JAR B;  1QVF F;  4B46 A;  1QD9 A;  4ZK7 A;  5GON A;  3TD5 A;  2UYK A;  2OHW A;  3JAT A;  5JCO C;  1T0A A;  2VAM A;  3HKE B;  1QU9 A;  1SZQ A;  2BTU A;  3IR9 A;  1XBI A;  5A2Q M;  2BTO A;  4X1Y B;  4YJ3 B;  1JJ2 F;  5LOV A;  4NWO B;  2IG8 A;  1FFX B;  5IYZ B;  1FNJ A;  3VOB A;  4ZHW A;  4EB6 B;  3IMP A;  3LWO C;  1W3E X;  2PHN A;  2P6Y A;  2ZF8 A;  3KE1 A;  3VCZ A;  4B45 A;  4LNU A;  2R75 1;  2Z1U A;  4BT2 A;  2CHT A;  3F0E A;  1XHO A;  5GIO C;  2GVI A;  2QA4 F;  3F6M A;  4TV9 A;  1K9M H;  5IT9 M;  3N2K A;  1OAP A;  2F9Z C;  2OTL F;  3Q8H A;  3JAW A;  1VQN F;  4O4L A;  2OTM A;  2VAP A;  3JAK B;  5LA6 B;  3J80 M;  1VQ4 F;  4I4T A;  1PF5 A;  5GIP C;  3SIU A;  4BT4 A;  5IJ0 A;  3HKB A;  3V3T A;  3VOA A;  3D54 A;  4O4I A;  5FNV B;  3JAS B;  3K0T A;  4IIJ A;  4ZOL B;  4BT7 A;  4FFB A;  4EI9 A;  5JVD B;  5EWR A;  2HVY D;  1Z5W A;  5G4U C;  5ITZ A;  5JQG B;  3C9S A;  4BVS A;  3ON1 A;  1YJ9 F;  1N8R H;  1DT9 A;  3ZOP A;  1JFF B;  5EYP B;  3N2G A;  1VQ7 F;  4BY9 D;  2OTJ F;  3VMF B;  2I6R A;  1Z5V A;  2H8E A;  2QTP A;  3E22 A;  1JY8 A;  3WJR A;  3NMU C;  1X25 A;  3D00 A;  3KIZ A;  1YJN F;  1W41 A;  2ZVZ A;  2IQQ A;  1KD1 H;  4I55 B;  5IJ9 A;  4DRX A;  3JVH A;  4X20 B;  3RYF A;  3R0P A;  3M84 A;  1U3L A;  1H47 A;  3KHN A;  3WPX A;  1YHQ F;  4BT6 A;  1VQO F;  3LME A;  1J7H A;  1GZ0 A;  1IPA A;  4G4Z A;  5JH7 A;  3K2X A;  1VQP F;  1SA0 B;  3WJQ A;  1W59 A;  3M1X A;  3LWV C;  2ZVY A;  2RHO A;  3VYU C;  4ZHV A;  3HKD A;  2UYN A;  3FD6 A;  4WBN A;  5EAZ A;  1YIJ F;  1TVK B;  3HJW C;  3CC2 F;  3JAK A;  3VI6 A;  5CA0 A;  1VK3 A;  1KNK A;  3OON A;  4TV8 A;  4ZHQ B;  3E1Y A;  2IAF A;  1YGY A;  4RQO A;  3P4E A;  1CN7 A;  4YJ2 A;  1X7O A;  2Z01 A;  2BO1 A;  3O85 A;  2VXY A;  5LP6 B;  4O2B B;  4NUT A;  3RE3 A;  3S0W A;  1W57 A;  3CC7 F;  4BVR A;  4EI7 A;  1JFF A;  3QTY A;  3RYH B;  2JNB A;  5EIB C;  5J2U A;  1K73 H;  1RA4 A;  1ONI A;  4G4V A;  1Q81 H;  3AGK A;  5KMG B;  1U43 A;  3JAL B;  1UI9 A;  4C8G A;  1ODE A;  4O4J B;  2HS4 A;  1S72 F;  1KC8 H;  1VQV A;  5LP6 C;  4TUY A;  5MN6 A;  3MQW A;  3F0D A;  5MN4 A;  2GZL A;  3S03 A;  5HY1 A;  1W42 A;  1H48 A;  3WGJ A;  4X1K B;  3WXM B;  4E6E A;  3RYC B;  3FBA A;  4HNA B;  3I56 F;  3BYQ A;  3OBW A;  3I7T A;  2I6D A;  1W2B F;  3NK6 A;  5HWE A;  5BMV A;  2LCA A;  3P10 A;  3RYI A;  1W55 A;  3NK7 A;  2HP3 A;  2QEX F;  1IV2 A;  3FPI A;  5CA1 B;  4ERH A;  1YI2 F;  