1JBJA

Cd3 epsilon and gamma ectodomain fragment complex in single-chain construct
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
186
structure length
186
Chain Sequence
b'DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVGSADDAKKDAAKKDDAKKDDAKKDGSQTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD3 Epsilon and gamma Ectodomain Fragment Complex
publication title Mechanisms contributing to T cell receptor signaling and assembly revealed by the solution structure of an ectodomain fragment of the CD3 epsilon gamma heterodimer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 18
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2001-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jbjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jbjA01
4DVBA 4J3WA 1Y18B 1TZGH 3OJDA 5D6CA 3EJJX 4X9HA 2ADFH 1CFNA 3MJ6A 4EUPG 4F33A 2XN9A 1RK0B 4JFZH 1EEZB 4S11A 5IMLA 1MSPA 1S7RA 2WINB 1R24B 5DLMH 5C0CA 5SWQA 4KHTH 2X9XA 2BOCA 3PABB 3HC0A 2P7TB 3IFPB 4OZGF 1KC5L 1TVHA 2Q3ZA 2J88H 1UZ6F 1FFRA 4WI6A 1OM3L 4EXKA 3UYRH 1WFTA 5CJQL 3REWB 1EEYA 2D31B 1ZE3C 1MFAL 1BREA 5CD5D 2FIRT 4TSAL 5FM8A 4JO2H 2HJLB 1Q9LA 1INDH 5HYEA 1NCAH 4NZRL 5ICZB 4L4VB 4AH2A 1G7IB 4CVZB 2OLDA 3EOYG 1F3JB 3GIVA 2XWBB 3QEQB 5GRUH 3UC0L 1FYTE 1FE8H 5J3HD 3KYOB 3RRQA 1G0DA 3W9EB 4JY4B 2VABA 1DBJH 1D5XA 3LHPL 4KJPC 3VCLA 2GK0A 2KDGA 4JHZA 3SJVA 2YMXL 2OJZL 1N6QL 1WZMA 2D7QA 4G9FD 4ENED 1GGYA 4M5ZH 4M1GH 1URLA 3I3EA 4XNMB 3BUYB 5F3BB 1XIWD 1B0GA 3QXVA 2WWMC 4QF1A 1AR2A 1UA6L 1MRCL 1T5WA 3NCEB 3IFNL 4AEEA 2A6KA 4QXWA 2NY1B 1CLZL 5E2TL 1A4JB 1OB1B 3V0WL 4DK6A 3KPRD 3M1BA 3VXRB 5K9OA 4EDWH 1D6EB 5BVPL 5DHVB 2W0FA 4V1DD 4CBPA 5GGVY 3BH9A 3CSYB 1IARB 2ICWI 5CCKH 4N0YH 1A14H 4OBRA 2D0FA 1FN4B 1MCPH 3RGHA 1XCTB 4WO4C 1NAKL 5CIPA 2P5WE 1G7HB 4L4JA 1K85A 4HBCH 4JQVC 4O9HH 4W6XB 4DZ8A 1NL0L 5A2KH 5HYQB 2OJEA 1MHPL 5HGHA 2VZSA 2VXVL 3LZFL 4NQDB 4TQEL 3SCMC 3TJEL 1K5NB 1HOCA 1I1AB 4LDOB 3MRGB 4Y4KC 4UAOB 4OCWH 2H3NB 2ZSVB 5L2JA 3DSFL 4WW2B 3HMWH 3C5SA 4Z7QF 1AJ7H 2PNDA 2F8VA 3TA3D 3BHBA 4FQLH 5GISL 4EBQH 1JL8A 2HT2D 2ADJA 4FQ1H 3BKCL 5IB1B 4F9LA 1B88A 1FGVL 4JDVB 2Q86B 2V9TA 4OF3A 5TDOB 4L4VE 5HDLA 2FYYB 5DTFA 4KJYA 5CJ8A 4GQ9H 4NCDA 3QEQE 3IDJB 4FQXD 5D7KE 5DEGB 3MA7A 1N64H 1BIIB 4QGYA 1J0HA 1YEIL 1MPAH 3NGBB 2ZUTA 1C1EH 1ORSB 3MRRA 1P1ZA 2AJXL 2X7LB 3GSOA 2FGWL 5I6XC 1ZS8A 4IS6B 3S35H 3T0XA 2MPAL 3S98A 1EVTC 1CGSH 2IFFL 3OKNB 3DECA 2MCPL 5D7LD 5EB9A 2XZCL 2W9EL 1H0DB 5E9DA 3MJGX 3WCYA 4MA3A 3LRGA 3ZYIA 1GC1H 4HUNB 3QDMD 5F7LB 3VXRE 4ORGA 3O81A 5IB2B 1NMCC 4OIAA 4XH2A 1WQVT 5HPMB 4Y4FA 4BZ2L 4QTHA 5C8JA 1V7NH 4FG6D 3KJ6L 4QT5A 1FP5A 3V6FB 5KBNC 1OAYH 3TO4A 2E7LC 3H42H 5I71B 3PIQB 3TVMD 1U8HA 4DKEH 1KTRL 5CGTA 3KLHD 3SGJC 1KJ3H 1OTSD 1DJSA 2XY1A 3VRIA 1JBJA 3OG4B 4QGTA 4NQDE 5E4IA 2VTFA 3HR5B 3ARDA 4PUBH 1JZ2A 5GGQL 1MWAH 1UJTA 1NBYA 3B4NA 3MLPA 3GSRA 3LEVL 3RL2A 3C08L 5C3LD 3EYOA 4F7CB 1WC7A 4NC1E 4JEGB 1LO3H 4JFOB 4JGMA 1Q94B 4J3TA 1LNUB 4UTBH 4X6BA 3PWUA 4ZD3L 2EEAA 4DEPB 2JIXB 5AG9A 3C2SA 4UIMA 5T3XL 1ONQA 5C71A 5MEPB 4PY7B 2FLBT 2E27L 2E9WA 3KPPB 4Z7WF 1TVBB 2A9NL 4NHCH 4BSWA 3GNML 3FB7A 2FBJL 2VLKA 3VG0H 5KVDH 3QUXA 5C7XL 5JZ7C 4I5BB 2P8MB 2XA3A 5I2IB 5F96H 3CH1A 1RI8A 25C8L 1F3DJ 4PJ8B 5I19L 1J5OH 3BN9C 4WNQB 4Q97A 4RFOH 5DRNA 1CU4L 4O51A 3WFDH 1VFAA 1A3LH 4UINL 4KUZH 4MS8D 3HZKB 3QJFA 3MSPA 5L2KB 5HHOA 4YBHA 3VFTB 1A3RH 4DCQB 1A7PH 3I6KA 4NNPH 4PBVC 5FO8B 4GT7A 4I3RL 3NCBB 2ORBL 2ZOLA 1FG2A 1FL5B 3O2DL 1I7TA 5CINH 1IZJA 1CXEA 1GYAA 4Q9QH 2HYMA 4L5FH 4X8XA 3RL1B 2W0PA 4U3CA 2XKNA 3QIUD 4D0CB 3MGOB 3HZVB 2R39A 3DBXB 5DYOB 1NCCH 1KN2L 3RPIB 4WIQA 5A43C 2LAAA 3GMQB 3V8CA 4NO3B 3L3GA 2FJGA 4TUOB 3WNKA 1FG9C 3WE6B 4KRNA 4QRPB 4DKFH 5DZOA 5I8CA 1ETZA 3NIDE 1OF2B 1A6AB 4OGZA 3QG6A 5F9WC 1BJ1H 1NC2B 4EIGB 3L5WA 3BJLA 5F6IC 4WY7H 1X5HA 3AAZB 2B2XL 4A6YA 4JZNA 1KTLB 4FQCH 4OD2B 4PRNB 4M7LH 2AJ3A 3DVGA 2QJDA 3U30B 2XZAH 3KPQB 4IDJH 3FT3A 3S4SB 2CDGB 2A6JA 5DRWB 4U3HA 4PJHB 1E28B 1R5WA 5MEQB 4BSVA 4RQQA 1JF5A 4PTTB 3UP1A 1V3KA 2CD0A 1ZT7A 2PCPB 4X6EB 4LIQH 4PJXA 1MJ7L 3HAEG 3LKPB 3DMMC 1XGQB 2D03H 1CFVL 3QULB 2I25N 5CP3A 3QDGD 5IJKA 3FT2B 3D18A 1DUYA 4TVPE 3QFJD 1TPXB 3SOBH 3DXAD 1XH3A 2CLVA 4ZOBA 5EU6D 5F1IB 3C60D 1NEZB 1VEPA 3O41B 4XNUH 1CDJA 1MCDA 4J6RL 5T33H 3MRHA 4WU7B 2QTEA 3VFWA 1H15B 5L2KE 3IDXL 4D0DB 4KU1A 4ZSOA 3ROOA 3F12B 4JZOB 4K23L 2F54B 4NNYB 4MD0A 2EYTB 3S35X 3TBTB 4ZG1A 1JHLH 3LIZH 3AM8C 5JO5B 1G7QB 1S9WB 1J1OH 2LV4A 4GKZA 3V4PH 4GG8A 2ESVB 3Q3GA 3WUZA 4I77L 4ODVH 3HPLB 7CGTA 3PDOA 2NX5D 5EWIH 5K9QI 1NBVH 3RVWD 4Y1AB 4R97B 5ICXA 4G6FD 1HHJB 3INUL 1KXTB 1OWRM 1RULH 1S9VB 4MMZC 3ILQC 4X7TB 1CD1A 2X4UB 3EAKA 4LKCA 5JTWA 1R0AH 4HKZA 1JNHB 2B0SH 3LKRB 3VWJA 1CQYA 2OI9C 3LB6D 5J11C 4QRPE 4JFED 4JR9L 5GZNC 2XTJB 1RIUL 2ADGB 4M3JA 1I7ZB 3JVGA 4OFYA 3ZHDA 3EOBA 5MP6L 3BDYH 4Q9CA 3G5ZA 2B1AL 4WHYG 1JF1A 2VLJB 5HGGS 4H20H 3TCLB 1S7TB 4ZPVB 4MAYB 3TFKD 4PJGF 1T66D 1Q9OB 5EU3B 1R3JA 3QI9C 4NSKA 4NN5B 3RKDD 1R3IH 5C70A 2M1KA 2V5MA 3VD5A 1NH6A 4MCZA 2BY2A 3O3AA 5IEHA 5CHNB 4MNQB 2VC2L 5CS7A 1KJ2B 