1JEGA

Solution structure of the sh3 domain from c-terminal src kinase complexed with a peptide from the tyrosine phosphatase pep
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
b'SGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE CSK
publication title A novel, specific interaction involving the Csk SH3 domain and its natural ligand.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/hydrolase
total genus 10
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jegA00
4GLMA 1JO8A 1VYVA 3I9QA 1GRIA 3UA7A 4JZ4A 2RN8A 2CUDA 1K1ZA 2O31A 4J9BA 5FWCA 1G2BA 2DJQA 1AZEA 2FPFA 1GBRA 3EG3A 4J9DA 2LQNA 4KRTA 4M4ZA 5GJVB 5ECAA 5IHKA 2J6OA 2DRKA 1PHTA 3SHWA 1M3CA 4JZ3A 4ORZA 1J3TA 1AD5A 4J9HA 2D8HA 2KT8A 2HEQA 3UATA 3VS7A 1BK2A 4CC7A 3LH5A 2YSQA 2YT6A 4OMMA 3UA6A 1OV3A 1UE9A 3GBQA 1EFNA 2DNUA 2OJ2A 2JT4A 1WIEA 2W10A 2CSQA 2EYYA 2RF0A 1HD3A 1HSQA 1VYTA 1QLYA 1X27A 1SPKA 4DEYA 3TSWA 2XMFA 1VA7A 2JS2A 2KYBA 3H0IA 2L3QA 1MUZA 1U3OA 2ROLA 2EQIA 1WDXA 2F2XA 1N5ZA 4HCKA 3M0TA 1RLPC 2NUZA 2EGCA 1W70A 1AOJA 1JU5C 3VRZA 1UTIA 2JW4A 4OMPA 2DBMA 2X3WD 1PRMC 1ZBJA 2EGEA 1KJWA 2J6FA 3EGUA 1UG1A 1ZX6A 1ZUUA 3EHQA 2MIOA 1WFWA 1T0JA 2KR3A 2QDLA 1S1NA 4LNPA 2CH4W 1UUEA 1M8MA 1HJDA 1U5SA 3NGPA 2DYBA 2RQUA 3UF4A 1BB9A 1NEBA 1SSHA 3ZL7C 5FWBA 2EPDA 3I5RA 2GBQA 2BTTA 3U23A 2KGTA 2EBPA 3VRYA 2AKLA 4RTXA 4FSSA 1IO6A 2KBTA 1YN8A 2FRWA 3PVLA 1WXUA 1FYNA 1UHCA 3M0PA 2RMOA 1G83A 5GJWB 3TVTA 4RUGA 2FPDA 3EG0A 2RQWA 3A98A 1I0CA 2GQIA 2LP5A 3M0SA 2OAWA 1GCQC 4GBQA 1E7OA 4Z88A 2DRMA 1WXBA 4CC4B 1CKAA 2DE0X 1WI7A 2K3BA 2PTKA 2EYWA 2VVKA 3THKA 4LE9A 2EW3A 4HVUA 4QT7A 2DL5A 1X69A 2SRCA 2E5KA 2F2VA 2W0ZA 5IHIA 1X6BA 1X2QA 2KRMA 2L3PA 2JTEA 1SEMA 3H0FA 1W6XA 1XOVA 4LN2A 2ED1A 2KEAA 1UDLA 2D0NA 2LJ1A 3TSZA 2A36A 2K6DA 1MV0B 1YCSB 2VWFA 4F17A 2KRNA 2AZVA 2KYMA 1GCQA 5IXBA 1GBQA 2HSPA 2DILA 3NPFA 1NLPC 2CT3A 2GTJA 4AG1C 3VS4A 1I1JA 1QWFA 1B3QA 2AK5A 2JMAA 2KE9A 2A08A 2HDAA 2L2PA 2O2OA 3RNJA 2LMJA 2HBWA 2M51A 1V1CA 1AZGB 2ED0A 2F2WA 5I22A 4J9GA 2C0TA 1PKTA 1NG2A 1ABOA 2DL3A 1PNJA 2JM8A 2CREA 1Y0MA 2K7AA 2IIMA 1H92A 3H41A 2A28A 1AWWA 4CC3A 4F14A 2MCNA 1ZLMA 4RTTA 1PWTA 1ZSGA 2O9VA 4HVVA 3FJ5A 3IQLA 1H3HA 1X2KA 2LJ3A 4HVWA 1KIKA 2J06A 2AZSA 3VS0A 4RTZA 2L3SA 2MOXA 1RUWA 4Y92A 1T3SA 1E6HA 2P4RA 1AWOA 2D1XA 1ARKA 1YWPA 1TG0A 1UHFA 3JV3A 4F16A 1T0HA 1GCPA 3RBBB 4X1VA 1OPKA 1TUCA 1AEYA 4R0KA 4IIOA 2RQTA 2KNBB 1JEGA 2CDTA 2V1QA 2H8HA 2V1RA 1PRLC 2DL8A 2O88A 1M3AA 1ZUKA 4AFZC 1NYGA 2YUQA 1YWOA 3EHRA 1Z9QA 1VYUA 2RNAA 1FMKA 2GTOA 4JJBA 1B07A 3SEMA 1K0XA 2AKKA 4AG2C 2CT4A 2B86A 2FPEA 1M30A 2GNCA 5IH2A 3R6NA 2DVJA 2CUBA 1NM7A 2ROTA 1YP5A 2DF6A 2FEIA 1K9AA 5FW9A 2FRYA 1MV3A 1OPLA 1WA7A 4Z8AA 3CQTA 1QCFA 2FO0A 1Y57A 2ECZA 3QWYA 2JXBA 1X6GA 2J05A 3M0RA 1RI9A 4EIKA 2RPNA 1GL5A 2JS0A 1GFCA 3NHNA 2L0AA 2X3XD 2I0NA 1PKSA 1SRMA 1WYXA 3VS3A 1KSWA 1AVZC 2YUOA 4AFSC 1AWJA 2EVRA 1RLQC 2LJ0A 1ABQA 1YNZA 4A63B 1WLPB 3VS6A 1W1FA 2LQWA 2D8JA 4LUEA 2BZ8A 4OMQA 1UECA 2J6KA 4CC2A 1BU1A 4HXJA 1CSKA 3I5SA 4OMLA 1TUDA 1BBZA 2PZ1A 1JQQA 2VKNA 2DL7A 3VS2A 3H0HA 3REBB 4AFUC 4J9CA 2RQVA 2J7IA 2DA9A 2K9GA 1UGVA 4J9EA 2DLPA 1OEBA 1T3LA 3NMZC 4RTWA 1GFDA 2DM1A 1ZUYA 2A37A 3VS1A 2DX1A 2LZ6B 2EYZA 3EG2A 2EYXA 4JJCA 5EC7A 1QKWA 4DEXA 1X43A 2DMOA 3EG1A 2LNHB 1UFFA 2C0OA 2KRSA 2CH4A 2ABLA 3C0CA 3I35A 1SRLA 2BZXA 1Z9ZA 2YUPA 3REAB 2PNIA 1NLOC 1UJYA 4K11A 2JM9A 2GGRA 1KFZA 2JMCA 2LCSA 2O9SA 2SEMA 5I11A 2C0IA 2OI3A 2EGAA 4JJDA 4RTUA 2KXDA 2CSIA 4WCIA 2DL4A 2LX7A 2YUNA 1WX6A 3KFVA 1SHGA 1WXTA 3ULRB 4IIMA 1LCKA 4J9IA 1E6GA 1K76A 4AFQC 4ESRA 2YDLA 1JXOA 4D8DA 2KT1A 4D8KA 2HCKA 5IHNA 1QKXA 2M0YA 1SHFA 1M3BA 1M27C 3VS5A 2K2MA 2KXCA 4E6RA 4RTYA 4ZNXA 1AWXA 4OMNA 4Z89A 3O5ZA 2K79A 3PVQA 1OOTA 3M0QA 3QWXX 1A0NB 2ESWA 2KROA 1CKBA 1K0SA 1UJ0A 4JPBW 2ENMA 1U06A 3M0UA 4LUDA 1I07A 1JXMA 4J9FA 5HCKA 2G6FX 5L23A 1NYFA 2EKHA 4RTVA 1NEGA 3PE0A 1QWEA 1H8KA 2BZYA 1K4US 4OMOA 2FG0A 2RQRA 5IXFA 2DBKA 2NWMA
chains in the Genus database with same CATH superfamily
1MNDA 4C92B 1RI0A 4CI0C 4JZ4A 2RN8A 1Q95G 4KGXB 2YLCA 4J9BA 1GXIE 2MWOA 3EG3A 4Z02A 4J9DA 2E3HA 1M2VB 2RM4A 1YIJA 1FMWA 4M4ZA 2K3YA 5IHKA 1ZSZA 2J6OA 2RI5A 1TWBA 1M3CA 2VB6A 4ORZA 1AD5A 1SSFA 4J9HA 2KQWA 1RAGB 3E9FA 3UATA 2RO0A 3UA6A 3CCMA 1OV3A 1KD1U 2OJ2A 2JT4A 4KT0E 4A4GA 3EFSA 2W10A 1K9MR 3OYMA 1SPKA 4DEYA 1R77A 2XMFA 3L1AA 1VA7A 2KYBA 2GF7A 2L3QA 4PK4A 5C6SA 2ROLA 4NOYA 1VQ7Q 1WDXA 1BI2A 1BYMA 3M0TA 1RLPC 1YITA 4M78F 2EGCA 1JU5C 4ME7A 2KVQG 2CZ7B 3MCAB 3OW2A 5CK9A 4C8QG 5KYXA 1YIJT 2J6FA 3EGUA 3BE3A 3L2UA 1LNXA 3CCLA 4C8QB 1B34A 1RAHB 3CCQA 3NGPA 2RQUA 3OYIA 1Q7YU 2EQKA 2LT4A 2EPDA 3I5RA 5GAOp 4M7AG 2ZPEB 3RMSA 2DIGA 3LH0A 3NTKA 3FIFA 2RI3A 2WSFE 4RTXA 2NUPB 2YHTA 4FSSA 4M7AB 1YN8A 2Z0WA 1WXUA 1VIEA 3M0PA 2RMOA 4MMLA 2K3XA 4JDSA 5GJWB 2XD0A 1YJ9A 5GAMh 2GQIA 3M0SA 4F7UG 2M02A 5D6XA 3GNFB 5GAOm 1JJ2A 1GCQC 4Q5WA 2DRMA 4F7UB 1CKAA 2DE0X 1SKUB 3FJPA 1YITT 1KC8R 3LLRA 5GAN5 2F2VA 3GIBA 1X6BA 3QHSA 2KK4A 2KRMA 1SEMA 1XTDA 5FRMA 4LN2A 3CCLT 4E7ZA 1UDLA 3MEUA 3CMAA 2HSEB 5I21A 4F17A 2KRNA 2CZ6B 4BACA 3RERA 3EH1A 1GBQA 3OW2S 3QUIA 2WSCE 3L2VA 4HKEA 4AG1C 3JB9D 1I1JA 1WHJA 1X75C 1B3QA 5KH6A 2AK5A 3RNJA 3C95A 5GAN4 2CZ1B 1Q7YC 1V1CA 2X35A 3JAME 1NG2A 3A8OB 2BIVA 2COWA 1ZSZB 3KXTA 1YIJQ 5CAIA 3OW2P 1M90C 1VQ9A 3OY9A 3OQ5A 4A4HA 4LDXA 4CC3A 3OS1A 2MCNA 1QVFA 4RTTA 3ASKA 2EKOA 4QW2A 3CMAT 2DXUA 4J6YA 3E9GA 1BIAA 3ER0A 3VS0A 3CCMQ 2L5QA 5LJ5f 2LC4A 2D1XA 1ARKA 3PT9A 1H641 2H3EB 1UHFA 1YJWA 2H3JA 1KQSA 4F16A 4DOWA 1JJ2P 4X1VA 1Q81R 1TUCA 1UGQB 4R0KA 