3LYB A;  3HKC B;  5J2T A;  1NJI H;  4X1I B;  1CLI A;  3J81 M;  3CB2 A;  4IHJ A;  3L7Q A;  2RHJ A;  4C4W C;  5JCO A;  5LXT A;  2Q1X A;  2ALE A;  1SDS A;  2AMT A;  2RHH A;  4O2A B;  3OBY A;  3E20 B;  3LWQ C;  4X3L A;  2EWC A;  3F0F A;  2VGM A;  1COM A;  2KGW A;  2AIZ P;  2HP0 B;  1XV2 A;  1Q86 H;  3ERN A;  2KTU A;  3ELC A;  1W58 1;  5KX5 B;  4EI8 A;  2MQE A;  3C9U A;  1W5E A;  1TUB A;  3JAR A;  4I50 B;  5EO3 A;  5LYJ B;  2LBW A;  3S06 A;  5HP7 A;  3CMA F;  3UT5 B;  2CVL A;  2K1S A;  3HKE A;  5EZY B;  3GHZ A;  1NMU B;  1KNJ A;  1QAH A;  1VQK F;  5CB4 B;  4X1Y A;  4YJ3 A;  5HY4 A;  3IKF A;  3VO8 A;  5FJ4 C;  2VGN A;  1FFX A;  5IYZ A;  5HXU A;  4F6R B;  2YXZ A;  4EB6 A;  1IV3 A;  5HXZ A;  4XCQ A;  3K14 A;  3MDO A;  4O4H B;  3GTZ A;  5C8Y B;  4BW0 B;  4HNA A;  3G71 F;  3CCL F;  3CCQ F;  3WJP A;  2B33 A;  2CWJ A;  3CCM F;  3WGM A;  1GX1 A;  1JN1 A;  1M90 H;  3JAT B;  3CYP B;  5CA1 A;  4U3J B;  3I55 F;  2YYE A;  1X52 A;  4R40 B;  4X1I A;  3IEQ A;  2UYJ A;  5LOV B;  5LA6 A;  3N4Y A;  3T80 A;  5HY2 A;  2HRU A;  3IEW A;  5FLX M;  1XRG A;  5EIB D;  5FNV A;  2N48 A;  3JAS A;  4KWE A;  2UZH A;  4ZOL A;  5MN5 A;  1IV4 A;  1H7M A;  5JVD A;  3CD6 F;  3HWU A;  4LNU B;  5B8F A;  1VQ9 F;  3CCV F;  4ZI7 B;  5JQG A;  1K8A H;  3TD4 A;  2CSL A;  4X3M A;  4TV9 B;  5G4V C;  3N2K B;  4NQ3 A;  3JAW B;  3I3F A;  4O4L B;  1X7P A;  3TD3 A;  5EYP A;  3WGK A;  1NQ3 A;  4RHA A;  4BVQ A;  3V4D A;  3WGN A;  2QI2 A;  5IJ0 B;  3QHD A;  1Q7Y H;  4O4I B;  4IIJ B;  2V9Y A;  3CCJ F;  3HAX D;  4I55 A;  2WAL A;  5EB1 B;  4FFB B;  4X20 A;  1W5A A;  4U39 A;  3G4S F;  4M8I A;  4B5C A;  5ITZ B;  5C8Y A;  1W40 A;  2BTQ B;  3QUW A;  2OZB A;  1SA0 A;  3WPW A;  3N4Z A;  1RLU A;  1U3P A;  4C8I A; 
#chains in the Genus database with same CATH homology
 3KJK A;  4ZK7 A;  1QD9 A;  2CHT A;  1NQ3 A;  3M4S A;  1UFY A;  2UYK A;  1XHO A;  3R0P A;  5HP8 A;  3K12 A;  1ONI A;  2UYP A;  3ZP4 A;  2UYN B;  3V4D A;  1XRG A;  1QU9 A;  3LME A;  1J7H A;  3GTZ A;  1UI9 A;  3KJJ A;  3LYB A;  1FNK A;  1ODE A;  2B33 A;  2CWJ A;  2OTM A;  3M1X A;  4NWO B;  3ZOP A;  2CW4 A;  5HP7 A;  3D01 A;  2IG8 A;  2DYY A;  1FNJ A;  1JD1 A;  1PF5 A;  2CHS A;  2UYN A;  3L7Q A;  3MQW A;  3ZP7 A;  2CSL A;  2CVL A;  3ZO8 A;  1DBF A;  1QAH A;  3QUW A;  3K0T A;  3VCZ A;  1X25 A;  3I3F A;  2EWC A;  2UYJ A;  1COM A;  3I7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...