5IVNA 5T1DL 4KQ4H 3UTQA 1FZOA 4A2LA 1IT9H 1NCDH 1J05B 4LLDB 1I9RH 2NCMA 2R1XB 2AV7B 2CUMA 3I6LE 1UXWA 2YK1H 1N2RA 5EUOA 4W4NA 1QSZA 1MCKA 2OR9L 2VAAB 3Q6FA 4LLAA 5TFSH 1M6OA 2DQGL 4N8CH 1DFBL 1A7NH 4D9LL 4ZOCA 3B9KA 1FYTD 5KS9F 1TZGL 4QKXB 3EYFA 1FO0L 4IOIB 2ADFL 4NP4L 4XRCB 4JFZL 4HV8A 1KPUA 5DLML 1N4XH 2V2XA 3BGMA 1ZEAH 4KHTL 5I1CH 3MMEB 3HHRB 4UV7H 3V0VA 2ILLA 3ZDZF 2J88L 1I7UA 3QJHB 3MCKA 3O4LB 1KIPB 1KLGA 2WK2A 1AGCA 1UB6A 3JXAA 4KUCF 5JLZB 5KVGL 5TGBA 2ESVE 3QQ3B 1JPTL 4MHHI 4OGAC 3UYRL 2VXTL 4WI8A 4Y1AE 3LS5H 4FRWA 4H0IA 2HVJB 4KDWA 1IM9B 1OLZA 4JO2L 1INDL 3EYQC 4FQQA 1NBZA 1K4CA 5CUSH 1Z0NA 3MJ8A 4MNGB 2X6MA 5GRUL 2MFNA 1FE8L 1C8PA 1N7ML 2XTJE 3GBLA 1DBJL 2IQAB 1MFDL 4KJWC 1VB9A 1XFPA 1OARH 2YZ8A 4JHAH 4GOSA 5HHQA 2VLJE 1DDHB 4NT6A 2Z92B 4HJ0D 2ZCKH 3AXLA 5CKGA 4QXUH 3LV3A 2DQFA 4OLVH 4X4YA 4M1GL 1XGRA 4YHOH 4NQXB 3ZLQC 5T3ZD 2NZ9D 1BX2B 1T7VA 2PTTB 3D25A 3T2PA 4LOUC 2J5LC 4KQ3H 4MNQE 5C08A 5HYSB 1OHQA 1QBAA 2YUZA 2CK0L 2XWTA 4EDWL 4WHCA 1PYWB 1RZJL 4OCNC 3TH3T 3ALPA 1KIQA 5DHVH 4OZHA 5CCKL 4N0YL 3VXUA 2DAVA 1A14L 1U95B 4L4VD 1MCPL 5JIIA 1WBZB 4M6NL 3GSNA 4WO4B 3QEQD 2DWDB 3B5GA 4HBCL 4YGVB 5D7KD 3GB7A 3JZ7A 4O9HL 4U6TA 3UO1H 5JA8B 3U83A 1VPOL 4U1LB 2C3HA 2B20A 3MRNB 3SCMB 2MSPA 3J8F7 5E8EB 4JDTH 4MJ4A 4Q6IC 1AC0A 2FEDC 3Q5YA 1TMCB 2PW2A 1WUNT 3VG9C 2YPVH 3VRLF 5I17A 4NZTH 1M7XA 3HMWL 3KYMB 2P5ED 1AJ7L 1OTTC 4PJDA 5JDSB 3HCVA 35C8H 4FQLL 4EBQL 4YLQT 4FQ1L 4U6HB 4ZUUA 2CKBA 3GMNA 3S8WA 4LSPH 4LASL 1MCBA 2HLAB 5DJ2A 3X14B 4MNGE 2DKMA 3MRIB 4P46A 4YAQA 3IDMA 3CDGB 5ANMA 1M1SA 3DVFA 1UENA 3A67H 1G9NC 4XBPB 1X9QA 2AXFB 1N64L 4NO0D 3IJHA 1SM3H 1MPAL 3CC5B 2VWEC 5KSBB 4QRRB 3Q48A 4U2YA 2WWKT 3ZT6A 5I6XB 2BDNH 2R2CA 2XACC 3S35L 4LHUG 4OIIH 4NQCA 2LFGA 1I1AD 3MLZH 1YMMA 4MVBC 4QHNB 1CGSL 3IU3A 3ZE1E 5CBAB 4YHYC 5DFTA 1FGNL 4FQIL 4GBXA 2G5BB 3BE1H 3D5OF 4Y4FC 1C16A 1GGBH 2BK8A 4X8JA 1GC1L 3MTRA 4EN3A 3GRWA 1TDQA 2VZUA 4OGYH 3TPKA 3ROLA 3DYMA 3TYFA 1CDGA 4MX7B 2B39A 2GJZB 4IIQC 3TO4C 3QSKB 1V7NL 3BP6B 4J2XA 1ODAA 1OAYL 2ERJC 4QY8A 3KS0H 5TQ2H 3CH8A 2UYLA 4KGJA 1F45A 1BAFH 2FHBA 3BKJH 3RGVA 1F97A 2X41A 3B9EA 1BFSA 3SDCA 1A7RH 3ARDC 3PDDA 1ROWA 3L5HA 2R1YB 5EO9A 3TIDA 3STLB 1MWAL 3WSQH 2G60H 3LKNA 5DDHA 2R0WH 3FJTA 1ZHLB 3X12B 4JY6A 4PGEA 4OF6A 3WNNA 4Y19A 3BDBA 4AMKH 2RJMA 1UVQA 4EUPB 1U0QA 1F2XK 4UTBL 2DJ4A 2WUCH 2CQVA 2HKHH 2NXYC 1X4XA 2E7MA 1FV1B 3ZL4H 2NNAB 3QUXC 4ZQKB 4Z76B 4NJAH 5F7WC 2NLJA 3CZFB 2QSCL 1ZXQA 5KVDL 3VG0L 4OF8A 4MLIA 1RIVH 1CICA 1U58B 2A6IB 4HGWB 5F96L 2J8UA 4GW5B 1F3DH 1S7SB 1PJ9A 3JV6B 4HXAH 4TVPH 4QRRE 2V6HA 5KSBE 3VFSA 4ZUWA 1J5OL 5IWLC 4W81A 3N1GC 4V2BA 3HC4H 4JN1H 4RFOL 3DI3B 3WFDL 2APTA 3JWOC 3VU2A 1A3LL 4KUZL 2BMKA 4D9QE 5F1OB 4HS3A 4I48A 1TLKA 1T04B 5DGQA 4C4KT 1XGPA 5DJ0B 1FFPA 3KPTA 3QO0A 1G9MH 4NNPL 2DQCH 1QEWA 3EYSH 1IQDA 5HD8D 3G5YB 4FFWC 2EXYC 5CINL 1NAMB 4S0SD 4Q9QL 4BUGA 2P49B 1YEDA 2KUTA 3OB8A 5C6WH 5FOBB 3L3HA 1V3MA 1VKXA 4C54A 1KJMB 1NCCL 3CFKB 2NW2B 5IUSA 2V5TA 1F2QA 3C8HA 4P59H 3U48A 4POUB 4J3SA 5EO1B 4LP5A 1FVCB 4DKFL 1IAOA 1VEOA 2FLRT 2HJFB 1IEAB 2P24B 2EYRB 4PJ8D 4U1NB 3JV4A 4XGZB 3V2AR 2NY0C 5F9WB 2PUQT 3BEWA 1GHFH 1BBJA 3VI3F 5F6IB 4WY7L 4PJFE 4QHLA 4TOYH 3CGTA 3T09A 1YECH 5L2KD 3MREB 4FQCL 3ARGA 2DQTL 4D8PB 3N1QC 4M7LL 1SBSL 5CLWA 4AT6A 5IM7B 1SHMA 2XZAL 4OCSL 4WJ5A 4CN4A 3WXWH 1FL6A 3PHSA 3MNVB 4BQ9A 4PJCB 2WP3T 2DYPD 3K8KA 1V5JA 4QOKE 1QVOA 3BMVA 1F6AA 2DQHH 4LIQL 4YHIA 3FMGH 5IJKC 5B4MC 3DMMB 2GSGA 4KMLB 4KAQL 2D03L 4KKLC 2VXUH 4U3XA 2IBZX 1MAML 1INEH 4OAWB 4JG0H 3SOBL 2BVOB 3CU1A 2RQ8A 4Z8FH 5D2LA 2Y7QA 2X1XR 2A6DB 3O9WA 5T33L 1JP5A 4BFIB 2IJ0C 1RK1B 5SX5H 1C7SA 4JKWA 3KWWB 1NC2D 1DL7H 3NZ8A 4NO5A 1GOFA 2J12B 5MERA 1UM5H 5I1JH 4MA1C 1OAKH 3QRFM 3C8KA 2WBJA 4KJQC 2VDKH 1JHLL 3LIZL 3V79C 3RX7A 5KJRH 4JFXA 3V4PL 3WUWB 5E8NB 4ODVL 4J1UA 1NANI 4RAVA 1QRNB 3OKKA 5EWIL 1NBVL 4OUUA 4P5MA 4U33A 2HN7B 5GGSY 1HXMA 4ZXBA 1FZJA 5CJOH 3VXOB 3VWJC 1RULL 4IRJA 2SEBA 2H6PB 2AJZB 1AIFB 3BRGC 3KYKH 2PW1B 4QRQA 4LU5L 4NM8L 1R0AL 1RZ8A 1RUPH 3I6LD 2OI9B 2VDMH 1QSEE 2CLRB 1FCCA 3NA9H 5DJCA 5J11B 4GRWB 4G7VH 4NFCA 1ZGLB 3U36B 2MNUA 5EU5A 3RTQA 2NTSP 4JCMA 5MI0C 3HMXA 3B5HA 3GMOA 1YDPA 4GW4B 4YO0A 1G7JB 2AEIT 3QI9B 2D9CA 1R3IL 5C0FA 1H3VA 3RWCA 5F70A 3U0TB 4QXTB 3F7RA 4QRSA 4LF3A 4WWKB 5DUPL 3R06A 4JDZB 1F90H 4NYLA 2ESVD 1IKNC 1KJ2H 4P2CG 3UZQA 5GRJH 5JOFB 4KQ4L 1IT9L 1NCDL 4U1HA 1RURH 4Y1AD 1AKJB 1I9RL 4HMCA 1UQSB 2YK1L 3F65A 43CAA 3B9KC 3MLTA 4L29A 3H7BA 5IOPA 4M8VA 1U36A 4N8CL 1A7NL 1CFNB 5INDA 5C86A 1S7UB 3RHWF 1EO8L 2X4PA 5C0CB 2XTJD 4JRWA 3KR3H 2WWKO 1MHCA 2Y4SA 2B1HH 1UGNA 3HS0A 2IPTH 3HC0B 5E7BA 1ACYH 2VLJD 1N4XL 3BN3B 5ESVB 2Q87A 4JVUA 1ZEAL 4HWEH 2YPKB 5I1CL 3ZHLA 4UV7L 4BQBA 1WBXA 1JCKA 3MLSH 1OP5H 2IBGA 5L6YH 3EW3B 3KLSA 4JO3H 4XX1E 3OR7B 5F9DC 4F37F 1Q9LB 3C5ZD 4OZFB 3UAJC 2ZUWA 3MRBB 1QRNE 4WGWB 4Z7VF 5DD6B 1U92B 2LU3A 2IEPA 3LS5L 4AH2B 5I16A 5BMFL 4Q6YA 4Q0XH 1WV7T 1NUFA 1WK0A 3UROR 3GMPA 3V5DA 4ZO6A 5CUSL 5AYUH 4JKPH 1D5XB 4N1EA 3DO7B 3PGCA 3Q2CA 4GRWE 5IJVA 4YXKH 3REVB 4WVRA 4BZ1H 3QUZC 5CSBA 4JHAL 4R0LA 5F6HJ 