2KDSA 4C92C 1S72T 1M1KR 3OS2A 4M7DD 2DL8A 1YITQ 1U1SA 2YUQA 5KCHA 2RHYA 4M75E 1Z9QA 2XIDA 2RNAA 5KYXB 1B07A 3SEMA 4J5YA 3X25B 1SG5A 2CP6A 1M30A 2D0QB 5GANf 3CCLQ 2DVJA 4EMKA 1NM7A 3OYYA 2P0KA 4PJJA 2FEIA 1NJIU 1K9AA 2DXCA 3Q1JA 1MV3A 3M53A 4Z8AA 1N8RC 1Y57A 1TH7A 2JXBA 2HKQB 4M7DA 4OP0A 3QZ5B 2HL5C 4OB2B 2DPPB 2G3RA 3INZA 1GL5A 2JS0A 4C92E 3OYCA 1MMNA 3NHNA 2L0AA 1YJ9Q 1PKSA 1WQWA 1YJWT 1QVFS 1IGUA 1KSWA 5GMKe 3M57A 1ACMB 1IREB 2LJ0A 3JCMg 2GCXA 1YNZA 5LJ5g 4A63B 5A2QE 1K9MU 2RJCA 1WLPB 5D7UA 3OBWA 1JBMA 4B9XA 4JLGA 5GAOq 1EZZB 2LQWA 4XU0A 4FT2A 2RI2A 1V76A 2BZ8A 4KH0B 5CKEA 1KQSS 2J6KA 1D3BA 3CBOA 4C8QC 1QVFP 4CRIA 1TUDA 3J80E 3CMAQ 2WSEE 3PNWC 5FRNA 2DL7A 1TXQA 3H0HA 4AFUC 4FL6A 4J9CA 1VQ5A 2DA9A 4QQDA 2XICA 2RK1A 2MYSA 4J9EA 3DLLA 3CC7A 1YJNA 3JRZA 3MKDA 4RTWA 3JCMb 4BDZA 5GANj 3MP1A 4N4GA 2A37A 3OS0A 2MI6A 5GMKh 5EC7A 1QKWA 1KQSP 3LW5E 1X43A 4IKFA 4KGZB 2DMOA 5C0MA 1QW1A 3CCJT 2KRSA 1NJIC 4GLKA 2JUFA 3CBMA 3I35A 3L2RA 2BZXA 3PMIA 3M9QA 3MEWA 2BE7D 2HAXA 2VASA 2CS7A 2DAQA 2YUPA 1UJYA 4K11A 2JM9A 4C8QE 2ZPGB 4JRQA 1MGQA 1VQ9Q 3CEYA 3CCSA 3OYBA 1KFZA 1WHLA 4PJOD 2LCSA 2E70A 1OQKA 2O9SA 3JB9G 2SEMA 2PQWA 2OI3A 4FT4A 2KXDA 4OB3B 3QYGB 4V2SA 2DL4A 1KC8U 4FW1A 1M5Q1 2LTOA 8ATCB 2PVGB 2DERA 1WX6A 3KFVA 3EFOA 1VQ5T 4MZPA 2YWWA 5CKFA 3HRUA 1LCKA 2JZ2A 3V8LA 3CC7T 1YJNT 2QK0A 2ZAEA 4M77D 4M75F 3DB3A 1YJWQ 3JSCA 3S3MA 4C0DB 3P8HA 4F7UE 3G6EA 2ZCFB 3MJXA 1IZ6A 1VOMA 4JLIA 4LD9K 2KXCA 4ZNXA 2DD4A 3O5ZA 2K79A 3PVQA 4PJOA 3QWXX 3MO8A 3QYHB 2ESWA 1CKBA 2EJ9A 2XKOC 1UGRB 5GMKm 4FIBA 3DLMA 1U06A 2XI9A 2YLBA 5HCKA 5L23A 5FU7C 4EMKB 2EKHA 4RG8A 1WZOA 3RR6A 4XTVA 4M77A 3PE0A 4IUUA 2DZCA 1H8KA 2BZYA 5LJ3f 4OMOA 5GAOr 4C92F 2FG0A 4OF1A 5IXFA 4MZMA 2DBKA 1U1TA 2NWMA 2EWNA 2EAYA 3OYHA 1JO8A 1M2OA 2BUDA 4M7DB 3UA7A 1D1BA 1K1ZA 2O31A 4OMFB 1G2BA 2DJQA 1AZEA 1GBRA 2LCCA 2QASA 1OU8A 2LQNA 4KRTA 3X26B 1QCNA 3QJ6A 2P84A 5GJVB 3G6ET 3CCJQ 4EDUA 2M16A 3SHWA 1KQ2A 3TEEA 2V8IA 1G8XA 2LT1A 3EG9A 2KT8A 3WXMB 2ZPBB 1BK2A 4KULA 4IUPA 4OMMA 5I2SA 1UE9A 3GBQA 1K73U 1R8OB 1WIEA 2EYYA 2RF0A 1HD3A 1HSQA 3J7AF 1QLYA 1G3SA 4HA8A 2LRQA 1VQ5Q 3UPUA 1OZ2A 1U3OA 2ATCB 3ZEHA 1BCMA 5A0DA 3CC7Q 2QAZA 5FLXE 3JCMX 1YJNQ 5CIUA 1N5ZA 4MZTA 3HL8A 2DO3A 1N9SA 1AOJA 5LJ3j 3ME9A 2JW4A 2RHUA 2V8JA 3CC2T 4C8QF 1KJWA 4ANJA 2KMTA 2DFUA 1ZUUA 2MIOA 2KR3A 1C6VX 4HCBA 4LNPA 1UUEA 4N4IA 5CKBA 1HJDA 2DYBA 3UF4A 2V8KA 3ZL7C 2JN0A 5FWBA 5GANe 2GBQA 2NYSA 3M4YA 2KGTA 3OSSC 2A3LA 5M9OA 3V7RA 1RADB 2E65A 5CR2A 3CCSQ 2KI7A 4P5NA 4J83A 1BKBA 3C94A 1UHCA 3P8BB 3JCMh 1G83A 5LJ5h 2FPDA 4FYVB 4C0FA 4F7UF 2K5LA 3EFOB 4QVZA 4GBQA 2K5FA 1E7OA 2QYZA 4Z88A 4XU3A 1IHVA 4DQ2A 2RK2A 1WI7A 1VQPA 1KHCA 4PJOG 3THKA 1WHMA 1X69A 4A53A 3G6EQ 1K73C 5KE3A 5IHIA 1EIFA 4PJOB 5J3BA 4II1A 1QCOA 2KEAA 2DXBA 3CC4A 2DVEA 1MV0B 1YCSB 3S6WA 2ZZDA 1IHWA 5CQXA 4X34A 4M77G 2KYMA 2EJFA 2EYQA 3I55T 5IXBA 4PLIA 3VJPA 2CP7A 2HSPA 4M77B 4BE1A 4A4EA 1RL2A 4M78D 5EG2A 3CD6T 2EFIA 2JNGA 4R55A 3MP8A 5I2MA 2A08A 2HDAA 2O2OA 4FM4B 2M51A 4L6V5 3MPUB 4J9GA 3GPLA 2C0TA 1PKTA 1VQPT 1PNJA 3GNGA 2CREA 4C5IA 3M56A 3EH2A 3EGDA 1H92A 3H41A 2A28A 4F14A 1BI3A 3EG9B 1ZLMA 1PWTA 1ZSGA 3FJ5A 3V7SA 4M78A 1VUBA 3CC4T 3OYGA 3GF5A 3M54A 1LPLA 2AZSA 1WPYA 2MOXA 1D1CA 1W2BA 4XTYA 1MHNA 3A8GB 2VGMA 4Y92A 4EMKC 3RMQA 4ZN1A 2E5QA 3JB9H 2X4JA 1GCPA 3RBBB 5GAN2 1K8AU 1OPKA 2VV5A 5IN1A 4ZGJB 1AEYA 3PMTA 1O75A 2OTJA 2CDTA 3VUBA 1PRLC 3X20B 1M3AA 4E7IA 4AFZC 4JRIA 2Y4XA 3EHRA 1NE8A 4JJBA 1K0XA 2PVOB 1M1GA 1IXDA 4AT1B 4NL3A 2B86A 4Y28E 2FPEA 2V26A 3M59A 1JRIA 2DF6A 1VQ6A 2X4WA 5GAMd 5FW9A 5CCAA 1WJRA 3G7ZA 3JCMV 1OPLA 1WA7A 2COYA 1QCFA 1KD1C 5LJ3e 2ECZA 2BE9B 4BI3A 1X6GA 4RKUE 5GAOl 1Y07A 1RI9A 4VUBA 3FB9A 3NTHA 1IRXA 2F69A 2X3XD 2I0NA 4NS5A 2R57A 2RJEA 2E41A 2EVRA 2FYKA 1R0BG 4N0AA 3HSBA 2OTJT 2E6NA 1ABQA 1NZ9A 1NBEB 4XU1A 1W2BS 1VQPQ 2HQXA 4EMHA 3OMCA 2DTOA 2P0QA 1Q82U 2VXEA 4OMQA 5LJ3d 2QQBA 1S72A 4HXJA 1CSKA 3C12A 1K8AC 1QP3A 2PZ1A 1VQ6T 3CC4Q 2F1LA 2KY9A 2L3RA 4PJNA 2XU8A 4FYWB 2K9GA 4PJLA 1T3LA 1W2BP 1NPRA 3HRSA 4M75C 1D1AA 1WGSA 3CCVA 3M58A 3VS1A 4NL2A 2NUTA 2DJZA 2EYZA 3EG2A 1VQMA 4JJCA 4HT8A 5L8RE 4BDYA 3QSUA 2I2LA 3EG1A 2C0OA 1VQ4A 1MMGA 5GAN3 2CH4A 2QI2A 2ABLA 1PD1A 3C0CA 2HBPA 1VQKA 1F1BB 1I81A 1Z9ZA 2X4YA 3REAB 1NLOC 2A7YA 1Y96A 3EGDB 1KG1A 5CO7A 1Q86R 4M78G 3JB9F 2C0IA 4BY6B 3OYAA 2EGAA 1PSFA 2JOYA 2WACA 3WVEB 4M78B 3CMEA 4WCIA 2LX7A 3CCRA 1QMCA 5GMKi 1SHGA 4M77C 4RG2A 1K76A 4ESRA 3QPHA 3NTIA 2YDLA 4BI8B 4J7FA 4D8DA 1B34B 3CCVT 2HCKA 1Q82C 2M0YA 5LL6S 1KK7A 1SHFA 1M4ZA 1VQMT 2MMPA 2YRDA 4XU2A 1M1FA 1NPPA 4RTYA 2JTFA 4OMNA 2EQMA 1D0XA 2OTJQ 3QDFA 4JJNK 1VQ4T 1Y71A 1A0NB 3RIRA 4B9WA 1WHHA 3RKWA 1UJ0A 4J6XA 1PM3A 1VQKT 4JPBW 2HD0A 4J7IA 4PJOE 1I07A 1JXMA 2LX9A 4J9FA 1VQ8A 4MMKA 2K4YA 3CCJA 1ZBXA 1WJSA 5IAYA 4RTVA 4D6WA 2LCLA 1WHGA 1VQ6Q 3V8JA 4JS5A 4ZTFA 1VQLA 5KYUA 4BD3A 3CMET 2RQRA 2EIFA 4M77E 1BIBA 3LGFA 4RCBA 3JCMc 3CCRT 4ZGDB 1QVPA 1VYVA 3I9QA 1AHJB 1O9SA 2CUDA 5IT9E 5D6WA 5FWCA 2MPXC 3OMGA 4GY5A 4HCCA 1OZ3A 4A4FA 3NFCA 2D9TA 4RCCA 3N5BB 2D8HA 2RJDA 3OYKA 4M7AC 4E7KA 5DM7R 2DIQA 1MMDA 3UT1A 3VYGA 5GANg 4HT9A 3PGGA 3VS7A 1XJWB 3LWIA 1VQ8T 2DNUA 2K2VA 1S72Q 5J39A 3R6OA 2CSQA 1OU9A 2QGGA 1ZA1B 3RKXA 1DJ7B 3VKIA 1X27A 1VQLT 2EQJA 3TSWA 2JS2A 3ZBDA 5FROA 2DEUA 3RDVA 4OVAA 4PLLA 1UGPB 2L8DA 2NUTB 2NUZA 3CCVQ 1W70A 1VQMQ 2DBMA 1PRMC 1ZBJA 3A8MB 1M8VA 4C0ZA 4M7AE 1UG1A 2FZGB 1VQ4Q 5GAMf 2CP5A 1WFWA 1ZA2B 1S1NA 1D0ZA 1VQKQ 2CH4W 1K9MC 1U5SA 3QG1A 1C0MA 3OYDA 1BB9A 1NEBA 1SSHA 1Y96B 3HFOA 1QP2A 9ATCB 1VQOA 3VRYA 3VU3C 1RABB 