1JE9A

Nmr solution structure of nt2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
b'LECHNQQSSQAPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCRTDRCNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHORT NEUROTOXIN II
publication title Structure-function relationship of three neurotoxins from the venom of Naja kaouthia: a comparison between the NMR-derived structure of NT2 with its homologues, NT1 and NT3
pubmed doi rcsb
molecule tags Toxin
total genus 7
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2001-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1je9A00
1CCQA 4IYEA 1NYSA 1NORA 2MFAA 1KBTA 4ZQYA 3EVSC 1CREA 1VB0A 2MJ4A 1CHVS 6EBXA 1CDTA 1KXIA 2OFSA 3BT1U 3U73U 1NTXA 3QB4B 4UY2C 1RGJA 2H64B 1NYUA 2PJYB 2GOOB 1CB9A 4BIKB 2H62D 2MJ0A 2CRSA 2HLQA 3U74U 1CXOA 1IDGA 1BTEA 3NDSA 1KS6A 1F8UB 3KFDI 3NH7A 4EY8B 1LXHA 2L5SA 1L4WA 2H8UA 1QKDA 1LSIA 4AEAA 5IMYC 1HOYA 2ERAA 1ABTA 1KU6B 1JGKA 2ABXA 3NEQA 5DO6A 3LAQU 2I9BE 1TXAA 2H7ZA 1TFSA 1IK8A 2BTXA 1QKEA 2VLWA 1LJZA 4FAOE 4LFTA 2UWRA 1HAAA 2H5FA 1F94A 1FRAA 1NXBA 2H62C 2QJ9C 2MHYA 4FAOC 1PLOA 1CVOA 2CTXA 2CRTA 5DZ5A 2PJYC 1FASA 2MUOA 1HC9A 1MAHF 2H7ZB 2LA1A 1S4YA 1KBAA 1LXGA 2BHIA 2J8BA 1FF4A 2L03A 2JVEA 1DRSA 4OM4A 1JE9A 2MUPA 1G6MA 1IQ9A 1NTNA 1ERGA 3PLCA 1HC9B 1ONJA 1IKCA 1KFHA 2HLRA 1REWC 2QJBC 2X8BB 1LX5B 1V6PA 2FD6U 2QC1A 1KBSA 1YWHA 3EBXA 2UX2A 1QM7A 1M9ZA 4XJJA 1FSSB 1KC4A 1XT3A 2CDXA 4RUDA 1TGXA 1W6BA 1IDIA 2QJAC 1IDLA 2H64C 3VTSA 1FSCA 1MR6A 1RL5A 3BT2U 1CDRA 1CDQA 4DO8A 1H0JA 2GOOC 5DU1A 1B41B 4QTIU 1CXNA 2JQPA 3HH7A 2K3GA 2N99A 1TXBA 2CCXA 1COEA 2LCRA 4P7UA 3KFDE 1CTXA 1ERAA 1BXPA 1FFJA 5IMTD 1JBDA 1CDSA 1IDHA 1ES7B 4HQPF 1HAJA 1UG4A 1I02A 1KTZB 1KL8A 2MJYA 4BDTB 1CODA 3FEVA 1IJCA 1CRFA 3ERAA 1ZADA 4OM5A 5EBXA 1NEAA 2NBTA
chains in the Genus database with same CATH superfamily