2ZCKL 2HFFB 3U7AA 2FD6L 5F7DA 4QXUL 1PGRB 4QF1B 4OLVL 4G8IB 1UH3A 4YHOL 5MHSE 4PR5A 5K59F 3DNKA 2H26B 3BYYA 3LQMA 2J5LB 3CVIH 4QTIH 5K9OB 1AE6H 1NFKA 2W0FB 3MGAA 4KKNA 3BH9B 3STZB 3DGGA 1T20B 2ZSWA 4P4RB 4PJBF 4MAUH 1JJUA 3WFZA 3QIBD 5E08H 2YS4A 4YFEA 5ACZB 4P4KD 1EGJH 3QPXH 4HHAB 1VDGA 4UTAH 3TJHC 5CSZA 4DZ8B 2AQ2A 3HNVH 1ZLUH 4X6DE 4LSRH 5D7IA 4LQ1A 3KYNA 1BIHA 3MJ9H 4M5YH 5D1ZA 1HOCB 1MLCB 3UO1L 3HAEB 4OFPA 4LQFH 3ULVD 5HVFB 2MHAB 4CN6A 3ARED 4JDTL 5KVEH 4Q6IB 3LN4B 3TF7C 3VG9B 4IRZL 4C4KO 1UWXK 1GGCH 2YPVL 4NZTL 5KZCB 4NC2B 4CNIB 1KJVA 4XVSH 2WWMD 5I66A 2ADJB 3O6FC 3VRJA 2DKSA 2JLLA 5CEYA 3BW9A 4MDJB 5GS1A 4N0CC 35C8L 1YYMH 5B21A 2X4QA 3F6IA 5SX5K 3FOMA 4F37K 4GMTH 5HDOA 3MRKA 4LCUA 5DTFB 1GPOH 2BVPA 4LSPL 2FO4B 4JFHD 3LN9A 3MA7B 3RVXD 5SX4I 3TNMA 3NFNA 3TT3L 2V5RA 3KPMA 4DZBA 3C6SB 3IGAB 3L3IB 4NKOB 4RA0C 4PY8I 1NGYA 3A67L 1BM3H 2A77H 4HUWB 3H8NA 1UG9A 1HHIB 3U46A 5JIPA 2BERA 3GSOB 3G08A 1SM3L 5C0EA 2YUXA 3TZVA 1U8PA 3R8QA 3MO1B 3ESVF 2AEPH 2PF6A 5I74C 2MJWA 3U4EA 3CDCA 3MLZL 4NKQB 5HY9A 4F7MB 4MA3B 4EN3C 1AFVH 4F7EA 1S7VA 2JCCF 3BE1L 4JPWH 3QQ4A 1QSFD 4JJ5A 4Y4FB 3VGHA 1R6VA 4QTHB 4OGYL 1TCMA 3IDIA 3DHMA 4QT5B 4K7PY 4U6YA 3N1MC 4IIQB 1X5LA 4IM8A 3HLAA 2QV2A 4JFPA 3I75B 3RGVC 3V4UH 4YHNB 4HS6B 3E3QC 2ERJB 2JF1A 4XZUA 3SDCC 1B3JA 4Z5RB 3QNYA 4AQOA 5J6GA 1Z3GL 2KH2B 2XFXA 3FQUA 1B0RA 3T4YA 4F7TB 3ILPA 5CEXB 2IPUK 3W11C 3QO1A 3GBMH 4DGVH 3ARDB 5E2VH 1LEKB 2CRMA 2OXGA 1CI5A 1R3LA 3GSRB 4QRRD 3VFMA 2NY5L 1GIGH 1H3PH 4NZJA 1OGAB 3EYOB 3WDHA 3HKFA 3WFCL 2G60L 1ZSDA 2R0WL 1T2XA 5JIHA 1VENA 5TQ0H 5BS0A 5IV2B 5AD0A 3ZTNH 2UUDH 2QSTA 1B6UA 3CFEA 3PWUB 4LSQL 4C56A 2NY4D 1OP3K 4AMKL 1Z9SA 3H9ZA 4UIMB 4XCNB 1N8ZA 4HKXB 4OI7A 4EUPH 5I15H 4LCIH 2WUCL 3LAFA 2HMIC 5ILTH 2NXYB 4UQ2A 4KDVA 3ZL4L 2FH8A 3FO2A 4BSWB 3FB7B 3QUXB 2AXHA 2IG2H 1JHTA 4K2UH 5ERWB 4YNYB 1RIVL 5KAQG 4AG4H 2VUOA 2R1WA 4DOHB 4BQ8A 4TVPL 2VWEE 1LO2H 1Z9MA 5GGRY 4OZGA 4P23A 5ESAA 3HC4L 4JN1L 4TSCH 5D2NE 1HIMH 1IC7L 3I6KB 4LCYB 4OZIF 2ZOLB 4I0KA 3S34H 1FG2B 1I7TB 1G9ML 4DGIH 1E4KA 1W0YT 3WIFB 2DQCL 1J8KA 5DJDA 3WHXB 3HUJF 3EYSL 1T7XA 4RFEA 2KPNA 5FDWB 2FJFA 3I50H 4LNVA 5IW6A 2NY6C 1NAMH 1CR9H 2Z4QA 5IP4A 5D72H 4CRPA 2FJGB 4QOKD 1UM4H 4N0FB 2WANA 2QQKL 5EC1A 5EU7C 1MCLA 1MQKH 2WBJD 4P59L 3RI5F 3TBYB 3ZTJH 1ETZB 5GS0C 2R0LH 3QG6B 3MBEA 5FO9A 4MWFA 2NY0B 2BSSA 4JZNB 4DGYH 1GHFL 3BN9D 3IRPX 1OGAE 2VE6B 1TJGH 1S8DA 4TOYL 3MCG1 4YGAB 3RWEA 2ATPB 4XXCA 1YECL 4AENA 1P84K 1ZLUK 3I6GB 4GKNA 1FH5H 2DBLH 1LD9B 1YY8B 4M6AA 2J6EH 4AEHH 4N9OB 4XPBL 3CSGA 1XGYL 4BSVB 2ICWA 4MQTB 1KEGH 1ZT7B 3FHQA 3P9LB 4PJXB 1C5DB 4RCAA 5TF0A 1KULA 2DQHL 5GRWA 4BK5A 3FMGL 2EDRA 3OKOA 3D18B 2XQBH 3RWHB 4WU5B 4OV5A 1XH3B 2CLVB 2Y1VA 5IF0B 1TZHB 1CFBA 3O3BA 3FO0H 1Z9LA 1INEL 5IFJA 1Q9WA 2WLZA 4JG0L 2J1KA 3Q5TA 4FMFA 4K3JH 1C12A 1QSED 3PG2A 5GGSA 5IVXA 4Z8FL 1FVDA 1RJZB 4LPXA 1GOGA 3RUGE 3R0NA 4MD0B 3OJ2C 3A6BH 1NGXA 1DL7L 3V6BR 1CTNA 5I1JL 2FX7H 3SY0B 4MA1B 5A2IH 1F5WA 1ADQA 1HDMA 1H5BA 4GG8B 3X13A 1PX4A 4KI5C 3E6HA 3Q3GB 3PDOB 3OJVC 4E5XA 5KJRL 4MXVF 1SJHA 3U2SA 4ZXBC 4LHUB 4H5SA 2X4OB 1F4HA 4IRJC 3F5WA 1EVUA 5ID1A 1PAMA 1CXIA 3F58H 1TCRA 1RZKC 3IU4H 1BD2E 5DRXB 3VWJB 4WI3A 1GSMA 3PL6D 3BH8B 5H37H 2A73A 5F9AC 3TO2A 4PRPA 1ORQA 3KYKL 3DMMD 4M8QA 4L3CB 4QNPF 1RUPL 4BKLA 2VDML 3EOBB 3MBXH 1NUNB 3NA9L 3G5ZB 4NQED 5E8DL 2WIMA 3RTQC 3T2QA 3VFNB 3HE7A 3Q0HA 4GRWH 3NIGF 3DWTA 3VH8B 3CXHJ 5D7SL 4Y2DA 2YRPA 1HYSC 3TBVA 3I9GL 5JXAH 5MI0B 3FB8A 4YHML 5DD1L 4MCZB 1T5XB 1XF5A 1TETH 2HTLD 3E6FA 3LPWA 4RDQF 1K8IA 1A6ZA 3QFDB 1NCNA 4KHXH 5FA4A 5DD3L 2YKLH 4OUOA 3ARSA 2GJ6B 1A9EA 3PJSA 1F90L 1BP3B 2BRQA 1TTFA 3OMZA 1T0NA 5IIEA 5GRJL 3LS4H 2VRAA 1UXWB 1J88A 1N2RB 1QRND 3DRTA 5EUOB 1RURL 2P1YA 5LGKA 3Q6FB 3VDAA 1M6OB 1TITA 2UUDK 3RA7H 4PRIA 5C0IA 4JRXE 4NOBA 3ILQD 3EYFB 1PKQB 1MFBH 5IBUG 5BVJA 4P2OA 2EO1A 5ALBH 5I1DA 5KSAD 3PXJA 4HV8B 3C9NB 1AGBA 1K4DB 2YEZA 3L1OH 3EOTL 5GZND 2NY7H 4YIQA 2EEDA 2V2XB 4PYGA 2GK2A 3KR3L 1YNTA 2XXCB 1ZOXA 1BGXH 2B1HL 2IPTL 4Y4HC 1ACYL 1DBMH 3VA6A 1I7UB 4PREB 3ZT7A 1CK0H 1A6WH 4HWEL 1LK2B 2HFGH 3WJLC 1AGCB 1MVFA 1UB6B 1IE5A 1RAMA 4AQ1B 5L6YL 2J7LA 2OTWA 5MHSD 3CFJA 2Q8AH 1RJLA 4WFHE 4Z7WA 4JO3L 2DWEB 4DW2L 1Q38A 3V52L 2VJXA 4WWKD 4FQQB 1NBZB 3MLUH 1QBLH 5FGBA 4BUHA 3MJ8B 2CXKA 1SJVA 4IHOA 4Q0XL 4JGJA 4PJEF 3P30L 1AH1A 3BZFB 3PQYD 1AKJD 5AYUL 4D0BB 1OTUC 1U8LA 4JKPL 1W0VA 4ODUB 3TP4A 1OD9A 4R0LC 2QQLH 2ZJSH 2JJSA 1PZ5A 4NT6B 2Y07H 3EYUH 4BZ1L 3LV3B 3QUZB 3EJZC 4X4YB 3WLBB 4W68A 5D1XA 1A4KA 1I8LC 3AS0A 3D25B 4L4TB 3WYRA 1KSRA 1IBGL 4HKBB 5FYJU 5IR1A 1YYLH 3C09C 1IGIL 4NZUH 1FDLH 4QTIL 3CVIL 1ULVA 1ZLSL 1AE6L 1IGMH 1K9TA 5FB8A 2GJ6E 2BC4B 3T0EA 4G6ML 4OZHB 5LBSH 2K7PA 3QQ9D 1TJHH 2XIDA 3HZYA 1OGTA 4MAUL 4R4ND 3T4AB 5A16A 5E08L 2YWYA 3WBDA 1AGDA 1JE6A 1EGJL 1PKQE 3QPXL 3BKYH 4UTAL 2P46B 4B7LA 2IPKA 5D1ZC 3HNVL 4KRLB 4RISH 3WJJA 3S88H 3GJFK 4JFFB 3WIIH 5DJAB 3MJ9L 4M5YL 3B3IA 4O2EB 2E9IA 3QUYC 5E6IA 3X17A 2DTSA 3V7MA 1W72L 2BNUA 4LQFL 5IB5A 3IFLH 4LEXH 1AY1H 3HAEH 2CUIA 4QEGA 5LAXA 4XXDA 5I17B 1N5AA 5HJ3B 5KVEL 3D69A 4Q9BA 3LQAC 4PJDB 4KTDH 1T6WA 1I9JL 3BT2H 1HCVA 5E1HB 4I4WA 5GS1C 4NIKB 4XVSL 3D3VA 3O6FB 3CSPA 4LOUD 4ZUUB 3GMNB 4XC1H 1YYML 2MQ0A 2H1PH 4GMTL 2VLRA 3L9RB 1GPOL 4HC1A 3UTPE 3TBSB 1QTYT 5ANMB 3QXTA 2YPLD 4X6FA 3GKWH 5C6TH 1BM3L 2A77L 4F8QA 3T1FB 1G9NH 1XT5A 3FO1A 2MOVA 4HS8H 4NQCB 2MCG1 2HFEA 4JPVH 2FHCA 4DN4H 3IU3B 3RKPA 1P4LB 2AEPL 4L4TE 3WXVL 5I74B 3NFSH 5FF6A 4OB5H 2K1MA 4NZDA 2FEDD 4EN3B 3SDDA 4EI5C 5C6PB 5TDPA 4JPWL 3P11H 1CE6A 3TYFB 5KSUA 4ACPA 1C08A 4FFVC 1U42A 2ADIA 3QDJB 1OTTD 3UZVB 2QL1A 3U1SH 4RGNC 4Y16B 5D71L 3GMLA 5B22A 3I85A 4PIRF 1MFEH 1CG9A 2UYLB 4NJ9H 4Y5XA 3RGVB 4JKKA 4RZCA 3V4UL 2X40A 1HWGB 4NQVB 3WFBH 4RBPH 1OSZA 4PJGA 4JFFE 5E94A 1JTOA 3VXSB 1RUMH 5EO9B 3GBML 3TIDB 4DGVL 3S9DB 3MXVH 3CX5J 3MNZB 5E2VL 4B53A 1JZ5A 3WNMA 4GAYA 1J7VR 5INCA 5DDHB 3H9SB 2VXQH 3GSUA 1GIGL 3GHBH 4ZNEE 5IVZA 3ZYZA 3VXQA 1FNGB 4JY6B 1MVUB 3LEYH 3ARFA 3GI8H 2BCKA 4Y19B 4XCYB 4PJDE 1UVQB 2R4SH 3HE6D 5K9KB 3ZTNL 3NBNA 2XV6B 4HMEA 4LRNL 3GSXA 4YZFE 5GGRA 3UTZA 4P2QA 3BWAA 3WNLA 5I15L 4LCIL 4FXKA 4W6YB 2VERN 3GBNH 1EZVX 5ILTL 5DZNA 3ALXA 5ANME 4HH9A 1JPST 2Z8VC 4M62H 4HIJB 5KS9A 2IG2L 2F5BL 4PGCB 2YWZA 1OY3B 1YEEH 4K2UL 3N9GH 1FNHA 2EDOA 5E03A 4Y5VA 5T1KA 1U8MA 3U6RA 3VFSB 4JLRA 3NTCH 4P23C 2ICEA 3G6DL 1AQDA 3E8UH 2BMKB 5E2JA 1LO2L 1GZPA 5H94A 2EIZA 4X5LA 4CVXA 1S78D 4TSCL 1FFPB 1HIML 3ZKQD 4OKDA 5K9JH 2NZIA 3U4BL 3JWOH 1NGWA 5J1AA 1QEWB 1OGAD 1IQDB 1XGTB 3S34L 1D9KA 2NY2D 4WFEE 4F9PA 1A0QH 1FFOA 3VJ6B 2GHWB 1OLLA 1MH5B 1VSCA 1FJ1A 3H7LA 1J11A 3QDJE 3I50L 2NY6B 5CZKA 1NAML 1UADC 1CR9L 3JBG7 2E9BA 4HX1B 4YR6A 5FV2A 2VL5A 4QHKJ 2FWOB 1UM4L 4U31A 1HSAB 1I8KB 3P0VH 3E3QE 1MQKL 4KTEH 3EO0B 3MBEC 1IAOB 3VXSE 2R0LL 3P9MB 3CVHA 2AK4A 1BBJB 1GJIA 4QHLB 2BRRH 1OAZH 5F89B 4XXCC 1FVEA 3H9SE 1D5MB 3IXAA 4DGYL 1TJGL 1DP0A 1IGJB 4Y19E 4AT6B 4WJ5B 2DM2A 4E42A 1FL6B 4C59B 1FH5L 2DBLL 4ZFZA 4AEHL 2J6EL 2DM7A 4Z0BL 1IM3A 1DLHB 2R2HA 2ZUQC 2C7UA 5BXFA 2BOBA 1KPRA 2YA2A 3HG1B 1KEGL 4ELME 4G6AC 2YHGA 3B43A 2W38A 3ECBB 3OXSA 2XQBL 3DV4B 5BO1L 1BD2D 1IC5H 2YD5A 3RPKA 3SGKA 2JK5A 3ES6B 3RNQB 2Y7QB 3F7VA 2YD4A 3VGEA 2RCSH 3MPCA 1LP9E 4K3JL 3VXTB 5CZXC 3DX9B 1JN6B 3L5IA 3WS3B 1CLCA 2NY0D 1GH7A 4UDUB 3C8KB 3A6BL 1H5BC 1U9KA 2AKRB 5F88B 5E2UH 4UIKH 4FZEH 2FX7L 1J1PH 3QNZA 3O6MH 2AXGB 1XF2A 5KVFH 4MDIA 4MJIB 1ZT4A 3MV9A 4RAVB 5SWZB 3DJ9A 3FB5A 3OKKB 4OUUB 4P5MB 4HJGA 2D7MA 1WLHA 4X0KB 1HXMB 4ZXBB 4CADB 3P0GB 5EZJA 4IRJB 4R3SB 4JJHA 4WCYH 4CU7A 4XNYH 3KPLB 4ELKA 2C3GA 3WN5C 4H88H 2Z31C 3F58L 2VYRE 4I0PA 4MQXD 4OKVB 2ARJQ 1LE9A 4NM4H 5AYQA 1RPQA 5K9QG 5CBEB 4JRXD 1FL3A 3MBXL 5EU5B 3BQUD 3RTQB 2AXJA 4IRSC 4E41E 2Y5TB 4R6UA 1YJDC 1YDPB 5HDQL 2Y23A 4LCWA 1N0XH 3X3FH 5JXAL 3V6ZA 5EORH 5C0FB 3RWCB 4RBPK 2C1PB 2PO6D 5FIEA 5IG7A 1B90A 1Q72L 5TDNA 3SQOL 1ZHBB 1TETL 3OAUH 1CGWA 3KGRA 3GJEA 5LGJA 3KDMB 2V7HB 3OPZH 5EOCJ 2J4WH 1QYGH 4KJQD 4NYLB 1QO3A 3PV6A 2YKLL 5GGUA 3HG1E 1Q0XH 4LLYA 5EN2B 5E5MB 4WFHD 3X11A 4YFDB 1AD9A 1MEXH 4AIXA 4JVWA 4Z7OE 2R2EA 4J3OC 4OQTA 3HZMB 3LS4L 1QFHA 5SV3A 5J13C 3MLTB 1I1FB 4H26B 2IWGA 1D5ZA 5IOPB 4P2OC 3RA7L 4U1SA 3TPUA 4U0QB 1QQDB 1MFBL 2X4PB 4DK3A 1GGTA 1KGCE 2Z91B 1T1WA 3ABZA 5ALBL 1MCIA 1JF6A 1QFWM 3NIDF 1MHCB 3L1OL 3HS0B 4Y0GA 5C0DA 4O2CA 3TV3H 5CAYB 5GS3A 1WBXB 4Y4HB 1M71A 1DBML 1CK0L 1A6WL 1LO0H 1JPGA 1A8JH 2HFGL 5AZ2H 3KPSA 1CBVH 4OM0H 4KI5E 4MJIE 1HH6B 5SWZE 4HKJB 1VACA 2Q8AL 4HUUA 3HFML 4JPIA 2YA1A 3RDTA 4EIZC 5FGBC 2OS7A 4G80B 4APQA 4HIHA 1UH2A 1A02N 2GJ6D 3NFPA 3MLUL 1QBLL 5I0DA 2QSQA 1RHFA 3PGCB 1WAAE 3FTGA 1PVHA 1ZTXH 2YSSA 5GGVH 4U7KA 4R0LB 5AUMB 2QQLL 2V5SA 2ZJSL 5FCSH 5D1XC 1U8KB 2Y07L 1ZLWK 3EYUL 5F9OH 1EUTA 2PR4H 3QXAA 4PR5B 4XC3H 4KGLA 1W8OA 2IFGA 2GUOA 5HHXH 5HYIA 3WS6A 4N1CA 2VL4A 3BIKA 3C09B 4NZUL 5DMYA 4MSWA 5GJSH 3T0EC 5DURB 3O8XD 2ZSWB 4L8BA 1WZ1H 3CPLB 1IGML 2IAND 1JNLH 1FIGL 1E6OH 1FNFA 1Y0LB 2CMRH 3C6LD 5MENE 5DI8A 1OAQH 4LRIC 4UDTA 3UAJD 1TJHL 2XOTA 4KK6C 5JW4N 5I18H 3H9HB 4P2RA 3UTPD 1ACZA 3T0BA 1G1CA 3VXMD 3UJJH 3T65B 3BKYL 1Z5LA 2AERT 4RISL 5DHYA 3S88L 4Q9RH 1OPGH 2CIIA 4XMLH 4Z95H 3MRQA 3QUYB 2UWEE 1T83C 1IGYA 3PXHA 2XA8L 3QUZD 3HB3D 3IFLL 4LEXL 1AY1L 3ULUD 1DBBH 1U6AL 1KJVB 2HLFC 1FLTX 5I66B 4LFHD 5T1LB 1PKOA 4ZFFA 4NKDA 1K2DA 4L4TD 3EDKA 5F72S 5CEYB 4KTDL 3BT2L 4QHMA 2V9RA 4YWGH 3FOMB 4LCUB 4M43H 2GJJA 4TTDC 4XC1L 2BVPB 5JW4M 2R8SH 1YN6A 3A6OA 3G5VA 2H1PL 3MV7A 4J7RA 4ESKA 5F7YC 5EULV 3NFNB 5JQ6H 1NGYB 3QRGH 5JW4Q 3I02A 3RWFA 3U46B 2OTPA 3G08B 5IHZA 3DSNA 3GKWL 2AW2A 5C6TL 3T77B 5C0EB 4M48H 1KCRH 4U2ZA 1U8PB 4PBXA 4JFFD 4HS8L 4YE4H 2I5YH 3DYPA 1NGQH 5T5FH 4KTYA 3EZ8A 4DN4L 3LSOA 1KCSH 5HY9B 5DJZB 2FR4B 3IKCA 1A7BA 1YMHA 3P73A 3TN0A 4F7EB 3NFSL 2Q7YA 4OB5L 3QQ4B 1KXQE 4DN3L 4EI5B 1IFHL 3IDIB 5ITFB 4UV4H 3P11L 1HSBA 3KNBA 2DTMH 3HLAB 1MRDH 4BK4A 4JFPB 5HI3C 3U1SL 4RGNB 4XNZC 3KJ4C 4Y5XC 4PTUB 5C9JB 4LAQH 1FZMA 5E00A 3OJMB 2A9MH 1MFEL 4FS0A 4XZUB 4NJ9L 3LY6A 5FUOH 1U93A 5MEOA 5J6GB 2Y25A 2XFXB 4LBEB 1IL1A 4U0RC 4MD4A 1ZVSB 4P3DA 2XICA 1TQBC 1AXTL 2VSDA 1VERA 1RUML 1U41A 3VFMB 3MXVL 5DQDH 3ARFC 1H3GA 3UZEA 1ZSDB 2VXQL 2WBWB 5C92A 3GHBL 5AD0B 2NYYC 2R9HC 3QEHB 