3META 2FRWA 1JB0E 2COZA 1PC0A 3TVTA 4EMGA 3CMEQ 4BI4A 3EG0A 2RQWA 3A98A 2LP5A 2OAWA 3M4GA 5FU6B 3CCRQ 5D6YA 3CBPA 3OYEA 1ZSZC 4CC4B 3WVDB 5HKCA 1UEBA 2VC8A 4IUVA 3V7CA 2K3BA 3MEVA 4E47A 2VVKA 2E1HA 4LE9A 2EW3A 2DL5A 5GAN8 5GMKl 2W0ZA 1VIFA 1P92A 3HP9A 1X2QA 4M7DG 2NLUA 2L3PA 3H0FA 4L5GA 1Q7YR 1XOVA 3PIOA 2O01E 1M2VA 2K6DA 2VWFA 3OYLA 1RAIB 2AZVA 1M90R 4M77F 7AT1B 3EGXA 3CC2A 1VQ8Q 3G71A 3BW1A 1VQOT 1PSEA 4AMCA 3X24B 3QJYA 5GAMj 2DILA 2VYTA 3NPFA 5GAMg 5KYUB 4BY6C 1NLPC 1VQLQ 1KC8C 1YFNA 2CT3A 2GTJA 1TOVA 3L2QA 3CCEA 4C0GA 4FYYB 3SDZA 2JMAA 2KE9A 5KE2A 2L2PA 1Q86U 2HBWA 2MWPA 1Q81U 1D3BB 2F2WA 1M1KU 3L2WA 1ABOA 2OTLA 1LOJA 2K57A 2JM8A 4DA4A 4LDWA 1XNIA 2YRCA 4C5GA 1AWWA 2M1HA 5HY6A 2HQEA 2OAUA 2ZGWA 4QQGA 2LJ3A 1OI1A 3HRTA 1QVGA 4BB7A 3DB4A 4ATOA 2HNIA 5LJ3g 2R58A 2L3SA 4M78E 3G71T 3HFNA 1RUWA 4EPCA 1C1AA 2P4RA 1AWOA 2HL3A 4XTWA 4DBRA 3JV3A 4A4KA 2XDPA 2PUOB 4DBFA 1N8RR 3CPWA 1RACB 5AYFA 4FCYA 1FX7A 2RQTA 4M7AF 3CCET 1JEGA 1W4SA 3OSVA 3JCMJ 1RAEB 3I55A 2V1QA 4JS4A 2H8HA 1Y7XA 2V1RA 2O88A 2CZ0B 1NYGA 2YRVA 2B8AA 4E7HA 3S3OA 2QTVA 1VYUA 3CXCA 2OTLT 3CD6A 2AKKA 3OB9A 2C06A 1VQ7T 3T9NA 4N0AC 4J6WA 2GNCA 5IH2A 1TS9A 3JCMd 2CUBA 2ROTA 2BKDN 2QXFA 4FYXB 2FRYA 4KH1B 3DKMA 4PFZA 3L42A 4OB0B 4XQ3A 1VQOQ 1Q81C 2XDBA 2FO0A 3VUZA 1M1KC 3TCJA 4LDYA 4JUVA 2J05A 4EIKA 1TU0B 2RPNA 3QDRB 3HPWA 1GFCA 5GANh 1WYXA 3VS3A 2YUOA 2CP3A 1XQHA 1RLQC 2RD1A 2EJGA 1QVGS 2RHIA 2Y4YA 2QTXA 3M5AA 1LJOA 3VS6A 2QGFB 1X6OA 2FVUA 3X28B 2E10A 4A54A 2D8JA 4LUEA 4PKCC 1NJIR 1BU1A 3PIPA 1SF9A 3I5SA 3CPWS 2QA4A 1RAFB 2QG9B 2VKNA 4Y91A 3EGXB 1QVGP 3E2UA 2DTHA 4DOVA 1UGVA 3CC2Q 4C0DC 3G71Q 2DLPA 3CXCS 2LQKA 3SB2A 2CP2A 1GFDA 3RESA 2LZ6B 2Y90A 2EYXA 3LX7A 2XK0A 2F5KA 5FU6C 3CPWP 3CCEQ 5GAN7 2MK5A 1R0CB 3GOXA 4ELZC 4X9DA 2E12A 2JTMA 4LDUA 3HTRA 5A0GA 2VGNA 2OTLQ 2PNIA 5CQYA 3CXCP 5GAMe 4MDXA 2QQRA 3QKJA 2E3IA 3QZ9B 1UGSB 2JMCA 5I11A 2QA4T 4M7DC 4RTUA 4DBQA 2P4TA 2DD5A 2PVDB 2VXFA 1FXXA 2HZYA 1IB8A 3ULRB 1E6GA 3FRNA 4LDVA 2FL7A 5GMKj 1JXOA 1MMAA 1FMVA 1QKXA 5IHNA 1M3BA 1M27C 1OYXA 3VS5A 2K2MA 2R5AA 3CCMT 4DBHA 1M90U 4E6RA 2QQAA 4Z89A 3ZFJA 3I55Q 3OYJA 3M0QA 2KROA 1LVKA 2R5MA 2PUKB 4ZTJA 4KUIA 3M0UA 3CD6Q 4M7DE 2ZPFB 2HMAA 3BFMA 4YTLA 1QWEA 1K4US 2XHCA 4J8OA 4GLMA 4QKUA 1GRIA 4E7SA 2RA2A 3SWNA 2IPOB 3CCQT 2FPFA 2LDMA 2DEQA 5ECAA 5A0LA 3LGLA 2DK3A 2DRKA 1PHTA 5LJ3h 4JZ3A 1J3TA 1YJ9T 2HEQA 2M9UA 3S3NA 4OGEA 4OB1B 3HKSA 2FB7A 4CC7A 2DZ9A 3LH5A 5KYNA 1OULA 2YSQA 1FWZA 2YT6A 1N8RU 3VYHB 5KCOA 3MP6A 1EFNA 2AIRB 2QA4Q 3QXEB 3O8VA 3KUFA 1VYTA 1B7TA 3EAEA 5FU7B 3C4SA 4C5EA 1ZHIA 3H0IA 1MUZA 1JJ2S 3D7SB 4XTUA 3FDRA 5AT1B 2EQIA 2F2XA 2LNVA 4HCKA 4PJOC 3KBGA 3G1JA 3VRZA 1WHKA 1N6AA 1UTIA 4OMPA 1D0YA 2X3WD 2EGEA 6AT1B 3JCMf 1M9SA 2AHJB 1ZX6A 3EHQA 1T0JA 2QDLA 3EFRA 4O5VA 2AT1B 2E64A 1M8MA 4WTOB 3TU4K 2IVWA 2FZCB 1K73R 4PL6A 1RAAB 1WNLA 2BTTA 2LVMA 3U23A 1I5OB 2EBPA 4XAXB 1U8RA 2AKLA 4IUQA 3H9NA 1IO6A 2RJFA 2KBTA 3PVLA 3TREA 1FYNA 3AHUA 2DKGA 1I5LA 2HQHA 4RUGA 1H3ZA 4E7LA 3L2ZA 1VQ9T 1I0CA 2K5IA 3UDCA 3M55A 1WXBA 3E1SA 3CCQQ 2EQUA 2KAFA 5DLQE 2RB6A 2PTKA 2EYWA 1WQ7A 2OX7A 4QVCA 4HVUA 4QT7A 2SRCA 4XTZA 2E5KA 1YI2A 4BUGA 3HHTB 2RHZA 1YHQA 4M7DF 3AT1B 2JTEA 2CYZB 1W6XA 3G4SA 2ED1A 2D0NA 2LJ1A 3TSZA 1G3WA 2A36A 4JRKA 4B6MA 4PFPA 1VQNA 4O6JA 1GCQA 5KYYA 3JCMP 1BCOA 5LJ5j 5DLOA 3P8DA 3BY7A 2CP0A 3E19A 4E7JA 1OX9A 2GQVA 2E4HA 2ZPIB 3VS4A 2X4XA 1QWFA 4QVDA 4ELYC 3SWNB 2QEXA 3LWHA 4UC4A 2LMJA 2MF2A 1AZGB 2ED0A 4XTXA 5I22A 3V8KA 1BI1A 2QQSA 3MEAA 2DL3A 3FLGA 5GAN6 3GLXA 1Y0MA 2K7AA 1YI2T 1I8FA 2IIMA 2X51A 1HK9A 4M75D 1YHQT 3GP8A 1QQJA 1EX4A 2ZPHB 3UWNA 2XG8D 3G4ST 2O9VA 4HVVA 4KBMB 1IGQA 3IQLA 1H3HA 1X2KA 2MAMA 1MNEA 4HVWA 1KIKA 3QBYA 2J06A 1VQNT 4RTZA 2GFUA 5HK3A 3JCMQ 3CCUA 1N27A 2CKKA 3VV0A 4E2FB 1T3SA 1E6HA 3JCMW 1YWPA 2FHDA 1ZQ1A 1TG0A 2DYIA 2DETA 1T0HA 4TVRA 4PFOA 1KD1R 3F70A 4IIOA 2KNBB 4M75A 4C92D 1UB4A 5KYWA 2QEXT 1ZUKA 2O4XA 2XDDA 2L89A 2VUBA 1YWOA 1FMKA 2D6FA 3TQ7P 2GTOA 2RH2A 4AG2C 2CT4A 4IUTA 3R6NA 3PTAA 4BE0A 3I56A 1YP5A 4KGVB 3URGA 4KUDK 4F04B 4FU6A 4X9CA 4LD6A 2IG0A 3SD4A 4PJOF 4RMOA 3CQTA 3QWYA 4C92A 1OX8A 3CCUT 3M0RA 1HYOA 5HK0A 1K8AR 4OGCA 1BI0A 3LYIA 4R56A 1SRMA 1AVZC 5J26A 4AFSC 1AWJA 5CVIA 3JB9I 4ZN3A 3CCST 3A8LB 3MHXA 4MDWA 3CPFA 4QQ6A 3OS5A 1W1FA 2RHXA 1KQ1A 2M0OA 1YI2Q 4M78C 1HXDA 2LQ8A 1YHQQ 4LXCA 1UECA 4CC2A 5GAOn 2PU9B 4BE2A 3H8ZA 2QQ9A 4OMLA 3G4SQ 1D09B 1G3TA 3BDLA 4C8QD 3OYFA 3A8HB 2HKNA 3I56T 4HCZA 1YCYA 4PNOA 1BBZA 2P0PA 1JQQA 3VS2A 3REBB 1VQNQ 2RQVA 2J7IA 5KYYB 4WF2A 3QIIA 4FSXA 1OEBA 1VQ7A 3NMZC 1TSFA 4M7AD 2DM1A 1TUGB 1ZUYA 4N4HA 2DX1A 2X9HA 2JVVA 4DEXA 2DXTA 1PG5B 2LNHB 4C5HA 1UFFA 1X01A 3A1PA 2A0FB 2QEXQ 4IURA 1PD0A 2QDYB 4C8QA 1SRLA 3JCMe 1Q82R 2GFAA 5CKHA 5LJ5e 3RUXA 2YXYA 5CKDA 3FC3A 3H6ZA 1KHIA 2GGRA 2NUPA 4M7AA 1YBYA 5DY9A 4JJDA 1TTHB 2CSIA 1AT1B 1G5VA 2YUNA 3SFMA 4PJMA 1WXTA 3CCUQ 4IIMA 4J9IA 3FEOA 4F7UA 1V29B 4AFQC 3J81E 2KT1A 4D8KA 4M75G 5LJ5d 1N9RA 3JB9J 4M75B 5KYWB 1AWXA 3SWNC 4ZGEB 1Q86C 3OA6A 1OOTA 2O4XB 1K0SA 2JJ9A 8AT1B 4FW2A 2ENMA 2E6ZA 1PCXA 1WJQA 4LUDA 3RKYA 2CGHA 2G6FX 2DTIA 1I4K1 3A5ZB 2F5TX 1NYFA 3PFSA 2FZKB 3OBYA 3QO3A 1NEGA 2KSSA 3BDUA 3I56Q 5GANd 4C92G 4XK8E 1G3YA 4JRPA 3OYNA 4L59A
chains in the Genus database with same CATH topology