1CCQA 4IYEA 1NYSA 1NORA 2MFAA 1KBTA 4ZQYA 3EVSC 1CREA 1VB0A 2MJ4A 1CHVS 6EBXA 1CDTA 1KXIA 2OFSA 3BT1U 3U73U 1NTXA 3QB4B 4UY2C 1RGJA 2H64B 1NYUA 2PJYB 2GOOB 1CB9A 4BIKB 2H62D 2MJ0A 2CRSA 2HLQA 3U74U 1CXOA 1IDGA 1BTEA 3NDSA 1KS6A 1F8UB 3KFDI 3NH7A 4EY8B 1LXHA 2L5SA 1L4WA 2H8UA 1QKDA 1LSIA 4AEAA 5IMYC 1HOYA 2ERAA 1ABTA 1KU6B 1JGKA 2ABXA 3NEQA 5DO6A 3LAQU 2I9BE 1TXAA 2H7ZA 1TFSA 1IK8A 2BTXA 1QKEA 2VLWA 1LJZA 4FAOE 4LFTA 2UWRA 1HAAA 2H5FA 1F94A 1FRAA 1NXBA 2H62C 2QJ9C 2MHYA 4FAOC 1PLOA 1CVOA 2CTXA 2CRTA 5DZ5A 2PJYC 1FASA 2MUOA 1HC9A 1MAHF 2H7ZB 2LA1A 1S4YA 1KBAA 1LXGA 2BHIA 2J8BA 1FF4A 2L03A 2JVEA 1DRSA 4OM4A 1JE9A 4KSNA 2MUPA 1G6MA 1IQ9A 1NTNA 1ERGA 3PLCA 1HC9B 1ONJA 1IKCA 1KFHA 2HLRA 1REWC 2QJBC 2X8BB 1LX5B 1V6PA 2FD6U 2QC1A 1KBSA 1YWHA 3EBXA 2UX2A 1QM7A 1M9ZA 4XJJA 1FSSB 1KC4A 1XT3A 2CDXA 4RUDA 1TGXA 1W6BA 1IDIA 2QJAC 1IDLA 2H64C 3VTSA 1FSCA 1MR6A 1RL5A 3BT2U 1CDRA 1CDQA 4DO8A 1H0JA 2GOOC 5DU1A 1B41B 4QTIU 1CXNA 2JQPA 3HH7A 2K3GA 2N99A 1TXBA 2CCXA 1COEA 2LCRA 4P7UA 3KFDE 1CTXA 1ERAA 1BXPA 1FFJA 5IMTD 1JBDA 1CDSA 1IDHA 1ES7B 4HQPF 1HAJA 1UG4A 1I02A 1KTZB 1KL8A 2MJYA 4BDTB 1CODA 3FEVA 1IJCA 1CRFA 3ERAA 1ZADA 4OM5A 5EBXA 1NEAA 2NBTA
chains in the Genus database with same CATH topology
1CCQA 4IYEA 1NYSA 1NORA 2MFAA 1KBTA 4ZQYA 3EVSC 1CREA 1VB0A 2MJ4A 1CHVS 6EBXA 1CDTA 1KXIA 2OFSA 3BT1U 3U73U 1NTXA 3QB4B 4UY2C 1RGJA 2H64B 1NYUA 2PJYB 2GOOB 1CB9A 4BIKB 2H62D 2MJ0A 2CRSA 2HLQA 3U74U 1CXOA 1IDGA 1BTEA 3NDSA 1KS6A 1F8UB 3KFDI 3NH7A 4EY8B 1LXHA 2L5SA 1L4WA 2H8UA 1QKDA 1LSIA 4AEAA 5IMYC 1HOYA 2ERAA 1ABTA 1KU6B 1JGKA 2ABXA 3NEQA 5DO6A 3LAQU 2I9BE 1TXAA 2H7ZA 1TFSA 1IK8A 2BTXA 1QKEA 2VLWA 1LJZA 4FAOE 4LFTA 2UWRA 1HAAA 2H5FA 1F94A 1FRAA 1NXBA 2H62C 2QJ9C 2MHYA 4FAOC 1PLOA 1CVOA 2CTXA 2CRTA 5DZ5A 2PJYC 1FASA 2MUOA 1HC9A 1MAHF 2H7ZB 2LA1A 1S4YA 1KBAA 1LXGA 2BHIA 2J8BA 1FF4A 2L03A 2JVEA 1DRSA 4OM4A 1JE9A 4KSNA 2MUPA 1G6MA 1IQ9A 1NTNA 1ERGA 3PLCA 1HC9B 1ONJA 1IKCA 1KFHA 2HLRA 1REWC 2QJBC 2X8BB 1LX5B 1V6PA 2FD6U 2QC1A 1KBSA 1YWHA 3EBXA 2UX2A 1QM7A 1M9ZA 4XJJA 1FSSB 1KC4A 1XT3A 2CDXA 4RUDA 