2JE8A 5EBWA 5IBUB 1G7PA 2EDTA 3GI8L 3M8OH 3ARTA 1KN4H 2IAMD 4QXGH 3LEXA 3VI4E 3RVUC 1WT5A 1SY6L 1U8JB 4JO1H 1RJYA 3NH7H 3W0WE 2AVGA 4WFED 1EEQA 1RZGB 3FO2B 3OKLB 2HKFH 3WL9A 5DRZA 1II4E 1NBQA 1DLFH 3IDNA 3BPNC 3GBNL 3QDJD 1OW0A 2CRYA 2OYPA 5BOPA 3MUJA 2DS4A 4P5TD 4Y16D 4ZDHA 4M62L 1ZA3A 1YEEL 3N9GL 4AIZA 3HA0A 3BEVA 5FEBA 3PF2A 4NQTA 5DMGD 4UBDC 1L7TH 4OZGB 3NTCL 1JK8A 4G5ZH 4KKCC 1EUUA 5ESAB 4MB3A 3E8UL 5ICYA 4U4BA 3BPCB 3VXSD 3HRZA 3OKEA 3RIAK 1HH9A 3W11D 1D9KC 1YEHH 2BVQB 4I2XA 1ZVHA 3K81A 5K9JL 3JWOL 4OLXH 4F9PC 1CLYL 1LMKA 2P8PB 3D39A 4RFEB 4W6WB 3QISA 5IHLB 5DQJA 5C0BA 4Z7VA 2R0KH 3QCTL 2QEJA 1A0QL 1BOYA 1EJ6A 2BY1A 1NGPH 2Z4QB 4HUXA 4XWGH 4XPGH 1INQA 4RGNE 1L9MA 4LLUA 3QWQB 2RFXA 5KANG 3SE9H 3P4NB 4PJ7B 1G6RB 1CFQA 1U3HD 3FQTB 5D9SB 1JMZA 3QIWC 2P43B 5J1SC 3OR6B 3ZE0F 4MNHA 4KTEL 3T04D 5FO9B 2XG4A 3ULVF 4MWFB 3N85H 3FFCA 2BSSB 3FQNA 1DSFH 3O2DA 2W60A 5C0JA 1A6VH 3EOAB 5GS0H 1S8DB 2BRRL 1OAZL 3RWEB 2VISB 4UQ3B 5SWSA 3U0PA 2W1NA 4H0GA 1BEYL 5HYJA 4GKNB 1REIA 3GMRA 3ZE1F 4X9IA 1DN0B 1U2CA 4JREC 3NIFE 1QLRB 4MXQC 4PJBA 2ICWB 1A7OH 3TIEA 1A6PA 2ICWJ 1B2WH 1TTGA 5DK3A 4PGJA 2ZUQB 2OR7A 4PGBA 5FYJD 1EDQA 1I3RB 4LLVB 1FFNB 2R2BB 4OV5B 2VOTA 4X4ME 4F57H 1Q9WB 5D7JA 1IC5L 5F97E 1C12B 1GOHA 5GGSB 1J8HB 2BNQD 1YC8A 1UZ6E 2RCSL 5C07D 2APVA 2ARJA 1NGXB 1WEJH 4E41D 1F4YH 4KROC 8FABB 3VW3H 4JFDA 1HDMB 2CXGA 3IXTA 3LKSA 3X13B 4K07A 1LEGA 3E6HB 3BRFA 5E2UL 4UIKL 4FZEL 4H8WC 1J1PL 2D2OA 3O6ML 4G8GE 4E5XB 3MGTA 4WUUE 1NJ9B 2QADC 3U2SB 2R23A 3DHJA 4M4PA 1T6VN 1VFMA 5ID1B 3LH2H 5HBBA 3BIAX 1TCRB 4I0PC 3CUPA 3MNWA 1J10A 4PJ7E 3HG1D 2I9TA 2XWJA 4WCYL 1MI5B 1T3FA 2OMNA 1BZ7A 4XNYL 5DJYA 4H88L 3WN5B 2Z31B 5FA3A 3DVIA 4M8QB 1SYSA 3AUVA 5DSCA 3DX8A 4BKLB 1RZKH 3BD5A 4IBLT 5CZVH 4PV9A 2J8OA 5E4EC 1CIDA 4HLJA 4NM4L 3WIHH 3MR9A 3WLWC 1XR9B 4GUPB 1DANT 1KGCD 4IRSB 1RU9H 4JQIH 7FABH 3T8XA 5DFVC 1LVEA 1O7SA 2JCCA 4NRYA 1N0XL 1XF5B 3X3FL 3E6FB 5EORL 1K8IB 5DUMH 5FA4B 5H35A 3OAUL 4JKLA 1F3RB 4HD9A 5DMIH 5HHVH 1A9EB 1MY5A 1X5GA 5IB4A 4WTXA 5LWYH 3OPZL 5EOCH 2J4WL 1QYGL 3CX5K 4YBQD 2UV3A 4KI5D 3ZSTA 1F42A 4MJID 2X2YA 5F7NC 3G04A 4Y7MA 5IIEB 1Q0XL 4AEIH 3BYTA 4V2CB 2A83B 5SWZD 4XP5L 4G7YH 4X7DC 1MEXL 4R2GD 3UYPA 3DIFB 4S2SA 5I9QC 2EKSA 4XB8A 4I8DA 4Q2ZB 1N3NA 5J13B 2IADB 5BVJB 1X4ZA 3V9FA 4P2OB 1CWVA 3LRHA 5I1DB 1T89A 3NVQA 5HHMB 1QBMH 1J8HE 4U1KB 1NKOA 1F4AA 2YEZB 3CX2A 2EH8H 4PPTA 4YIQB 4J8RB 1J87A 9CGTA 1X5XA 1IKFH 2CR3A 1BLNA 3MA9H 1EBAA 3L6FA 4PJFF 1U91A 4KPHH 5DC9B 3TV3L 1MHEA 2VLME 2EDBA 1ZWIA 2EIDA 3AB0C 1EMTH 1LO0L 5AZ2L 1RJLB 1JV5A 4FQJH 2AJYH 1BVZA 1BQHA 1CBVL 5C1MB 3MOQA 1RIHH 5ID0B 5GSVB 5C0AB 1EFQA 3WD5H 5IGXH 5KTEH 4O2FA 4Q58C 4NRZA 2PN5A 1FO0A 4S1QH 3B6SA 3RNKB 1MI5E 4MQSB 4W4OA 5D8JL 5MEND 3JWDC 1KXVC 1U8LB 1DZBA 4G9FA 3HNTL 2BNRB 3PDGA 4LPVA 3SQBA 2AABH 4M4RA 1PZ5B 3GMMA 5DF0A 4ZUVA 4M02A 5B38A 1XIWA 3VWKC 1ZTXL 1Z0MA 1PQZA 1Y6NR 5GGVL 1A1NA 4DUWA 3GSWB 3OAYH 3IDYC 3RX8A 2VDQH 4OZIA 3KPRA 5F9OL 3GK8L 2PR4L 1S7QB 3KHOA 3HUJA 4V1DA 5GIRA 3WS6C 4XC3L 3SKNA 5LVEA 3W82A 5IR1B 2FSEB 3QPQC 1NDMA 4UU9A 2RR3A 5D1QD 5HHXL 1H3XA 5FB8B 4HK0B 5GJSL 4P99A 3T0EB 4GXUN 1KTDA 1QPPA 1WZ1L 1JNLL 4R7DA 1E6OL 2CMRL 3HZYB 4TNVK 1MNUH 3DV6A 1T2QH 2V2WA 5A16B 1PY4A 1ZVYA 4KK9C 1OAQL 1LE5B 4QRUA 2HH0H 5I18L 1EA9C 4PRBA 2AJSH 32C2A 3VGGA 2IPKB 2FJHA 4D94A 2DI9A 1CZ8H 4K8RC 5JW3H 3UJJL 3OKDA 1WTGT 1RHHB 3MFGB 4RRPG 1OTUD 5TPWH 4OLZH 3KPNA 4Q9RL 1JGDB 4XMLL 4Z95L 5ESQB 2UVEA 5IB5B 1AO7B 1Z9OA 1P7QB 3TA3A 3TH2T 2ZCHH 1OAUH 1N5AB 2CK2A 2OXHA 3D69B 43C9A 2R0ZH 3GZKA 5HI4D 1V3JA 5I8EA 1DBBL 4OZ4B 1N5YH 1R5VB 5M94B 4ZO8A 1PEWA 2VSCA 1YQ2A 2E6QA 3K4ZA 4GXUM 4P9MH 2L7UA 3AS2A 3LQAH 5ABDE 1Q9KA 4JFQB 1KBGH 5JIKA 5C0AE 3ZKMC 3VDBA 2HRLA 4YWGL 1BFOA 4FQXA 1ZKAA 1JYXA 4CW1B 4M43L 1UZ8A 4RNRB 5DURD 4G8FA 3BDXA 1FSKC 5IMOA 3V6OE 1PSKH 4YDIH 2V17H 3SKOB 5I30H 3D87B 2C3VA 3NPZB 2BNRE 5JQ6L 1CFSA 1BVKB 3QRGL 3QZWA 2FL5A 5EBLA 1EPFA 3QXDA 5IQ9A 3M07A 3FO1B 5KN5A 4ALAH 2CIKA 3RWJB 4GO6B 5D7LA 2HFEB 4N9GA 4X99A 4YDVA 4HZLA 5ADOL 4M48L 1KCRL 1YEGH 3QDMA 4GRLD 1AR1C 1H3TA 2I5YL 4NPYB 5FF6B 3QUYD 5T5FL 1LK3H 4NQSA 3SE8H 1MCQA 1KCSL 3CMOH 4X80H 2YOCA 4PRHB 2HT3C 1CE6B 5KSUB 4U7MA 1EAPA 1L7IH 5T1LD 1T1YB 3D85D 2FZ3B 4QYOB 3TVMA 3P4OB 2LAGB 3GMLB 5HDBF 1FHGA 2DTML 2GITA 3GSQB 3RJQB 3W0WD 4R4BA 2EH7L 4NUGL 1MRDL 5T3XD 4XNZB 3KJ4B 4C55A 4LAQL 4RZCB 4DFIA 6FABH 1UM6H 2A9ML 5CP7B 1EFXB 4LNRA 2NR6D 4Y8AA 3BZEA 4PGDA 2VQ1A 5FUOL 1BPVA 4GRWF 3F62A 3AS3A 4U0RB 1KLFA 3UTTB 1YEKH 3VDCA 2XZQH 1TQBB 4K7FB 1SYVB 5IMMA 1N6UA 3A0OA 1AO7E 1BOGA 4RIRA 4RA3A 4RWHA 4ZFOB 3NABH 3VXQB 5DQDL 1MJJA 5IW1B 2XKUA 3ARFB 5A3ID 3MLYL 2VDRH 2BCKB 3N1FC 5F9JA 4IOFC 3B9VA 5D7IF 3UTSB 3NN8A 1C5CH 3I2CH 3M8OL 4YXHH 4P2QB 2QR0B 3NCYS 4QXGL 1JGUH 4L3EB 1MCWM 4FXKB 4JAMA 3FFCD 4WTWA 3NH7L 1WISA 4M3KB 5FK9A 4EI5D 1OW0C 4RMTA 2WQ8A 3MX0A 2HKFL 2IH3A 4HH9B 5SWSD 2AI0H 5KS9B 1DLFL 3BPNB 4LCCC 3FQWB 2X4SB 1AGFA 4RGND 5HYJD 4LVOC 4JN2A 1U8MB 3MRMA 3U6RB 4ZYKB 3RWIA 2A74B 4JLRB 2EKJA 4JFYB 1YPZE 2ICEB 1R3KA 1BQHG 1DUZA 1KUMA 3DRQB 3GM8A 4X6DF 5IKCB 1A9BA 3EFFB 