4GLMA 1JO8A 1VYVA 3I9QA 1GRIA 3UA7A 4JZ4A 2RN8A 2CUDA 1K1ZA 2O31A 4J9BA 5FWCA 1G2BA 2DJQA 1AZEA 2FPFA 1GBRA 3EG3A 4J9DA 2LQNA 4KRTA 4M4ZA 5GJVB 5ECAA 5IHKA 2J6OA 2DRKA 1PHTA 3SHWA 1M3CA 4JZ3A 4ORZA 1J3TA 1AD5A 4J9HA 2D8HA 2KT8A 2HEQA 3UATA 3VS7A 1BK2A 4CC7A 3LH5A 2YSQA 2YT6A 4OMMA 3UA6A 1OV3A 1UE9A 3GBQA 1EFNA 2DNUA 2OJ2A 2JT4A 1WIEA 2W10A 2CSQA 2EYYA 2RF0A 1HD3A 1HSQA 1VYTA 1QLYA 1X27A 1SPKA 4DEYA 3TSWA 2XMFA 1VA7A 2JS2A 2KYBA 3H0IA 2L3QA 1MUZA 1U3OA 2ROLA 2EQIA 1WDXA 2F2XA 1N5ZA 4HCKA 3M0TA 1RLPC 2NUZA 2EGCA 1W70A 1AOJA 1JU5C 3VRZA 1UTIA 2JW4A 4OMPA 2DBMA 2X3WD 1PRMC 1ZBJA 2EGEA 1KJWA 2J6FA 3EGUA 1UG1A 1ZX6A 1ZUUA 3EHQA 2MIOA 1WFWA 1T0JA 2KR3A 2QDLA 1S1NA 4LNPA 2CH4W 1UUEA 1M8MA 1HJDA 1U5SA 3NGPA 2DYBA 2RQUA 3UF4A 1BB9A 1NEBA 1SSHA 3ZL7C 5FWBA 2EPDA 3I5RA 2GBQA 2BTTA 3U23A 2KGTA 2EBPA 3VRYA 2AKLA 4RTXA 4FSSA 1IO6A 2KBTA 1YN8A 2FRWA 3PVLA 1WXUA 1FYNA 1UHCA 3M0PA 2RMOA 1G83A 5GJWB 3TVTA 4RUGA 2FPDA 3EG0A 2RQWA 3A98A 1I0CA 2GQIA 2LP5A 3M0SA 2OAWA 1GCQC 4GBQA 1E7OA 4Z88A 2DRMA 1WXBA 4CC4B 1CKAA 2DE0X 1WI7A 2K3BA 2PTKA 2EYWA 2VVKA 3THKA 4LE9A 2EW3A 4HVUA 4QT7A 2DL5A 1X69A 2SRCA 2E5KA 2F2VA 2W0ZA 5IHIA 1X6BA 1X2QA 2KRMA 2L3PA 2JTEA 1SEMA 3H0FA 1W6XA 1XOVA 4LN2A 2ED1A 2KEAA 1UDLA 2D0NA 2LJ1A 3TSZA 2A36A 2K6DA 1MV0B 1YCSB 2VWFA 4F17A 2KRNA 2AZVA 2KYMA 1GCQA 5IXBA 1GBQA 2HSPA 2DILA 3NPFA 1NLPC 2CT3A 2GTJA 4AG1C 3VS4A 1I1JA 1QWFA 1B3QA 2AK5A 2JMAA 2KE9A 2A08A 2HDAA 2L2PA 2O2OA 3RNJA 2LMJA 2HBWA 2M51A 1V1CA 1AZGB 2ED0A 2F2WA 5I22A 4J9GA 2C0TA 1PKTA 1NG2A 1ABOA 2DL3A 1PNJA 2JM8A 2CREA 1Y0MA 2K7AA 2IIMA 1H92A 3H41A 2A28A 1AWWA 4CC3A 4F14A 2MCNA 1ZLMA 4RTTA 1PWTA 1ZSGA 2O9VA 4HVVA 3FJ5A 3IQLA 1H3HA 1X2KA 2LJ3A 4HVWA 1KIKA 2J06A 2AZSA 3VS0A 4RTZA 2L3SA 2MOXA 1RUWA 4Y92A 1T3SA 1E6HA 2P4RA 1AWOA 2D1XA 1ARKA 1YWPA 1TG0A 1UHFA 3JV3A 4F16A 1T0HA 1GCPA 3RBBB 4X1VA 1OPKA 1TUCA 1AEYA 4R0KA 4IIOA 2RQTA 2KNBB 1JEGA 2CDTA 2V1QA 2H8HA 2V1RA 1PRLC 2DL8A 2O88A 1M3AA 1ZUKA 4AFZC 1NYGA 2YUQA 1YWOA 3EHRA 1Z9QA 1VYUA 2RNAA 1FMKA 2GTOA 4JJBA 1B07A 3SEMA 1K0XA 2AKKA 4AG2C 2CT4A 2B86A 2FPEA 1M30A 2GNCA 5IH2A 3R6NA 2DVJA 2CUBA 1NM7A 2ROTA 1YP5A 2DF6A 2FEIA 1K9AA 5FW9A 2FRYA 1MV3A 1OPLA 1WA7A 4Z8AA 3CQTA 1QCFA 2FO0A 1Y57A 2ECZA 3QWYA 2JXBA 1X6GA 2J05A 3M0RA 1RI9A 4EIKA 2RPNA 1GL5A 2JS0A 1GFCA 3NHNA 2L0AA 2X3XD 2I0NA 1PKSA 1SRMA 1WYXA 3VS3A 1KSWA 1AVZC 2YUOA 4AFSC 1AWJA 2EVRA 1RLQC 2LJ0A 1ABQA 1YNZA 4A63B 1WLPB 3VS6A 1W1FA 2LQWA 2D8JA 4LUEA 2BZ8A 4OMQA 1UECA 2J6KA 4CC2A 1BU1A 4HXJA 1CSKA 3I5SA 4OMLA 1TUDA 1BBZA 2PZ1A 1JQQA 2VKNA 2DL7A 3VS2A 3H0HA 3REBB 4AFUC 4J9CA 2RQVA 2J7IA 2DA9A 2K9GA 1UGVA 4J9EA 2DLPA 1OEBA 1T3LA 3NMZC 4RTWA 1GFDA 2DM1A 1ZUYA 2A37A 3VS1A 2DX1A 2LZ6B 2EYZA 3EG2A 2EYXA 4JJCA 5EC7A 1QKWA 4DEXA 1X43A 2DMOA 3EG1A 2LNHB 1UFFA 2C0OA 2KRSA 2CH4A 2ABLA 3C0CA 3I35A 1SRLA 2BZXA 1Z9ZA 2YUPA 3REAB 2PNIA 1NLOC 1UJYA 4K11A 2JM9A 2GGRA 1KFZA 2JMCA 2LCSA 2O9SA 2SEMA 5I11A 2C0IA 2OI3A 2EGAA 4JJDA 4RTUA 2KXDA 2CSIA 4WCIA 2DL4A 2LX7A 2YUNA 1WX6A 3KFVA 1SHGA 1WXTA 3ULRB 4IIMA 1LCKA 4J9IA 1E6GA 1K76A 4AFQC 4ESRA 2YDLA 1JXOA 4D8DA 2KT1A 4D8KA 2HCKA 5IHNA 1QKXA 2M0YA 1SHFA 1M3BA 1M27C 3VS5A 2K2MA 2KXCA 4E6RA 4RTYA 4ZNXA 1AWXA 4OMNA 4Z89A 3O5ZA 2K79A 3PVQA 1OOTA 3M0QA 3QWXX 1A0NB 2ESWA 2KROA 1CKBA 1K0SA 1UJ0A 4JPBW 2ENMA 1U06A 3M0UA 4LUDA 1I07A 1JXMA 4J9FA 5HCKA 2G6FX 5L23A 1NYFA 2EKHA 4RTVA 1NEGA 3PE0A 1QWEA 1H8KA 2BZYA 1K4US 4OMOA 2FG0A 2RQRA 5IXFA 2DBKA 2NWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLM A;  1JO8 A;  1VYV A;  3I9Q A;  1GRI A;  3UA7 A;  4JZ4 A;  2RN8 A;  2CUD A;  1K1Z A;  2O31 A;  4J9B A;  5FWC A;  1G2B A;  2DJQ A;  1AZE A;  2FPF A;  1GBR A;  3EG3 A;  4J9D A;  2LQN A;  4KRT A;  4M4Z A;  5GJV B;  5ECA A;  5IHK A;  2J6O A;  2DRK A;  1PHT A;  3SHW A;  1M3C A;  4JZ3 A;  4ORZ A;  1J3T A;  1AD5 A;  4J9H A;  2D8H A;  2KT8 A;  2HEQ A;  3UAT A;  3VS7 A;  1BK2 A;  4CC7 A;  3LH5 A;  2YSQ A;  2YT6 A;  4OMM A;  3UA6 A;  1OV3 A;  1UE9 A;  3GBQ A;  1EFN A;  2DNU A;  2OJ2 A;  2JT4 A;  1WIE A;  2W10 A;  2CSQ A;  2EYY A;  2RF0 A;  1HD3 A;  1HSQ A;  1VYT A;  1QLY A;  1X27 A;  1SPK A;  4DEY A;  3TSW A;  2XMF A;  1VA7 A;  2JS2 A;  2KYB A;  3H0I A;  2L3Q A;  1MUZ A;  1U3O A;  2ROL A;  2EQI A;  1WDX A;  2F2X A;  1N5Z A;  4HCK A;  3M0T A;  1RLP C;  2NUZ A;  2EGC A;  1W70 A;  1AOJ A;  1JU5 C;  3VRZ A;  1UTI A;  2JW4 A;  4OMP A;  2DBM A;  2X3W D;  1PRM C;  1ZBJ A;  2EGE A;  1KJW A;  2J6F A;  3EGU A;  1UG1 A;  1ZX6 A;  1ZUU A;  3EHQ A;  2MIO A;  1WFW A;  1T0J A;  2KR3 A;  2QDL A;  1S1N A;  4LNP A;  2CH4 W;  1UUE A;  1M8M A;  1HJD A;  1U5S A;  3NGP A;  2DYB A;  2RQU A;  3UF4 A;  1BB9 A;  1NEB A;  1SSH A;  3ZL7 C;  5FWB A;  2EPD A;  3I5R A;  2GBQ A;  2BTT A;  3U23 A;  2KGT A;  2EBP A;  3VRY A;  2AKL A;  4RTX A;  4FSS A;  1IO6 A;  2KBT A;  1YN8 A;  2FRW A;  3PVL A;  1WXU A;  1FYN A;  1UHC A;  3M0P A;  2RMO A;  1G83 A;  5GJW B;  3TVT A;  4RUG A;  2FPD A;  3EG0 A;  2RQW A;  3A98 A;  1I0C A;  2GQI A;  2LP5 A;  3M0S A;  2OAW A;  1GCQ C;  4GBQ A;  1E7O A;  4Z88 A;  2DRM A;  1WXB A;  4CC4 B;  1CKA A;  2DE0 X;  1WI7 A;  2K3B A;  2PTK A;  2EYW A;  2VVK A;  3THK A;  4LE9 A;  2EW3 A;  4HVU A;  4QT7 A;  2DL5 A;  1X69 A;  2SRC A;  2E5K A;  2F2V A;  2W0Z A;  5IHI A;  1X6B A;  1X2Q A;  2KRM A;  2L3P A;  2JTE A;  1SEM A;  3H0F A;  1W6X A;  1XOV A;  4LN2 A;  2ED1 A;  2KEA A;  1UDL A;  2D0N A;  2LJ1 A;  3TSZ A;  2A36 A;  2K6D A;  1MV0 B;  1YCS B;  2VWF A;  4F17 A;  2KRN A;  2AZV A;  2KYM A;  1GCQ A;  5IXB A;  1GBQ A;  2HSP A;  2DIL A;  3NPF A;  1NLP C;  2CT3 A;  2GTJ A;  4AG1 C;  3VS4 A;  1I1J A;  1QWF A;  1B3Q A;  2AK5 A;  2JMA A;  2KE9 A;  2A08 A;  2HDA A;  2L2P A;  2O2O A;  3RNJ A;  2LMJ A;  2HBW A;  2M51 A;  1V1C A;  1AZG B;  2ED0 A;  2F2W A;  5I22 A;  4J9G A;  2C0T A;  1PKT A;  1NG2 A;  1ABO A;  2DL3 A;  1PNJ A;  2JM8 A;  2CRE A;  1Y0M A;  2K7A A;  2IIM A;  1H92 A;  3H41 A;  2A28 A;  1AWW A;  4CC3 A;  4F14 A;  2MCN A;  1ZLM A;  4RTT A;  1PWT A;  1ZSG A;  2O9V A;  4HVV A;  3FJ5 A;  3IQL A;  1H3H A;  1X2K A;  2LJ3 A;  4HVW A;  1KIK A;  2J06 A;  2AZS A;  3VS0 A;  4RTZ A;  2L3S A;  2MOX A;  1RUW A;  4Y92 A;  1T3S A;  1E6H A;  2P4R A;  1AWO A;  2D1X A;  1ARK A;  1YWP A;  1TG0 A;  1UHF A;  3JV3 A;  4F16 A;  1T0H A;  1GCP A;  3RBB B;  4X1V A;  1OPK A;  1TUC A;  1AEY A;  4R0K A;  4IIO A;  2RQT A;  2KNB B;  1JEG A;  2CDT A;  2V1Q A;  2H8H A;  2V1R A;  1PRL C;  2DL8 A;  2O88 A;  1M3A A;  1ZUK A;  4AFZ C;  1NYG A;  2YUQ A;  1YWO A;  3EHR A;  1Z9Q A;  1VYU A;  2RNA A;  1FMK A;  2GTO A;  4JJB A;  1B07 A;  3SEM A;  1K0X A;  2AKK A;  4AG2 C;  2CT4 A;  2B86 A;  2FPE A;  1M30 A;  2GNC A;  5IH2 A;  3R6N A;  2DVJ A;  2CUB A;  1NM7 A;  2ROT A;  1YP5 A;  2DF6 A;  2FEI A;  1K9A A;  5FW9 A;  2FRY A;  1MV3 A;  1OPL A;  1WA7 A;  4Z8A A;  3CQT A;  1QCF A;  2FO0 A;  1Y57 A;  2ECZ A;  3QWY A;  2JXB A;  1X6G A;  2J05 A;  3M0R A;  1RI9 A;  4EIK A;  2RPN A;  1GL5 A;  2JS0 A;  1GFC A;  3NHN A;  2L0A A;  2X3X D;  2I0N A;  1PKS A;  1SRM A;  1WYX A;  3VS3 A;  1KSW A;  1AVZ C;  2YUO A;  4AFS C;  1AWJ A;  2EVR A;  1RLQ C;  2LJ0 A;  1ABQ A;  1YNZ A;  4A63 B;  1WLP B;  3VS6 A;  1W1F A;  2LQW A;  2D8J A;  4LUE A;  2BZ8 A;  4OMQ A;  1UEC A;  2J6K A;  4CC2 A;  1BU1 A;  4HXJ A;  1CSK A;  3I5S A;  4OML A;  1TUD A;  1BBZ A;  2PZ1 A;  1JQQ A;  2VKN A;  2DL7 A;  3VS2 A;  3H0H A;  3REB B;  4AFU C;  4J9C A;  2RQV A;  2J7I A;  2DA9 A;  2K9G A;  1UGV A;  4J9E A;  2DLP A;  1OEB A;  1T3L A;  3NMZ C;  4RTW A;  1GFD A;  2DM1 A;  1ZUY A;  2A37 A;  3VS1 A;  2DX1 A;  2LZ6 B;  2EYZ A;  3EG2 A;  2EYX A;  4JJC A;  5EC7 A;  1QKW A;  4DEX A;  1X43 A;  2DMO A;  3EG1 A;  2LNH B;  1UFF A;  2C0O A;  2KRS A;  2CH4 A;  2ABL A;  3C0C A;  3I35 A;  1SRL A;  2BZX A;  1Z9Z A;  2YUP A;  3REA B;  2PNI A;  1NLO C;  1UJY A;  4K11 A;  2JM9 A;  2GGR A;  1KFZ A;  2JMC A;  2LCS A;  2O9S A;  2SEM A;  5I11 A;  2C0I A;  2OI3 A;  2EGA A;  4JJD A;  4RTU A;  2KXD A;  2CSI A;  4WCI A;  2DL4 A;  2LX7 A;  2YUN A;  1WX6 A;  3KFV A;  1SHG A;  1WXT A;  3ULR B;  4IIM A;  1LCK A;  4J9I A;  1E6G A;  1K76 A;  4AFQ C;  4ESR A;  2YDL A;  1JXO A;  4D8D A;  2KT1 A;  4D8K A;  2HCK A;  5IHN A;  1QKX A;  2M0Y A;  1SHF A;  1M3B A;  1M27 C;  3VS5 A;  2K2M A;  2KXC A;  4E6R A;  4RTY A;  4ZNX A;  1AWX A;  4OMN A;  4Z89 A;  3O5Z A;  2K79 A;  3PVQ A;  1OOT A;  3M0Q A;  3QWX X;  1A0N B;  2ESW A;  2KRO A;  1CKB A;  1K0S A;  1UJ0 A;  4JPB W;  2ENM A;  1U06 A;  3M0U A;  4LUD A;  1I07 A;  1JXM A;  4J9F A;  5HCK A;  2G6F X;  5L23 A;  1NYF A;  2EKH A;  4RTV A;  1NEG A;  3PE0 A;  1QWE A;  1H8K A;  2BZY A;  1K4U S;  4OMO A;  2FG0 A;  2RQR A;  5IXF A;  2DBK A;  2NWM A; 
#chains in the Genus database with same CATH topology
 1MND A;  4C92 B;  1RI0 A;  4CI0 C;  4JZ4 A;  2RN8 A;  1Q95 G;  4KGX B;  2YLC A;  4J9B A;  1GXI E;  2MWO A;  3EG3 A;  4Z02 A;  4J9D A;  2E3H A;  1M2V B;  2RM4 A;  1YIJ A;  1FMW A;  4M4Z A;  2K3Y A;  5IHK A;  1ZSZ A;  2J6O A;  2RI5 A;  1TWB A;  1M3C A;  2VB6 A;  4ORZ A;  1AD5 A;  1SSF A;  4J9H A;  2KQW A;  1RAG B;  3E9F A;  3UAT A;  2RO0 A;  3UA6 A;  3CCM A;  1OV3 A;  1KD1 U;  2OJ2 A;  2JT4 A;  4KT0 E;  4A4G A;  3EFS A;  2W10 A;  1K9M R;  3OYM A;  1SPK A;  4DEY A;  1R77 A;  2XMF A;  3L1A A;  1VA7 A;  2KYB A;  2GF7 A;  2L3Q A;  4PK4 A;  5C6S A;  2ROL A;  4NOY A;  1VQ7 Q;  1WDX A;  1BI2 A;  1BYM A;  3M0T A;  1RLP C;  1YIT A;  4M78 F;  2EGC A;  1JU5 C;  4ME7 A;  2KVQ G;  2CZ7 B;  3MCA B;  3OW2 A;  5CK9 A;  4C8Q G;  5KYX A;  1YIJ T;  2J6F A;  3EGU A;  3BE3 A;  3L2U A;  1LNX A;  3CCL A;  4C8Q B;  1B34 A;  1RAH B;  3CCQ A;  3NGP A;  2RQU A;  3OYI A;  1Q7Y U;  2EQK A;  2LT4 A;  2EPD A;  3I5R A;  5GAO p;  4M7A G;  2ZPE B;  3RMS A;  2DIG A;  3LH0 A;  3NTK A;  3FIF A;  2RI3 A;  2WSF E;  4RTX A;  2NUP B;  2YHT A;  4FSS A;  4M7A B;  1YN8 A;  2Z0W A;  1WXU A;  1VIE A;  3M0P A;  2RMO A;  4MML A;  2K3X A;  4JDS A;  5GJW B;  2XD0 A;  1YJ9 A;  5GAM h;  2GQI A;  3M0S A;  4F7U G;  2M02 A;  5D6X A;  3GNF B;  5GAO m;  1JJ2 A;  1GCQ C;  4Q5W A;  2DRM A;  4F7U B;  1CKA A;  2DE0 X;  1SKU B;  3FJP A;  1YIT T;  1KC8 R;  3LLR A;  5GAN 5;  2F2V A;  3GIB A;  1X6B A;  3QHS A;  2KK4 A;  2KRM A;  1SEM A;  1XTD A;  5FRM A;  4LN2 A;  3CCL T;  4E7Z A;  1UDL A;  3MEU A;  3CMA A;  2HSE B;  5I21 A;  4F17 A;  2KRN A;  2CZ6 B;  4BAC A;  3RER A;  3EH1 A;  1GBQ A;  3OW2 S;  3QUI A;  2WSC E;  3L2V A;  4HKE A;  4AG1 C;  3JB9 D;  1I1J A;  1WHJ A;  1X75 C;  1B3Q A;  5KH6 A;  2AK5 A;  3RNJ A;  3C95 A;  5GAN 4;  2CZ1 B;  1Q7Y C;  1V1C A;  2X35 A;  3JAM E;  1NG2 A;  3A8O B;  2BIV A;  2COW A;  1ZSZ B;  3KXT A;  1YIJ Q;  5CAI A;  3OW2 P;  1M90 C;  1VQ9 A;  3OY9 A;  3OQ5 A;  4A4H A;  4LDX A;  4CC3 A;  3OS1 A;  2MCN A;  1QVF A;  4RTT A;  3ASK A;  2EKO A;  4QW2 A;  3CMA T;  2DXU A;  4J6Y A;  3E9G A;  1BIA A;  3ER0 A;  3VS0 A;  3CCM Q;  2L5Q A;  5LJ5 f;  2LC4 A;  2D1X A;  1ARK A;  3PT9 A;  1H64 1;  2H3E B;  1UHF A;  1YJW A;  2H3J A;  1KQS A;  4F16 A;  4DOW A;  1JJ2 P;  4X1V A;  1Q81 R;  1TUC A;  1UGQ B;  4R0K A;  2KDS A;  4C92 C;  1S72 T;  1M1K R;  3OS2 A;  4M7D D;  2DL8 A;  1YIT Q;  1U1S A;  2YUQ A;  5KCH A;  2RHY A;  4M75 E;  1Z9Q A;  2XID A;  2RNA A;  5KYX B;  1B07 A;  3SEM A;  4J5Y A;  3X25 B;  1SG5 A;  2CP6 A;  1M30 A;  2D0Q B;  5GAN f;  3CCL Q;  2DVJ A;  4EMK A;  1NM7 A;  3OYY A;  2P0K A;  4PJJ A;  2FEI A;  1NJI U;  1K9A A;  2DXC A;  3Q1J A;  