1TGXA 1W6BA 1IDIA 2QJAC 1IDLA 2H64C 3VTSA 1FSCA 1MR6A 1RL5A 3BT2U 1CDRA 1CDQA 4DO8A 1H0JA 2GOOC 5DU1A 1B41B 4QTIU 1CXNA 2JQPA 3HH7A 2K3GA 2N99A 1TXBA 2CCXA 1COEA 2LCRA 4P7UA 3KFDE 1CTXA 1ERAA 1BXPA 1FFJA 5IMTD 1JBDA 1CDSA 1IDHA 1ES7B 4HQPF 1HAJA 1UG4A 1I02A 1KTZB 1KL8A 2MJYA 4BDTB 1CODA 3FEVA 1IJCA 1CRFA 3ERAA 1ZADA 4OM5A 5EBXA 1NEAA 2NBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CCQ A;  4IYE A;  1NYS A;  1NOR A;  2MFA A;  1KBT A;  4ZQY A;  3EVS C;  1CRE A;  1VB0 A;  2MJ4 A;  1CHV S;  6EBX A;  1CDT A;  1KXI A;  2OFS A;  3BT1 U;  3U73 U;  1NTX A;  3QB4 B;  4UY2 C;  1RGJ A;  2H64 B;  1NYU A;  2PJY B;  2GOO B;  1CB9 A;  4BIK B;  2H62 D;  2MJ0 A;  2CRS A;  2HLQ A;  3U74 U;  1CXO A;  1IDG A;  1BTE A;  3NDS A;  1KS6 A;  1F8U B;  3KFD I;  3NH7 A;  4EY8 B;  1LXH A;  2L5S A;  1L4W A;  2H8U A;  1QKD A;  1LSI A;  4AEA A;  5IMY C;  1HOY A;  2ERA A;  1ABT A;  1KU6 B;  1JGK A;  2ABX A;  3NEQ A;  5DO6 A;  3LAQ U;  2I9B E;  1TXA A;  2H7Z A;  1TFS A;  1IK8 A;  2BTX A;  1QKE A;  2VLW A;  1LJZ A;  4FAO E;  4LFT A;  2UWR A;  1HAA A;  2H5F A;  1F94 A;  1FRA A;  1NXB A;  2H62 C;  2QJ9 C;  2MHY A;  4FAO C;  1PLO A;  1CVO A;  2CTX A;  2CRT A;  5DZ5 A;  2PJY C;  1FAS A;  2MUO A;  1HC9 A;  1MAH F;  2H7Z B;  2LA1 A;  1S4Y A;  1KBA A;  1LXG A;  2BHI A;  2J8B A;  1FF4 A;  2L03 A;  2JVE A;  1DRS A;  4OM4 A;  1JE9 A;  2MUP A;  1G6M A;  1IQ9 A;  1NTN A;  1ERG A;  3PLC A;  1HC9 B;  1ONJ A;  1IKC A;  1KFH A;  2HLR A;  1REW C;  2QJB C;  2X8B B;  1LX5 B;  1V6P A;  2FD6 U;  2QC1 A;  1KBS A;  1YWH A;  3EBX A;  2UX2 A;  1QM7 A;  1M9Z A;  4XJJ A;  1FSS B;  1KC4 A;  1XT3 A;  2CDX A;  4RUD A;  1TGX A;  1W6B A;  1IDI A;  2QJA C;  1IDL A;  2H64 C;  3VTS A;  1FSC A;  1MR6 A;  1RL5 A;  3BT2 U;  1CDR A;  1CDQ A;  4DO8 A;  1H0J A;  2GOO C;  5DU1 A;  1B41 B;  4QTI U;  1CXN A;  2JQP A;  3HH7 A;  2K3G A;  2N99 A;  1TXB A;  2CCX A;  1COE A;  2LCR A;  4P7U A;  3KFD E;  1CTX A;  1ERA A;  1BXP A;  1FFJ A;  5IMT D;  1JBD A;  1CDS A;  1IDH A;  1ES7 B;  4HQP F;  1HAJ A;  1UG4 A;  1I02 A;  1KTZ B;  1KL8 A;  2MJY A;  4BDT B;  1COD A;  3FEV A;  1IJC A;  1CRF A;  3ERA A;  1ZAD A;  4OM5 A;  5EBX A;  1NEA A;  2NBT A; 