1GZPB 1L7TL 3IFOB 2NXZC 4G5ZL 5D5MB 1SMAA 5AAMA 5IEKB 2NY3C 3VXPA 1IQWH 2NTFB 2IH1B 3ZKND 5C2BH 2YBRB 4PD4J 1F4XH 1D9KB 3QIUA 4MJ6A 3MRCA 4OLXL 1FFOB 1KB5A 3NA4A 3DURA 4PRHE 4FA8A 5HGAA 2DN7A 4AL8H 1FJ1B 3HI1B 2Z93B 5IBLC 4DWHA 2R0KL 4HIIA 3BKMH 5DEFB 5B38G 3OAYK 4YPGB 1V05A 5DT1H 4PJEA 1NGPL 1UKQA 4XWGL 4CU8A 4XPGL 4L8CA 1G6VK 4YR6B 1YA5A 4QRTA 3P4MA 5JHLH 4NBXB 4U6VH 4LVHC 1G6RH 4YHPA 3QIWB 4X6CE 3UTTE 4NHUA 4HPOH 1OQXA 2AJUH 5FDYA 3N85L 1EH9A 2Y06H 1U8NA 3IXAB 1DSFL 1A6VL 1I1YA 4X9GA 3KAAA 1MY7A 4PJIB 5ISZB 2JB5H 3UTSE 5FYKE 3QEUA 2ED9A 4KMQA 3BUTA 2E6PA 4U05A 1TZIA 4ETQA 3MRPB 4L3EE 4JREB 2C7UB 4O5LH 1UWEH 1KPRB 1A7OL 4OLUH 3QDGA 4G8GD 1B2WL 4WUUD 3QFJA 3ZZ1A 3DXAA 4QWWD 4H0HB 1WFUA 4CDHA 5EU6A 4LSUH 1DQTA 2DDQH 1A1MA 4YFLI 3VGFA 2BFVH 3C60A 3O45A 4MD5A 3RWGA 5FGSA 3C8DA 1YY9D 3D1MC 1TNMA 3KPOA 5HVHC 5CWSA 4BH7B 4ZAKB 1F4WH 3ARZA 3PGDA 2F53E 4F57L 4Z78A 3FQXB 4Z18A 1QSVA 3VFUA 1G7LA 3N50A 2A1WH 4HWBH 5I0ZA 3DUUA 3ZDZE 1DVFD 4X98A 4EVNA 5D5ME 3QH3B 4AY0A 2Z35B 1TNNA 2NMSA 1X6NA 1WEJL 3IETB 1F4YL 4KROB 2NX5A 1SBBA 1CVRA 2C1OA 3QNZB 1XF2B 3LKOB 2BSTA 1ADQH 4MDIB 1X5ZA 3QZWG 1GZQA 4HJGB 4FXGB 3HC3H 5GS2D 2QADB 2C26A 3PWPB 4FFYH 1D6VL 2ZZUT 2XY2A 1I4FA 2H2PD 3FRUA 4JFEA 1NCUA 3UJTH 4F7PA 3FHAA 3LH2L 4I0PB 4NN6C 2W9DL 1HHGA 4QLRA 1LE9B 4G6AD 1WWWX 2C5DC 3MACH 4NDMA 1PG7H 1FL3B 5CZVL 1QG3A 1JTTA 5DK2B 1U3YA 5E4EB 3WIHL 5J9PA 1YN7B 3D9AH 3LDBC 4EZMA 2G75A 4UOW0 1J8HD 5FECA 4LCWB 2E7CA 3AU1B 2IBBA 3MQIA 2H41A 1OD7A 1RU9L 2VN4A 2YD6A 4JQIL 4MJ5A 5CZXD 4UT9H 3MLRH 7FABL 1BJ8A 5HI5C 5BJTA 4PJIE 1YJDH 1QA9A 5ISZE 4JG1H 1S7WB 1RY7B 5DUML 2VLMD 5GZOC 3PV6B 4JM2D 4XTRD 3OKMA 5DMIL 2EDLA 5E6YA 5LWYL 3X11B 5EOCL 2R2EB 4XP6H 1FYTA 4AEIL 4G7YL 1KNOA 4RDQG 1D5ZB 4AEFA 3V4VH 5I9QB 1T89C 4GS7C 3TPUB 1MI5D 4JY5H 3ULSA 4FXLA 3ESUF 4NC0B 3K4AA 1JUFA 4GFTB 1QBML 2LE9A 3DX6A 4XNXL 1XF4A 4PP2A 1BZQK 5C0DB 4O2CB 5E6ZA 5CD5C 1IKFL 1M71B 3MA9L 3RJDA 2X4RB 4IRSD 4PG9B 4YBLC 2D7NA 4KPHL 1JPGB 2AJVH 3KPSB 4HT1H 3ZMRA 3O2WL 3AB0B 1MRFH 1EMTL 5J06A 4KK8C 5IVXF 5J3HC 1VACB 4FQJL 2AJYL 4JPIB 5ECJE 2V5YA 1RIHL 3BSZH 3PWPE 1RSFA 1QFUH 4HIHB 4W4OC 1HQ4A 3WD5L 1XCQB 5IGXL 5KTEL 4YC2C 1MFNA 4HWNA 3SDAD 1WCBB 1Y18A 1QPXA 3IDUA 4RMUA 1JYWA 2AAVA 1SEBB 2ZCLL 1RK0A 4CAGA 3DGCR 2YSSB 4LLQA 2WINA 5I73C 1CD9B 1CL7L 2X05A 2F5AH 3VWKB 4OSUH 4B0MM 3PABA 4LPYA 5F7MC 3HRPA 2IALB 2P7TA 3IFPA 1HYRC 3HPJB 2YD2A 3RUGF 3IDYB 2VDQL 1XF1A 4L9DA 5C09B 1QZ1A 4WHDA 1KIRA 3ZDYE 4X83A 2G2RA 4UNTA 3AMLA 1MIEH 2D31A 3SO5A 3BIKB 5C0GA 4L8BB 1UH4A 5I1GH 4L4VA 4K3GA 4KVCH 4CVZA 4N90E 5DI8B 5HGDB 3RZCD 4UDTB 1F3JA 2OQJA 3QEQA 5GJTL 5CMAB 5C0AD 3H0TB 4R90H 3DROB 3W9EA 1MNUL 2BJMH 3IF1B 1T2QL 3ARBD 1CT8A 3RP1A 2DM4A 2HH0L 4C57C 2AJSL 3KXFB 4FZ8H 2VDPH 3LCYA 2XPGB 4OLEA 3BP4A 1CZ8L 2YA0A 4KK5D 5DHYB 3L3OB 5JW3L 2BNRD 3R8BB 5EC2B 3D2UB 3MRQB 4XNMA 4G43B 3TA3C 3BUYA 5TPWL 2P5EA 1KG0A 2HT2C 1NC4B 2H32B 1RZJC 4RGMC 2P48B 2ZCHL 1OAUL 5CGYC 2Y5EA 4MJ2A 3MJ7A 2R0ZL 4KRPC 1JFQH 4WTZA 4ZFFB 1K2DB 1R5IA 3FFDA 3SKUD 1N5YL 4QHMB 4FQXC 3A6CH 1AI1H 4BFGA 3CSYA 4P9ML 1QLFB 1KELH 3LQAL 4XVTH 1KBGL 4HFWB 2VR5A 3MV7B 4K3EH 3L95B 4Z9KB 4HH8A 1UXSB 2CJUL 4KKBC 4NO0A 1G7HA 1FSKB 3SBWC 4HC1H 4FFZH 2AQ1A 1PSKL 5I30L 1EHNA 5CJXA 2VN7A 4NQDA 3HI5H 3Q6GH 3ZT5A 4HK3J 1I1AA 3MRGA 3V0AC 3VFRA 3OWEA 1KOAA 2H3NA 2ZSVA 4K7PH 4ALAL 4HAFA 4WW2A 5C09E 5B3JE 3LSOB 1N59B 5E99L 5TE4H 2OL3L 1CDIA 1P4IH 1AO7D 4UT6H 1P7QD 3SE8L 1JWSA 2D7PA 3CMOL 3ARQA 1SJEA 4JDVA 4DVRH 2Q86A 3TVMC 2YC1B 5LGHH 5TDOA 3RIFF 3KNBB 1L7IL 2HLFD 3KLHC 3ZYOA 1I1RA 4PFEA 3IDJA 3S5LA 4NNXB 3IAPA 5DEGA 5E00B 2AQ3A 2EE6A 5DUBB 4M61A 5LCVL 1DQJA 1BIIA 1U93B 1KPVA 4TN9A 3PHOA 6FABL 2BXYA 2HAZA 1UM6L 1IL1B 4MD4B 3KXFE 2XRAH 2ZOKA 3PWVB 4LDEB 4UUJB 5C0RH 2DICA 2UZYB 1YEKL 2XZQL 3JSSA 2AV1A 1CN4A 2OM5A 2PTUA 3OKNA 5I1IH 4RMWA 4EDXB 1H0DA 1BQLH 3NABL 5EUKB 1U8QB 3LPGA 5IFAL 5EBWB 3SKMA 1G7PB 2VDRL 2BZDA 4B5EA 3L3JB 3LMJH 5IB2A 2FGZA 4OTXH 1C5CL 3I2CL 3QA3B 4YXLH 4YXHL 5FYKH 4PJ9C 1JGUL 2EEBA 4PRHD 1QD0A 5JR1H 3STBA 3V6FA 5FUZL 4NBZB 4XPHH 3B9AA 4N8PA 3S3JA 2N1KA 4ZDHB 4MCYA 2AI0L 4MS8C 2CO7B 3DUSA 1JWUB 4LCCB 3V5HB 5CILH 4WFFD 4AIZB 5HI3D 4I3SH 3DARA 4LVOB 1NFDB 1AQKL 5JORB 1EFXD 1AXIB 1JK8B 2PETA 1JZ4A 4QHUB 5ICYB 4XPAH 5DQ9A 3T3PF 3HRZB 1UACH 1VESA 3UTTD 2NXZB 3BP5B 2Q8BH 1JMXA 1FNSH 1EERB 1DQDH 4I2XB 2NY3B 1IQWL 3LOWA 3UBXB 1Q94A 4EXPX 1F4XL 4Z7VB 5DQJB 5C0BB 2V2TB 4XVUC 3K2UL 4H1LB 5MEPA 1AD0A 4K9EL 1V7MH 2NYYD 3UTSD 3KPPA 4PG2C 5EBMB 4AL8L 4HUXB 2DD8H 1TVBA 3BKML 1INQB 4CUCA 4L3ED 5DT1L 1VGEH 2RFXB 4I5BA 2P8MA 1FFQA 5HPOA 3J7HA 5BZWA 5GRVK 5CFHA 3BAEH 1T7YA 4PJ8A 3AVEA 4NWTH 4U6VL 3FOLB 5AZEL 4WNQA 1PLGH 2BVTA 4LVHB 1G6RL 5C2UB 1NMAH 3HZKA 1DQMH 5L2KA 4RX4D 4K94C 5C0JB 2F53D 2W60B 4HPOL 4WUKH 2AJUL 2FECI 3U0PB 2Y06L 4KKAD 3ULUF 3BX7C 2Y36H 1RVFH 4RSVA 3RWDA 4KKCD 2X1WL 3OAZK 1CTOA 2DYPA 1CDCA 3FB6B 3RL1A 3W81A 2JB5L 1HEZA 3TIEB 1J0IA 4D0CA 2VITB 4OFDA 3MGOA 3HZVA 3DBXA 4O5LL 4PV8A 1UWEL 3RPIA 1IAIM 4PGBB 4Z7UF 4OLUL 4KH2A 1I85A 4NO3A 3C60C 4TUOA 2LTQC 2OZ4H 2ZWLT 3GUTA 3GGWB 3ARYA 2LABA 4PJHE 