1MV3 A;  3M53 A;  4Z8A A;  1N8R C;  1Y57 A;  1TH7 A;  2JXB A;  2HKQ B;  4M7D A;  4OP0 A;  3QZ5 B;  2HL5 C;  4OB2 B;  2DPP B;  2G3R A;  3INZ A;  1GL5 A;  2JS0 A;  4C92 E;  3OYC A;  1MMN A;  3NHN A;  2L0A A;  1YJ9 Q;  1PKS A;  1WQW A;  1YJW T;  1QVF S;  1IGU A;  1KSW A;  5GMK e;  3M57 A;  1ACM B;  1IRE B;  2LJ0 A;  3JCM g;  2GCX A;  1YNZ A;  5LJ5 g;  4A63 B;  5A2Q E;  1K9M U;  2RJC A;  1WLP B;  5D7U A;  3OBW A;  1JBM A;  4B9X A;  4JLG A;  5GAO q;  1EZZ B;  2LQW A;  4XU0 A;  4FT2 A;  2RI2 A;  1V76 A;  2BZ8 A;  4KH0 B;  5CKE A;  1KQS S;  2J6K A;  1D3B A;  3CBO A;  4C8Q C;  1QVF P;  4CRI A;  1TUD A;  3J80 E;  3CMA Q;  2WSE E;  3PNW C;  5FRN A;  2DL7 A;  1TXQ A;  3H0H A;  4AFU C;  4FL6 A;  4J9C A;  1VQ5 A;  2DA9 A;  4QQD A;  2XIC A;  2RK1 A;  2MYS A;  4J9E A;  3DLL A;  3CC7 A;  1YJN A;  3JRZ A;  3MKD A;  4RTW A;  3JCM b;  4BDZ A;  5GAN j;  3MP1 A;  4N4G A;  2A37 A;  3OS0 A;  2MI6 A;  5GMK h;  5EC7 A;  1QKW A;  1KQS P;  3LW5 E;  1X43 A;  4IKF A;  4KGZ B;  2DMO A;  5C0M A;  1QW1 A;  3CCJ T;  2KRS A;  1NJI C;  4GLK A;  2JUF A;  3CBM A;  3I35 A;  3L2R A;  2BZX A;  3PMI A;  3M9Q A;  3MEW A;  2BE7 D;  2HAX A;  2VAS A;  2CS7 A;  2DAQ A;  2YUP A;  1UJY A;  4K11 A;  2JM9 A;  4C8Q E;  2ZPG B;  4JRQ A;  1MGQ A;  1VQ9 Q;  3CEY A;  3CCS A;  3OYB A;  1KFZ A;  1WHL A;  4PJO D;  2LCS A;  2E70 A;  1OQK A;  2O9S A;  3JB9 G;  2SEM A;  2PQW A;  2OI3 A;  4FT4 A;  2KXD A;  4OB3 B;  3QYG B;  4V2S A;  2DL4 A;  1KC8 U;  4FW1 A;  1M5Q 1;  2LTO A;  8ATC B;  2PVG B;  2DER A;  1WX6 A;  3KFV A;  3EFO A;  1VQ5 T;  4MZP A;  2YWW A;  5CKF A;  3HRU A;  1LCK A;  2JZ2 A;  3V8L A;  3CC7 T;  1YJN T;  2QK0 A;  2ZAE A;  4M77 D;  4M75 F;  3DB3 A;  1YJW Q;  3JSC A;  3S3M A;  4C0D B;  3P8H A;  4F7U E;  3G6E A;  2ZCF B;  3MJX A;  1IZ6 A;  1VOM A;  4JLI A;  4LD9 K;  2KXC A;  4ZNX A;  2DD4 A;  3O5Z A;  2K79 A;  3PVQ A;  4PJO A;  3QWX X;  3MO8 A;  3QYH B;  2ESW A;  1CKB A;  2EJ9 A;  2XKO C;  1UGR B;  5GMK m;  4FIB A;  3DLM A;  1U06 A;  2XI9 A;  2YLB A;  5HCK A;  5L23 A;  5FU7 C;  4EMK B;  2EKH A;  4RG8 A;  1WZO A;  3RR6 A;  4XTV A;  4M77 A;  3PE0 A;  4IUU A;  2DZC A;  1H8K A;  2BZY A;  5LJ3 f;  4OMO A;  5GAO r;  4C92 F;  2FG0 A;  4OF1 A;  5IXF A;  4MZM A;  2DBK A;  1U1T A;  2NWM A;  2EWN A;  2EAY A;  3OYH A;  1JO8 A;  1M2O A;  2BUD A;  4M7D B;  3UA7 A;  1D1B A;  1K1Z A;  2O31 A;  4OMF B;  1G2B A;  2DJQ A;  1AZE A;  1GBR A;  2LCC A;  2QAS A;  1OU8 A;  2LQN A;  4KRT A;  3X26 B;  1QCN A;  3QJ6 A;  2P84 A;  5GJV B;  3G6E T;  3CCJ Q;  4EDU A;  2M16 A;  3SHW A;  1KQ2 A;  3TEE A;  2V8I A;  1G8X A;  2LT1 A;  3EG9 A;  2KT8 A;  3WXM B;  2ZPB B;  1BK2 A;  4KUL A;  4IUP A;  4OMM A;  5I2S A;  1UE9 A;  3GBQ A;  1K73 U;  1R8O B;  1WIE A;  2EYY A;  2RF0 A;  1HD3 A;  1HSQ A;  3J7A F;  1QLY A;  1G3S A;  4HA8 A;  2LRQ A;  1VQ5 Q;  3UPU A;  1OZ2 A;  1U3O A;  2ATC B;  3ZEH A;  1BCM A;  5A0D A;  3CC7 Q;  2QAZ A;  5FLX E;  3JCM X;  1YJN Q;  5CIU A;  1N5Z A;  4MZT A;  3HL8 A;  2DO3 A;  1N9S A;  1AOJ A;  5LJ3 j;  3ME9 A;  2JW4 A;  2RHU A;  2V8J A;  3CC2 T;  4C8Q F;  1KJW A;  4ANJ A;  2KMT A;  2DFU A;  1ZUU A;  2MIO A;  2KR3 A;  1C6V X;  4HCB A;  4LNP A;  1UUE A;  4N4I A;  5CKB A;  1HJD A;  2DYB A;  3UF4 A;  2V8K A;  3ZL7 C;  2JN0 A;  5FWB A;  5GAN e;  2GBQ A;  2NYS A;  3M4Y A;  2KGT A;  3OSS C;  2A3L A;  5M9O A;  3V7R A;  1RAD B;  2E65 A;  5CR2 A;  3CCS Q;  2KI7 A;  4P5N A;  4J83 A;  1BKB A;  3C94 A;  1UHC A;  3P8B B;  3JCM h;  1G83 A;  5LJ5 h;  2FPD A;  4FYV B;  4C0F A;  4F7U F;  2K5L A;  3EFO B;  4QVZ A;  4GBQ A;  2K5F A;  1E7O A;  2QYZ A;  4Z88 A;  4XU3 A;  1IHV A;  4DQ2 A;  2RK2 A;  1WI7 A;  1VQP A;  1KHC A;  4PJO G;  3THK A;  1WHM A;  1X69 A;  4A53 A;  3G6E Q;  1K73 C;  5KE3 A;  5IHI A;  1EIF A;  4PJO B;  5J3B A;  4II1 A;  1QCO A;  2KEA A;  2DXB A;  3CC4 A;  2DVE A;  1MV0 B;  1YCS B;  3S6W A;  2ZZD A;  1IHW A;  5CQX A;  4X34 A;  4M77 G;  2KYM A;  2EJF A;  2EYQ A;  3I55 T;  5IXB A;  4PLI A;  3VJP A;  2CP7 A;  2HSP A;  4M77 B;  4BE1 A;  4A4E A;  1RL2 A;  4M78 D;  5EG2 A;  3CD6 T;  2EFI A;  2JNG A;  4R55 A;  3MP8 A;  5I2M A;  2A08 A;  2HDA A;  2O2O A;  4FM4 B;  2M51 A;  4L6V 5;  3MPU B;  4J9G A;  3GPL A;  2C0T A;  1PKT A;  1VQP T;  1PNJ A;  3GNG A;  2CRE A;  4C5I A;  3M56 A;  3EH2 A;  3EGD A;  1H92 A;  3H41 A;  2A28 A;  4F14 A;  1BI3 A;  3EG9 B;  1ZLM A;  1PWT A;  1ZSG A;  3FJ5 A;  3V7S A;  4M78 A;  1VUB A;  3CC4 T;  3OYG A;  3GF5 A;  3M54 A;  1LPL A;  2AZS A;  1WPY A;  2MOX A;  1D1C A;  1W2B A;  4XTY A;  1MHN A;  3A8G B;  2VGM A;  4Y92 A;  4EMK C;  3RMQ A;  4ZN1 A;  2E5Q A;  3JB9 H;  2X4J A;  1GCP A;  3RBB B;  5GAN 2;  1K8A U;  1OPK A;  2VV5 A;  5IN1 A;  4ZGJ B;  1AEY A;  3PMT A;  1O75 A;  2OTJ A;  2CDT A;  3VUB A;  1PRL C;  3X20 B;  1M3A A;  4E7I A;  4AFZ C;  4JRI A;  2Y4X A;  3EHR A;  1NE8 A;  4JJB A;  1K0X A;  2PVO B;  1M1G A;  1IXD A;  4AT1 B;  4NL3 A;  2B86 A;  4Y28 E;  2FPE A;  2V26 A;  3M59 A;  1JRI A;  2DF6 A;  1VQ6 A;  2X4W A;  5GAM d;  5FW9 A;  5CCA A;  1WJR A;  3G7Z A;  3JCM V;  1OPL A;  1WA7 A;  2COY A;  1QCF A;  1KD1 C;  5LJ3 e;  2ECZ A;  2BE9 B;  4BI3 A;  1X6G A;  4RKU E;  5GAO l;  1Y07 A;  1RI9 A;  4VUB A;  3FB9 A;  3NTH A;  1IRX A;  2F69 A;  2X3X D;  2I0N A;  4NS5 A;  2R57 A;  2RJE A;  2E41 A;  2EVR A;  2FYK A;  1R0B G;  4N0A A;  3HSB A;  2OTJ T;  2E6N A;  1ABQ A;  1NZ9 A;  1NBE B;  4XU1 A;  1W2B S;  1VQP Q;  2HQX A;  4EMH A;  3OMC A;  2DTO A;  2P0Q A;  1Q82 U;  2VXE A;  4OMQ A;  5LJ3 d;  2QQB A;  1S72 A;  4HXJ A;  1CSK A;  3C12 A;  1K8A C;  