#chains in the Genus database with same CATH topology
 1CCQ A;  4IYE A;  1NYS A;  1NOR A;  2MFA A;  1KBT A;  4ZQY A;  3EVS C;  1CRE A;  1VB0 A;  2MJ4 A;  1CHV S;  6EBX A;  1CDT A;  1KXI A;  2OFS A;  3BT1 U;  3U73 U;  1NTX A;  3QB4 B;  4UY2 C;  1RGJ A;  2H64 B;  1NYU A;  2PJY B;  2GOO B;  1CB9 A;  4BIK B;  2H62 D;  2MJ0 A;  2CRS A;  2HLQ A;  3U74 U;  1CXO A;  1IDG A;  1BTE A;  3NDS A;  1KS6 A;  1F8U B;  3KFD I;  3NH7 A;  4EY8 B;  1LXH A;  2L5S A;  1L4W A;  2H8U A;  1QKD A;  1LSI A;  4AEA A;  5IMY C;  1HOY A;  2ERA A;  1ABT A;  1KU6 B;  1JGK A;  2ABX A;  3NEQ A;  5DO6 A;  3LAQ U;  2I9B E;  1TXA A;  2H7Z A;  1TFS A;  1IK8 A;  2BTX A;  1QKE A;  2VLW A;  1LJZ A;  4FAO E;  4LFT A;  2UWR A;  1HAA A;  2H5F A;  1F94 A;  1FRA A;  1NXB A;  2H62 C;  2QJ9 C;  2MHY A;  4FAO C;  1PLO A;  1CVO A;  2CTX A;  2CRT A;  5DZ5 A;  2PJY C;  1FAS A;  2MUO A;  1HC9 A;  1MAH F;  2H7Z B;  2LA1 A;  1S4Y A;  1KBA A;  1LXG A;  2BHI A;  2J8B A;  1FF4 A;  2L03 A;  2JVE A;  1DRS A;  4OM4 A;  1JE9 A;  4KSN A;  2MUP A;  1G6M A;  1IQ9 A;  1NTN A;  1ERG A;  3PLC A;  1HC9 B;  1ONJ A;  1IKC A;  1KFH A;  2HLR A;  1REW C;  2QJB C;  2X8B B;  1LX5 B;  1V6P A;  2FD6 U;  2QC1 A;  1KBS A;  1YWH A;  3EBX A;  2UX2 A;  1QM7 A;  1M9Z A;  4XJJ A;  1FSS B;  1KC4 A;  1XT3 A;  2CDX A;  4RUD A;  1TGX A;  1W6B A;  1IDI A;  2QJA C;  1IDL A;  2H64 C;  3VTS A;  1FSC A;  1MR6 A;  1RL5 A;  3BT2 U;  1CDR A;  1CDQ A;  4DO8 A;  1H0J A;  2GOO C;  5DU1 A;  1B41 B;  4QTI U;  1CXN A;  2JQP A;  3HH7 A;  2K3G A;  2N99 A;  1TXB A;  2CCX A;  1COE A;  2LCR A;  4P7U A;  3KFD E;  1CTX A;  1ERA A;  1BXP A;  1FFJ A;  5IMT D;  1JBD A;  1CDS A;  1IDH A;  1ES7 B;  4HQP F;  1HAJ A;  1UG4 A;  1I02 A;  1KTZ B;  1KL8 A;  2MJY A;  4BDT B;  1COD A;  3FEV A;  1IJC A;  1CRF A;  3ERA A;  1ZAD A;  4OM5 A;  5EBX A;  1NEA A;  2NBT A; 