4WRLA 4LSUL 1KT2A 2DDQL 4QRPA 4XBGA 4LPWA 2BFVL 4GG6B 4FTVB 4BFBD 4WTZG 5HVHB 1NFDE 1OF2A 4WI5A 4F15C 4J3VA 1F4WL 1NC2A 3O3EA 3KLAA 2JJVA 3L7EB 2VIRA 2X89D 3C2AH 2KKQA 2A1WL 5A1AA 2KZ1B 4HWBL 2EIEA 4OD2A 4NO2A 4PRNA 2BHUA 4WEBH 3RVWC 4M9PA 3S4SA 1P6AB 2CDGA 4K7PX 2JTDA 5DRWA 2C4FU 2F54E 4U1GC 3LB6C 2DLGA 5ISZD 3WKNA 1MJ8H 2R23B 1NLBH 4YZFF 3U7YH 3HC3L 4H8WH 4F80A 4HXBH 1XGQA 3MYJB 4MXQD 3CUPB 3MNWB 3QULA 3LVEA 2I9TB 2XWJB 3UJTL 1T3FB 1BZ7B 4NN6B 1SYSB 5DSCB 4PY8J 1T66C 2ZNWA 3DX8B 4LPTA 5F1IA 4LGSB 4Y2OA 4PV9B 1NEZA 2HA1A 5J7CC 4G42B 1NCAL 3RKDC 3H9YA 4G9DB 5IHBA 3MACL 2B4CC 3OQ3B 4ZAKD 1QFPA 2GTZA 2HP4A 3SE4A 3D9AL 3LDBB 3F12A 5F1NA 2PXYD 4JZOA 1ZT1A 5FKAB 4NNYA 3MLWH 2APFA 3T8XB 3S5LG 2JCCB 3TBTA 4NRYB 1KCUH 5JO5A 1XZ0A 2P5WD 3BGAA 1G7QA 3MRJB 1S9WA 4UT9L 3MLRL 4MB4A 1YJDL 2ESVA 4LSVH 1HILB 5TE7H 5EZIH 4CMHC 1IVLA 4Y1AA 4M5ZL 4ZTOH 2VXSH 1XF3B 1HHJA 1ZLVH 3RY5A 3QWOA 1UCBH 1QFOA 3DX7A 4UZGA 1P5VA 2QADD 4JVPA 4S2SB 4XP6L 1JNHA 4CMMB 4P57A 5L9DH 1K8DB 3LRSA 3TC9A 4GG6E 2DQJH 4FTVE 2ADGA 1I7ZA 4GS7B 5EA0H 2VLJA 4JY5L 2F74A 2P42B 3TCLA 1S7TA 5HGBB 5EU3A 3O11B 2O5YH 1P84J 1BLNB 3L6FB 1U91B 4ORZC 1MHEB 1MLBA 5HHNB 4Z7NF 3C5ZA 5IBTH 4YBLB 3OXRB 1VFOA 1HHKB 1HQRA 2AJVL 1BQHB 4HT1L 4Y4KB 1MRFL 1T7WA 4OCWL 1J05A 4LLDA 1IAKA 1IGTB 2R1XA 2XYCA 1WBYB 3O4LE 4O2FB 3F7YB 4JCLA 1AGEB 1CD8A 3BSZL 1AXSB 4DQOH 1FO0B 4XI5C 1DN2A 2CLZA 4F9LC 1G7MA 4ELMF 3VGBA 4HJ0C 4YC2B 2NY1D 4N90D 2WMPA 4PD4K 1P4BH 5EO0B 1EX0A 3K80A 2I07B 3VXRD 3T2NH 4IMLA 1DQQB 1E4XH 2GCYB 3GMMB 4WI7A 4XBEH 4ZUVB 1FNLA 3JWDH 3QHZH 3VFPA 4PRAB 1PQZB 3MV8B 4KMTH 5I73B 4M1CD 2H2SD 4GQ9L 2F5AL 1G9EA 1H3UA 4XP4H 3MMEA 4OSUL 1LP9F 1EIBA 3QDHA 1FZKB 4OQ1A 3HUJB 1C1EL 3SKNB 3QUKB 5JLZA 4X5WB 5JHDB 3IKKA 1MIEL 1PW3A 2PYEB 1DEEB 4NQDD 2HVJA 3QIBA 4IOSD 3PE9A 4GLRH 1CXFA 1JNJA 4IJ3C 5I1GL 4P4KA 5KOMC 4YK4C 4KXZI 5EIIB 4MNGA 4QHKI 1CS6A 5I1LB 1I8MA 4R90L 2BJML 1RUKH 1NMCB 3BO8A 4PRBB 1EZVY 2EXWD 32C2B 2GAZA 2FJHB 1P7HL 2EDJA 2OJZH 1JGLH 1DDHA 3OKDB 1A21A 4XB7A 2Z92A 3AREA 1XGUB 4FZ8L 1P7KA 2JB6A 3KPNB 4PJAB 2GTWA 4NCC2 3H42L 1MCWW 4K8RH 4R7NB 4HPYH 4HG4K 4ETYA 1WVZA 1DANU 3TA3B 3BXNB 5GGTA 1SQ2N 3VWKD 1BX2A 4DKEL 2Q20A 43C9B 2PTTA 1KJ3L 3U7WH 3R1GH 3OX8B 4RGMB 2H32H 5C09D 5BVPH 5I8EB 1CE1H 3CNKA 3KHQA 4KRPB 1JFQL 4PUBL 3GFUA 1M4KA 4FQXB 3A6CL 1AI1L 1ES0A 3QPQD 2DQUH 1KELL 1EGJA 1NAKH 4G8FB 4NBYB 4K3EL 2HVKA 4H25B 1LO3L 4Z7OF 4J4PD 2FEEL 2C3VB 1NL0H 2DWDA 4OFKA 3S4SG 3I3DA 4FFZL 4ONHA 5F8QC 3BP7A 5HHPA 1LEIB 3RVVD 4RMRA 2YRLA 3WV0A 1W72A 4JQVA 3QZWB 5EBLB 3QXDB 5IQ9B 5BRZB 4U1LA 3HI5L 3MV8E 5KN5B 2CO6B 4NHCL 8CGTA 4X99B 4F58H 4P3CH 5JNYB 4PJ5B 4YDVB 4HZLB 1JYNA 2LVCA 4K8RD 2GKIA 4K7PL 1K3ZA 3D2UD 2IF7A 1H9VA 3HUJE 1QSFA 3KYMA 5TE4L 1NC4D 1P4IL 5JDSA 5JHDE 3KG5A 4UT6L 2CDFA 3H3PH 1NEZG 2PYEE 4HCRH 1EAPB 2GFBB 4U6HA 4DVRL 4KI5F 1A3RL 5FGRA 3WFHA 5LGHL 1A7PL 1EHAA 3X14A 2OSLA 5D96C 3MRIA 4AM0B 1EO5A 4N5ED 4JRYB 3CDGA 2APWA 4MQ7B 4Z6AT 2O61B 1PFCA 5IMKB 4L5FL 4LNRB 2AXFA 2X4NB 1JGEA 3V8OA 2JIXD 3CC5A 1SVCP 4QRRA 1WAAF 5J6HA 1JZ3A 1ZLVK 4PJAE 3DUHA 4NFDA 1BOGB 4RIRB 2XZCH 2W9EH 5I1IL 2Q3AA 4NUJB 4TVPD 4FQ2H 1BQLL 4HWZB 2OR8A 2E9JA 1ITCA 3NN8B 4ZFOL 1QACA 3LMJL 3OKYA 5EFIA 5JPMB 4MX7A 2EC8A 4OTXL 2UY6A 4YXLL 2R69H 2JJWA 5FYKL 1LO5B 4PJ9B 1JPFB 2VR4A 4WW1B 5JR1L 3UYOD 4KC3B 5E8PB 2E7LA 4IDJL 4XPHL 3IJYA 3GJFB 2NY5C 5DJ6B 1TENA 1ED3A 1P2CB 2ITCA 3PHQA 5DD0H 3SGJA 5CILL 1R3KB 1JZ7A 5BRZE 4I3SL 1DUZB 1I3GH 2R1YA 1A9BB 3VXNA 4PLJD 4PP1D 4PJ5E 4MZ3A 4PJFA 3VFVA 2VB5A 4O58H 4X4XB 1DQLH 3MUHL 5I1AA 2WLYA 4XPAL 1LO4H 4Z0XB 1UWXH 1ZHLA 4N0RA 1BZ9B 2UWEF 2FH6A 2Q8BL 1FNSL 4QRPD 5JMOC 4XNUL 1KB5B 1G0XA 1GRWA 1D5BB 2HJKB 5LJYH 4BM7A 3MLVH 4TYUA 3PNWB 5FHBH 2NNAA 4QOKA 4BJLA 5C7XH 3MRDB 4H1LH 2NW3B 4X9FA 4ZQKA 4PJEB 3V5KB 4Z76A 4O02H 4DAGH 2DD8L 4L8CB 3CZFA 2QLVB 4JRYE 1CFTA 25C8H 1VGEL 5DS8B 1J1OL 1PEZA 5I19H 4QRTB 4HGKC 1T0MA 3SGEH 1CL7I 3BAEL 4GW5A 2GSIB 4UOJA 4NRXB 1KCVH 1CQKA 2KBGA 4YUEH 4NHUB 5GSRA 1PLGL 1NMAL 1DQML 5BQ7B 2B0SL 1LHZA 4I3RH 4YEEA 3JVGC 4WUKL 4TUJB 3ORJA 4PLNC 2Y36L 4NKMA 3EDFA 5FAAA 5DJ8A 2RBLA 3BDYL 3G5YA 4H20L 4EKXA 1KN2H 5FOBA 4OT1H 1I85C 1KJMA 2HT4C 3CFKA 2YRZA 3QFJB 3MV01 2F54D 3G6AA 3EUUA 5IBLD 1MCSA 3C60B 2A0LD 2LTQB 2OZ4L 4PJCE 1A5FH 3VFOB 3ZKXC 5JXED 3KPOB 1QSEA 5F3HB 5CWSB 3MRFA 2HRPH 5EO1A 5GRZA 1S9XB 2HJFA 1IEAA 1X7QA 2EYRA 4U1NA 4XGZA 1G7LB 1BWWA 1E27A 2YD9A 2ITDA 4F15B 4GSDH 3QNXA 3AS1A 4L1HA 1GVIA 4WHTB 1T1XB 1IILE 4X98B 4LSTH 4DVBB 1D7FA 3OJDB 5D6CB 3OB0K 5TFSL 3MREA 4HEPG 4Y89A 4D8PA 4WENB 4F33B 2OX5A 2XN9B 3RBSA 1PD6A 2NX5B 5IMLB 5IM7A 2AS5M 1S7RB 2EZ0D 1OP3H 5SWQB 1H8NA 4G6FB 5B39A 5L8KB 4XCEA 1F11A 3MNVA 2BOCB 3QBTB 1S3KH 4KZEH 5JW5A 4N8VA 1TVHB 4L3AA 4MAYD 2QBWA 1O7VA 4U1GB 1CFVH 3PL6A 4PJEE 1NLBL 1I4FB 4XNQA 4KI1A 3U7YL 4F7PB 3DMMA 4HXBL 1S9KC 1EEYB 2XT1B 4NQEA 4I13B 5F7HA 5CSGA 4MNQD 5C0ND 3MUZ1 1M7IA 4J3UA 4YJZL 3GIZH 2A6DA 5I8KH 4FTVD 3SE4C 6CGTA 5J9PB 3GIVB 1RK1A 1MCJA 2G75B 2VABB 3KWWA 5FECB 4U7SA 1A2YA 4MJ5B 3WO3B 3MLWL 3VCLB 1I1CA 2GK0B 3CK0H 1LQSR 4ISVA 5BJTB 2DLIA 4HEME 1WTLA 3SJVB 1OARL 