1QP3 A;  2PZ1 A;  1VQ6 T;  3CC4 Q;  2F1L A;  2KY9 A;  2L3R A;  4PJN A;  2XU8 A;  4FYW B;  2K9G A;  4PJL A;  1T3L A;  1W2B P;  1NPR A;  3HRS A;  4M75 C;  1D1A A;  1WGS A;  3CCV A;  3M58 A;  3VS1 A;  4NL2 A;  2NUT A;  2DJZ A;  2EYZ A;  3EG2 A;  1VQM A;  4JJC A;  4HT8 A;  5L8R E;  4BDY A;  3QSU A;  2I2L A;  3EG1 A;  2C0O A;  1VQ4 A;  1MMG A;  5GAN 3;  2CH4 A;  2QI2 A;  2ABL A;  1PD1 A;  3C0C A;  2HBP A;  1VQK A;  1F1B B;  1I81 A;  1Z9Z A;  2X4Y A;  3REA B;  1NLO C;  2A7Y A;  1Y96 A;  3EGD B;  1KG1 A;  5CO7 A;  1Q86 R;  4M78 G;  3JB9 F;  2C0I A;  4BY6 B;  3OYA A;  2EGA A;  1PSF A;  2JOY A;  2WAC A;  3WVE B;  4M78 B;  3CME A;  4WCI A;  2LX7 A;  3CCR A;  1QMC A;  5GMK i;  1SHG A;  4M77 C;  4RG2 A;  1K76 A;  4ESR A;  3QPH A;  3NTI A;  2YDL A;  4BI8 B;  4J7F A;  4D8D A;  1B34 B;  3CCV T;  2HCK A;  1Q82 C;  2M0Y A;  5LL6 S;  1KK7 A;  1SHF A;  1M4Z A;  1VQM T;  2MMP A;  2YRD A;  4XU2 A;  1M1F A;  1NPP A;  4RTY A;  2JTF A;  4OMN A;  2EQM A;  1D0X A;  2OTJ Q;  3QDF A;  4JJN K;  1VQ4 T;  1Y71 A;  1A0N B;  3RIR A;  4B9W A;  1WHH A;  3RKW A;  1UJ0 A;  4J6X A;  1PM3 A;  1VQK T;  4JPB W;  2HD0 A;  4J7I A;  4PJO E;  1I07 A;  1JXM A;  2LX9 A;  4J9F A;  1VQ8 A;  4MMK A;  2K4Y A;  3CCJ A;  1ZBX A;  1WJS A;  5IAY A;  4RTV A;  4D6W A;  2LCL A;  1WHG A;  1VQ6 Q;  3V8J A;  4JS5 A;  4ZTF A;  1VQL A;  5KYU A;  4BD3 A;  3CME T;  2RQR A;  2EIF A;  4M77 E;  1BIB A;  3LGF A;  4RCB A;  3JCM c;  3CCR T;  4ZGD B;  1QVP A;  1VYV A;  3I9Q A;  1AHJ B;  1O9S A;  2CUD A;  5IT9 E;  5D6W A;  5FWC A;  2MPX C;  3OMG A;  4GY5 A;  4HCC A;  1OZ3 A;  4A4F A;  3NFC A;  2D9T A;  4RCC A;  3N5B B;  2D8H A;  2RJD A;  3OYK A;  4M7A C;  4E7K A;  5DM7 R;  2DIQ A;  1MMD A;  3UT1 A;  3VYG A;  5GAN g;  4HT9 A;  3PGG A;  3VS7 A;  1XJW B;  3LWI A;  1VQ8 T;  2DNU A;  2K2V A;  1S72 Q;  5J39 A;  3R6O A;  2CSQ A;  1OU9 A;  2QGG A;  1ZA1 B;  3RKX A;  1DJ7 B;  3VKI A;  1X27 A;  1VQL T;  2EQJ A;  3TSW A;  2JS2 A;  3ZBD A;  5FRO A;  2DEU A;  3RDV A;  4OVA A;  4PLL A;  1UGP B;  2L8D A;  2NUT B;  2NUZ A;  3CCV Q;  1W70 A;  1VQM Q;  2DBM A;  1PRM C;  1ZBJ A;  3A8M B;  1M8V A;  4C0Z A;  4M7A E;  1UG1 A;  2FZG B;  1VQ4 Q;  5GAM f;  2CP5 A;  1WFW A;  1ZA2 B;  1S1N A;  1D0Z A;  1VQK Q;  2CH4 W;  1K9M C;  1U5S A;  3QG1 A;  1C0M A;  3OYD A;  1BB9 A;  1NEB A;  1SSH A;  1Y96 B;  3HFO A;  1QP2 A;  9ATC B;  1VQO A;  3VRY A;  3VU3 C;  1RAB B;  3MET A;  2FRW A;  1JB0 E;  2COZ A;  1PC0 A;  3TVT A;  4EMG A;  3CME Q;  4BI4 A;  3EG0 A;  2RQW A;  3A98 A;  2LP5 A;  2OAW A;  3M4G A;  5FU6 B;  3CCR Q;  5D6Y A;  3CBP A;  3OYE A;  1ZSZ C;  4CC4 B;  3WVD B;  5HKC A;  1UEB A;  2VC8 A;  4IUV A;  3V7C A;  2K3B A;  3MEV A;  4E47 A;  2VVK A;  2E1H A;  4LE9 A;  2EW3 A;  2DL5 A;  5GAN 8;  5GMK l;  2W0Z A;  1VIF A;  1P92 A;  3HP9 A;  1X2Q A;  4M7D G;  2NLU A;  2L3P A;  3H0F A;  4L5G A;  1Q7Y R;  1XOV A;  3PIO A;  2O01 E;  1M2V A;  2K6D A;  2VWF A;  3OYL A;  1RAI B;  2AZV A;  1M90 R;  4M77 F;  7AT1 B;  3EGX A;  3CC2 A;  1VQ8 Q;  3G71 A;  3BW1 A;  1VQO T;  1PSE A;  4AMC A;  3X24 B;  3QJY A;  5GAM j;  2DIL A;  2VYT A;  3NPF A;  5GAM g;  5KYU B;  4BY6 C;  1NLP C;  1VQL Q;  1KC8 C;  1YFN A;  2CT3 A;  2GTJ A;  1TOV A;  3L2Q A;  3CCE A;  4C0G A;  4FYY B;  3SDZ A;  2JMA A;  2KE9 A;  5KE2 A;  2L2P A;  1Q86 U;  2HBW A;  2MWP A;  1Q81 U;  1D3B B;  2F2W A;  1M1K U;  3L2W A;  1ABO A;  2OTL A;  1LOJ A;  2K57 A;  2JM8 A;  4DA4 A;  4LDW A;  1XNI A;  2YRC A;  4C5G A;  1AWW A;  2M1H A;  5HY6 A;  2HQE A;  2OAU A;  2ZGW A;  4QQG A;  2LJ3 A;  1OI1 A;  3HRT A;  1QVG A;  4BB7 A;  3DB4 A;  4ATO A;  2HNI A;  5LJ3 g;  2R58 A;  2L3S A;  4M78 E;  3G71 T;  3HFN A;  1RUW A;  4EPC A;  1C1A A;  2P4R A;  1AWO A;  2HL3 A;  4XTW A;  4DBR A;  3JV3 A;  4A4K A;  2XDP A;  2PUO B;  4DBF A;  1N8R R;  3CPW A;  1RAC B;  5AYF A;  4FCY A;  1FX7 A;  2RQT A;  4M7A F;  3CCE T;  1JEG A;  1W4S A;  3OSV A;  3JCM J;  1RAE B;  3I55 A;  2V1Q A;  4JS4 A;  2H8H A;  1Y7X A;  2V1R A;  2O88 A;  2CZ0 B;  1NYG A;  2YRV A;  2B8A A;  4E7H A;  3S3O A;  2QTV A;  1VYU A;  3CXC A;  2OTL T;  3CD6 A;  2AKK A;  3OB9 A;  2C06 A;  1VQ7 T;  3T9N A;  4N0A C;  4J6W A;  2GNC A;  5IH2 A;  1TS9 A;  3JCM d;  2CUB A;  2ROT A;  2BKD N;  2QXF A;  4FYX B;  2FRY A;  4KH1 B;  3DKM A;  4PFZ A;  3L42 A;  4OB0 B;  4XQ3 A;  1VQO Q;  1Q81 C;  2XDB A;  2FO0 A;  3VUZ A;  1M1K C;  3TCJ A;  4LDY A;  4JUV A;  2J05 A;  4EIK A;  1TU0 B;  2RPN A;  3QDR B;  3HPW A;  1GFC A;  5GAN h;  1WYX A;  3VS3 A;  2YUO A;  2CP3 A;  1XQH A;  1RLQ C;  2RD1 A;  2EJG A;  1QVG S;  2RHI A;  2Y4Y A;  2QTX A;  3M5A A;  1LJO A;  3VS6 A;  2QGF B;  1X6O A;  2FVU A;  3X28 B;  2E10 A;  4A54 A;  2D8J A;  4LUE A;  4PKC C;  1NJI R;  1BU1 A;  3PIP A;  1SF9 A;  3I5S A;  3CPW S;  2QA4 A;  1RAF B;  2QG9 B;  2VKN A;  4Y91 A;  3EGX B;  1QVG P;  3E2U A;  2DTH A;  4DOV A;  1UGV A;  3CC2 Q;  4C0D C;  3G71 Q;  2DLP A;  3CXC S;  2LQK A;  3SB2 A;  2CP2 A;  1GFD A;  3RES A;  2LZ6 B;  2Y90 A;  2EYX A;  3LX7 A;  2XK0 A;  2F5K A;  5FU6 C;  3CPW P;  3CCE Q;  5GAN 7;  2MK5 A;  1R0C B;  3GOX A;  4ELZ C;  4X9D A;  2E12 A;  2JTM A;  4LDU A;  3HTR A;  5A0G A;  2VGN A;  2OTL Q;  2PNI A;  5CQY A;  3CXC P;  5GAM e;  4MDX A;  2QQR A;  3QKJ A;  2E3I A;  3QZ9 B;  1UGS B;  2JMC A;  5I11 A;  2QA4 T;  4M7D C;  4RTU A;  4DBQ A;  2P4T A;  2DD5 A;  2PVD B;  2VXF A;  1FXX A;  2HZY A;  1IB8 A;  3ULR B;  1E6G A;  3FRN A;  4LDV A;  2FL7 A;  5GMK j;  1JXO A;  1MMA A;  1FMV A;  1QKX A;  5IHN A;  1M3B A;  1M27 C;  1OYX A;  3VS5 A;  2K2M A;  2R5A A;  3CCM