#chains in the Genus database with same CATH homology
 1CCQ A;  4IYE A;  1NYS A;  1NOR A;  2MFA A;  1KBT A;  4ZQY A;  3EVS C;  1CRE A;  1VB0 A;  2MJ4 A;  1CHV S;  6EBX A;  1CDT A;  1KXI A;  2OFS A;  3BT1 U;  3U73 U;  1NTX A;  3QB4 B;  4UY2 C;  1RGJ A;  2H64 B;  1NYU A;  2PJY B;  2GOO B;  1CB9 A;  4BIK B;  2H62 D;  2MJ0 A;  2CRS A;  2HLQ A;  3U74 U;  1CXO A;  1IDG A;  1BTE A;  3NDS A;  1KS6 A;  1F8U B;  3KFD I;  3NH7 A;  4EY8 B;  1LXH A;  2L5S A;  1L4W A;  2H8U A;  1QKD A;  1LSI A;  4AEA A;  5IMY C;  1HOY A;  2ERA A;  1ABT A;  1KU6 B;  1JGK A;  2ABX A;  3NEQ A;  5DO6 A;  3LAQ U;  2I9B E;  1TXA A;  2H7Z A;  1TFS A;  1IK8 A;  2BTX A;  1QKE A;  2VLW A;  1LJZ A;  4FAO E;  4LFT A;  2UWR A;  1HAA A;  2H5F A;  1F94 A;  1FRA A;  1NXB A;  2H62 C;  2QJ9 C;  2MHY A;  4FAO C;  1PLO A;  1CVO A;  2CTX A;  2CRT A;  5DZ5 A;  2PJY C;  1FAS A;  2MUO A;  1HC9 A;  1MAH F;  2H7Z B;  2LA1 A;  1S4Y A;  1KBA A;  1LXG A;  2BHI A;  2J8B A;  1FF4 A;  2L03 A;  2JVE A;  1DRS A;  4OM4 A;  1JE9 A;  4KSN A;  2MUP A;  1G6M A;  1IQ9 A;  1NTN A;  1ERG A;  3PLC A;  1HC9 B;  1ONJ A;  1IKC A;  1KFH A;  2HLR A;  1REW C;  2QJB C;  2X8B B;  1LX5 B;  1V6P A;  2FD6 U;  2QC1 A;  1KBS A;  1YWH A;  3EBX A;  2UX2 A;  1QM7 A;  1M9Z A;  4XJJ A;  1FSS B;  1KC4 A;  1XT3 A;  2CDX A;  4RUD A;  1TGX A;  1W6B A;  1IDI A;  2QJA C;  1IDL A;  2H64 C;  3VTS A;  1FSC A;  1MR6 A;  1RL5 A;  3BT2 U;  1CDR A;  1CDQ A;  4DO8 A;  1H0J A;  2GOO C;  5DU1 A;  1B41 B;  4QTI U;  1CXN A;  2JQP A;  3HH7 A;  2K3G A;  2N99 A;  1TXB A;  2CCX A;  1COE A;  2LCR A;  4P7U A;  3KFD E;  1CTX A;  1ERA A;  1BXP A;  1FFJ A;  5IMT D;  1JBD A;  1CDS A;  1IDH A;  1ES7 B;  4HQP F;  1HAJ A;  1UG4 A;  1I02 A;  1KTZ B;  1KL8 A;  2MJY A;  4BDT B;  1COD A;  3FEV A;  1IJC A;  1CRF A;  3ERA A;  1ZAD A;  4OM5 A;  5EBX A;  1NEA A;  2NBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...