1KCUL 3ZE2F 3AM8A 4OF7A 5E7FA 3OSKA 2DJSA 3LQZA 3WUWA 5E8NA 5TE7L 4LSVL 3MXWH 5EZIL 1B0GB 3INUH 1QRNA 4CMHB 1T5WB 3OKMB 4ZTOL 2VXSL 2A6KB 4JB9H 1EAJA 3VXOA 3MZGB 3OBAA 1UCBL 4HLZH 2YD3A 5KG9A 2H6PA 2AJZA 3M1BB 1ERNA 1KNOB 1QFWH 2X70A 4JR9H 1NCTA 4J3XA 3O4LD 4KQ3L 2VQUA 5KSAA 2CLRA 5L9DL 4HFUH 1CGUA 3SPVA 2DQJL 2P47B 2VZOA 2WUBH 1IM9D 5EA0L 1XMWA 2CRIA 1XF4B 3CFIC 5CIPB 1KCKA 4GW4A 4CU6A 4ONOA 1G7JA 2O5YL 3QI9A 5EPMA 3C5ZC 2XN9E 2OJEB 5HGHB 3U0TA 1S9YA 5C0CE 4Q74A 3FAWA 4UOW1 1EK3A 3RHWK 5IBTL 1QRKA 5T1DH 3H3KA 5IT2H 3BJ91 4KJPD 4WWKA 3D48R 4JDZA 5L2JB 4LP4A 4ZNCD 5HI5D 3NIFF 4KRMB 5JOFA 2DQIH 2XQYG 3C5SB 3PQYA 1AKJA 2OR9H 1BWMA 4HAGA 3MYZA 3BVNA 3BHBB 4JPKH 4DQOL 5GZOD 1IGFH 1XR8A 1UQSA 1JVKA 4OCRH 3L3DA 4D2NA 4K3HA 1FO0H 3BZ4A 5DGRA 4NP4H 3BMWA 1P4BL 4X6DA 1S7UA 2Q76A 3OG6B 2BVUA 4KJYB 4LLQB 3IVKA 3T2NL 1OSPH 4P46C 1E4XL 3GHEH 2P45B 4XBEL 2IC2A 4LEOA 2ZUUA 3JWDL 3QHZL 4KMTL 3S96A 5ESVA 3Q1SH 2YPKA 4XP4L 1UKTA 3MRRB 4UT7H 2ENSA 1KIRB 1P1ZB 5KVGH 3SJVE 1JPTH 2G2RB 4XP9H 4WO4D 4EQ3A 1ZS8B 5JPNA 2VXTH 4B7IA 1WJ3A 4HGMA 3QIBC 5C0GB 3OR7A 2BDNL 4OZFA 4AK1A 3MRBA 4OIIL 4P4KC 5DD6A 1AP2A 1U92A 4GBXC 3SCMD 5DK0A 3G6JF 4Y4KD 5E9DB 4YHYB 2OQJB 4IJ3B 5D93C 1CDUA 4KK8D 4YK4B 1N7MH 3PV7A 4ORGB 3MC0A 1MFDH 4XH2B 1CT8B 3DO7A 1GGBL 4PJ7F 4PLKC 3ULVC 4S10A 5C8JB 1RUKL 2DQEH 2YXFA 3AREC 5FKPA 3REVA 4IEFB 3SDYH 1J18A 3BP4B 1JGLL 3TO4B 4NWUH 2MKLC 3M17A 4YHLH 3RBGA 2HFFA 3GO1H 1U8HB 2P5EB 1KG0B 5TQ2L 3MV8D 4G8IA 2B7DT 4K8RL 4HPYL 1BAFL 3VMPA 3BKJL 1RMFH 3VRIB 1U8IA 2H26A 2X44D 3ZTJG 2V7NA 3MJ7B 2CK0H 1A7RL 3PP3K 3U7WL 3R1GL 2RHEA 1NBYB 1R5IB 1LILA 1RZJH 3FFDB 3QAZC 3DI2B 1CE1L 3STZA 3RL2B 2EECA 4P9HC 2KQNA 1T20A 5JHDD 4P4RA 4UNUA 3RVXC 3WSQL 1WC7B 2PYED 2D7OA 4D9QD 2YPLA 1D5IH 2DQUL 4NO0B 4X6BB 4JHWH 4M6NH 5CD3A 5ACZA 4LMQE 2LU4A 4HHAA 1ONQB 5DVKA 2GT9A 4DKAA 5B39G 1OWWA 1TIUA 1VPOH 2HKHL 4NN7C 3ME0A 3S37H 2VLKB 1MLCA 4F8TA 5T3ZE 3VFRB 4KVNH 4N8VG 4TVSa 1MCRA 3HAEA 4NJAL 5JUEH 4DJMA 1CICC 2MHAA 3CH1B 5ETUA 4WEUD 4F58L 4P3CL 4Q6IA 3LN4A 3H2WA 4JM4H 4FQHA 4B41A 5DRNB 1JWSB 4O51B 1VFAB 4HXAL 4CNIA 3QJFB 3BD4A 5HHOB 1SJEB 1EO7A 3ET9F 3AROA 4MDJA 3H3PL 4LASH 5CGYD 4JM2F 2QQQA 4HCRL 4X4ZA 4KRPD 5E9DE 3QP3A 3UPRA 3QUMA 3S5LB 2FO4A 3P40A 5D96B 4M61B 3K1DA 1DQJB 4YDLC 1KPVB 3C6SA 4WV1A 3PHOB 3IGAA 2XKNB 3L3IA 4NKOA 4HUWA 1HHIA 4KKBD 2DM3A 1OOAA 1SVZA 2ZOKB 5SV4A 3WUWG 4XX1G 1DR9A 3L3GB 2JJTA 1N6VA 2P5EE 2AV1B 5BRZD 2NY4C 3MO1A 5D2NA 1FGNH 5H37G 4FQIH 4R4FH 2EC9U 4OCXH 3HE6A 1EHLH 5I8CB 4PJ5D 4XHJC 5JZ7D 4F7MA 3SKMB 3HNSH 4ZS7H 3L5WB 4FQ2L 1K3IA 2EE2A 4A6YB 4YEFA 1F6FB 3CDYA 3ARGC 4LSSH 4A2MA 5DHXB 1EBPA 1NCBH 3UPAA 2AJ3B 3DVGB 2ATKA 4IIQA 4M7LT 1IRAY 1L6XA 2R69L 1HCFX 2FIKA 3KS0J 4AJ0A 4CN1A 2UY7A 3FT3B 3I75A 3EHBC 1MHHA 5A2JH 2A6JB 4YHNA 4HS6A 4MCYB 4U6XA 4WI2A 5IESH 1R5WB 3DUSB 3O3UN 5DO2C 3WXWL 5F7UA 4RQQB 3QCVH 3H6JA 4Z5RA 4JRYD 3GJFH 4F7TA 3GEWB 5CEXA 5DD0L 4HIEA 2VLKE 1MF2H 2FX8H 4X9BA 1LEKA 2ZUVA 3FT4A 1I3GL 3FN9A 5DQ9B 1NQBA 1DUYB 5JW4R 1OGAA 1XEDA 1EV2E 4O58L 1DQLL 2VXUL 4HUVA 4MXWH 1LO4L 5IV2A 3O9WC 4DOHE 1SY6A 4HULB 3ELAT 4GRMA 3MRHB 3VFWB 1T7ZA 5F7KC 3T2OA 1UFUA 5HHOE 4ZSOB 3ROOB 4XCNA 1OAXH 4HKXA 1AD0B 4ZO9A 1KACB 5I75C 3ETBF 1KB5H 3MLVL 1IGCH 2WBJC 4S1DC 5FHBL 2QSCH 1UM5L 5E1AA 1OAKL 4O02L 4DAGL 1CIUA 4GKZB 5DEZA 5BZWB 2VDKL 4PJ9D 5ERWA 4YNYA 2H8PA 1IC4H 5ICXB 4ZUTA 1U8OA 3UDWA 1KIUA 1F00I 2W65A 1OP9A 3N1PC 1CD1B 4OZFG 5EU4A 1KCVL 4LKCB 5IWLA 4YUEL 1YUHA 2Q7NA 4HKZB 5CJOL 3RUGA 2DQDH 4MLSA 3F7QA 4LCYA 3HI6H 4JO4H 5LXGH 4RMVA 3RWDB 4K94H 1JF1B 1LWRA 2DYPB 4G7VL 3RI5K 3WIFA 3TH4T 2ZKHH 3T0VA 3WHXA 1HEZB 5FDWA 1R3JB 4NSKB 4PV8B 4OT1L 4WI9A 4M1DH 3O3AB 4XVUD 5IEHB 3GUTB 1KFAH 1BD2A 4TSBH 4G8EA 4N0FA 1KT2B 4XBGB 1A5FL 2D4FA 2I9LA 1FZOB 3CLFH 3UTQB 3QHTC 3ZKXB 1C7TA 3TBYA 4I18A 2HRPL 4PJXE 3O3EB 1KJ2L 4XWOC 3AMKA 4D3CH 3KLAB 3G5XA 2VIRB 3WHE0 1YEFH 4GSDL 3E1F1 5DMKA 2DQTH 3VMOA 2VE6A 4NO2B 4WGVB 3S37X 3W9DA 3B9KB 4LSTL 1EJOH 1SBSH 2ATPA 1J12A 4OCSH 5TF1H 4WI4A 2VAJA 3JWNC 3SDXF 3I6GA 3TBWA 4L8SA 1GXEA 1LD9A 1YY8A 1KPUB 2IQ9H 4ZSOE 2LQRA 3BGMB 4FHBD 3PL6C 3V0VB 5AWNH 1S3KL 4KZEL 3P9LA 1JWMA 1C5DA 3MCKB 4KAQH 2FEEI 1KLGB 5DXWA 4L1DA 3SHSA 1CGTA 3MLSL 5TGBB 1MAMH 3QI9D 3RWHA 4WU5A 4JRXA 5F1SA 5IF0A 3BQUA 1TZHA 1MCCA 4N0UA 15C8H 2EYSA 3EKCA 4L8DA 1K4CB 4TNWF 1RJZA 2GTZB 3CU7A 3GIZL 4LLWA 5I8KL 5EZOH 4XMKH 1YPZF 3B9DA 2HTLC 5F1NB 1ZT1B 2I24N 2PO6A 2B4CH 1ZA6A 3FAXA 1EEUA 1FNAA 1XZ0B 3SY0A 5HHQB 3CK0L 4YXKL 3AXLB 4XAKE 2XN9D 2DQFB 5C0CD 1XGRB 3MXWL 4LHUA 2X4OA 3QWOB 2WM0A 2KZWA 3DX7B 3MZTA 4JB9L 1Q0YH 4LU5H 4NM8H 5DRXA 4QO1A 2V9QA 5C08B 5KSAC 3BH8A 4P57B 3LRSB 2VDNH 2XWTB 1QFWL 3FQRA 3ARWA 4L3CA 4BQCA 1U3JA 3QWRA 2AGJH 1KIQB 4HFUL 3VFNA 4OGAD 4HBQA 2F74B 4LPUA 3VXUB 4NOFA 5EUOE 3CCHA 3DVNA 3VH8A 4X6CF 4Y88A 2WUBL 3GSNB 1AHWA 3EYQD 5CIPH 4IMKA 3GB7B 3UEZA 2VDOH 1MLBB 4ZMAT 1T5XA 5DVMA 3C5ZB 2Q6WA 3WFEH 4LSRL 3P77A 4WWKC 5DUPH 3QFDA 1HQRB 4ODSH 3VGAC 4KJWD 3K4DA 3SJVD 5IT2L 3K3QA 2GJ6A 2PW2B 5D6DA 2HG5A 1B4JH 1IAKB 3E2HC 3QHFH 1IKNA 1TJIH 4PB0H 2DQIL 1HKFA 1OT2A 1CD0A 2CLZB 1GGCL