T;  4DBH A;  1M90 U;  4E6R A;  2QQA A;  4Z89 A;  3ZFJ A;  3I55 Q;  3OYJ A;  3M0Q A;  2KRO A;  1LVK A;  2R5M A;  2PUK B;  4ZTJ A;  4KUI A;  3M0U A;  3CD6 Q;  4M7D E;  2ZPF B;  2HMA A;  3BFM A;  4YTL A;  1QWE A;  1K4U S;  2XHC A;  4J8O A;  4GLM A;  4QKU A;  1GRI A;  4E7S A;  2RA2 A;  3SWN A;  2IPO B;  3CCQ T;  2FPF A;  2LDM A;  2DEQ A;  5ECA A;  5A0L A;  3LGL A;  2DK3 A;  2DRK A;  1PHT A;  5LJ3 h;  4JZ3 A;  1J3T A;  1YJ9 T;  2HEQ A;  2M9U A;  3S3N A;  4OGE A;  4OB1 B;  3HKS A;  2FB7 A;  4CC7 A;  2DZ9 A;  3LH5 A;  5KYN A;  1OUL A;  2YSQ A;  1FWZ A;  2YT6 A;  1N8R U;  3VYH B;  5KCO A;  3MP6 A;  1EFN A;  2AIR B;  2QA4 Q;  3QXE B;  3O8V A;  3KUF A;  1VYT A;  1B7T A;  3EAE A;  5FU7 B;  3C4S A;  4C5E A;  1ZHI A;  3H0I A;  1MUZ A;  1JJ2 S;  3D7S B;  4XTU A;  3FDR A;  5AT1 B;  2EQI A;  2F2X A;  2LNV A;  4HCK A;  4PJO C;  3KBG A;  3G1J A;  3VRZ A;  1WHK A;  1N6A A;  1UTI A;  4OMP A;  1D0Y A;  2X3W D;  2EGE A;  6AT1 B;  3JCM f;  1M9S A;  2AHJ B;  1ZX6 A;  3EHQ A;  1T0J A;  2QDL A;  3EFR A;  4O5V A;  2AT1 B;  2E64 A;  1M8M A;  4WTO B;  3TU4 K;  2IVW A;  2FZC B;  1K73 R;  4PL6 A;  1RAA B;  1WNL A;  2BTT A;  2LVM A;  3U23 A;  1I5O B;  2EBP A;  4XAX B;  1U8R A;  2AKL A;  4IUQ A;  3H9N A;  1IO6 A;  2RJF A;  2KBT A;  3PVL A;  3TRE A;  1FYN A;  3AHU A;  2DKG A;  1I5L A;  2HQH A;  4RUG A;  1H3Z A;  4E7L A;  3L2Z A;  1VQ9 T;  1I0C A;  2K5I A;  3UDC A;  3M55 A;  1WXB A;  3E1S A;  3CCQ Q;  2EQU A;  2KAF A;  5DLQ E;  2RB6 A;  2PTK A;  2EYW A;  1WQ7 A;  2OX7 A;  4QVC A;  4HVU A;  4QT7 A;  2SRC A;  4XTZ A;  2E5K A;  1YI2 A;  4BUG A;  3HHT B;  2RHZ A;  1YHQ A;  4M7D F;  3AT1 B;  2JTE A;  2CYZ B;  1W6X A;  3G4S A;  2ED1 A;  2D0N A;  2LJ1 A;  3TSZ A;  1G3W A;  2A36 A;  4JRK A;  4B6M A;  4PFP A;  1VQN A;  4O6J A;  1GCQ A;  5KYY A;  3JCM P;  1BCO A;  5LJ5 j;  5DLO A;  3P8D A;  3BY7 A;  2CP0 A;  3E19 A;  4E7J A;  1OX9 A;  2GQV A;  2E4H A;  2ZPI B;  3VS4 A;  2X4X A;  1QWF A;  4QVD A;  4ELY C;  3SWN B;  2QEX A;  3LWH A;  4UC4 A;  2LMJ A;  2MF2 A;  1AZG B;  2ED0 A;  4XTX A;  5I22 A;  3V8K A;  1BI1 A;  2QQS A;  3MEA A;  2DL3 A;  3FLG A;  5GAN 6;  3GLX A;  1Y0M A;  2K7A A;  1YI2 T;  1I8F A;  2IIM A;  2X51 A;  1HK9 A;  4M75 D;  1YHQ T;  3GP8 A;  1QQJ A;  1EX4 A;  2ZPH B;  3UWN A;  2XG8 D;  3G4S T;  2O9V A;  4HVV A;  4KBM B;  1IGQ A;  3IQL A;  1H3H A;  1X2K A;  2MAM A;  1MNE A;  4HVW A;  1KIK A;  3QBY A;  2J06 A;  1VQN T;  4RTZ A;  2GFU A;  5HK3 A;  3JCM Q;  3CCU A;  1N27 A;  2CKK A;  3VV0 A;  4E2F B;  1T3S A;  1E6H A;  3JCM W;  1YWP A;  2FHD A;  1ZQ1 A;  1TG0 A;  2DYI A;  2DET A;  1T0H A;  4TVR A;  4PFO A;  1KD1 R;  3F70 A;  4IIO A;  2KNB B;  4M75 A;  4C92 D;  1UB4 A;  5KYW A;  2QEX T;  1ZUK A;  2O4X A;  2XDD A;  2L89 A;  2VUB A;  1YWO A;  1FMK A;  2D6F A;  3TQ7 P;  2GTO A;  2RH2 A;  4AG2 C;  2CT4 A;  4IUT A;  3R6N A;  3PTA A;  4BE0 A;  3I56 A;  1YP5 A;  4KGV B;  3URG A;  4KUD K;  4F04 B;  4FU6 A;  4X9C A;  4LD6 A;  2IG0 A;  3SD4 A;  4PJO F;  4RMO A;  3CQT A;  3QWY A;  4C92 A;  1OX8 A;  3CCU T;  3M0R A;  1HYO A;  5HK0 A;  1K8A R;  4OGC A;  1BI0 A;  3LYI A;  4R56 A;  1SRM A;  1AVZ C;  5J26 A;  4AFS C;  1AWJ A;  5CVI A;  3JB9 I;  4ZN3 A;  3CCS T;  3A8L B;  3MHX A;  4MDW A;  3CPF A;  4QQ6 A;  3OS5 A;  1W1F A;  2RHX A;  1KQ1 A;  2M0O A;  1YI2 Q;  4M78 C;  1HXD A;  2LQ8 A;  1YHQ Q;  4LXC A;  1UEC A;  4CC2 A;  5GAO n;  2PU9 B;  4BE2 A;  3H8Z A;  2QQ9 A;  4OML A;  3G4S Q;  1D09 B;  1G3T A;  3BDL A;  4C8Q D;  3OYF A;  3A8H B;  2HKN A;  3I56 T;  4HCZ A;  1YCY A;  4PNO A;  1BBZ A;  2P0P A;  1JQQ A;  3VS2 A;  3REB B;  1VQN Q;  2RQV A;  2J7I A;  5KYY B;  4WF2 A;  3QII A;  4FSX A;  1OEB A;  1VQ7 A;  3NMZ C;  1TSF A;  4M7A D;  2DM1 A;  1TUG B;  1ZUY A;  4N4H A;  2DX1 A;  2X9H A;  2JVV A;  4DEX A;  2DXT A;  1PG5 B;  2LNH B;  4C5H A;  1UFF A;  1X01 A;  3A1P A;  2A0F B;  2QEX Q;  4IUR A;  1PD0 A;  2QDY B;  4C8Q A;  1SRL A;  3JCM e;  1Q82 R;  2GFA A;  5CKH A;  5LJ5 e;  3RUX A;  2YXY A;  5CKD A;  3FC3 A;  3H6Z A;  1KHI A;  2GGR A;  2NUP A;  4M7A A;  1YBY A;  5DY9 A;  4JJD A;  1TTH B;  2CSI A;  1AT1 B;  1G5V A;  2YUN A;  3SFM A;  4PJM A;  1WXT A;  3CCU Q;  4IIM A;  4J9I A;  3FEO A;  4F7U A;  1V29 B;  4AFQ C;  3J81 E;  2KT1 A;  4D8K A;  4M75 G;  5LJ5 d;  1N9R A;  3JB9 J;  4M75 B;  5KYW B;  1AWX A;  3SWN C;  4ZGE B;  1Q86 C;  3OA6 A;  1OOT A;  2O4X B;  1K0S A;  2JJ9 A;  8AT1 B;  4FW2 A;  2ENM A;  2E6Z A;  1PCX A;  1WJQ A;  4LUD A;  3RKY A;  2CGH A;  2G6F X;  2DTI A;  1I4K 1;  3A5Z B;  2F5T X;  1NYF A;  3PFS A;  2FZK B;  3OBY A;  3QO3 A;  1NEG A;  2KSS A;  3BDU A;  3I56 Q;  5GAN d;  4C92 G;  4XK8 E;  1G3Y A;  4JRP A;  3OYN A;  4L59 A; 
#chains in the Genus database with same CATH homology
 4GLM A;  1JO8 A;  1VYV A;  3I9Q A;  1GRI A;  3UA7 A;  4JZ4 A;  2RN8 A;  2CUD A;  1K1Z A;  2O31 A;  4J9B A;  5FWC A;  1G2B A;  2DJQ A;  1AZE A;  2FPF A;  1GBR A;  3EG3 A;  4J9D A;  2LQN A;  4KRT A;  4M4Z A;  5GJV B;  5ECA A;  5IHK A;  2J6O A;  2DRK A;  1PHT A;  3SHW A;  1M3C A;  4JZ3 A;  4ORZ A;  1J3T A;  1AD5 A;  4J9H A;  2D8H A;  2KT8 A;  2HEQ A;  3UAT A;  3VS7 A;  1BK2 A;  4CC7 A;  3LH5 A;  2YSQ A;  2YT6 A;  4OMM A;  3UA6 A;  1OV3 A;  1UE9 A;  3GBQ A;  1EFN A;  2DNU A;  2OJ2 A;  2JT4 A;  1WIE A;  2W10 A;  2CSQ A;  2EYY A;  2RF0 A;  1HD3 A;  1HSQ A;  1VYT A;  1QLY A;  1X27 A;  1SPK A;  4DEY A;  3TSW A;  2XMF A;  1VA7 A;  2JS2 A;  2KYB A;  3H0I A;  2L3Q A;  1MUZ A;  1U3O A;  2ROL A;  2EQI A;  1WDX A;  2F2X A;  1N5Z A;  4HCK A;  3M0T A;  1RLP C;  2NUZ A;  2EGC A;  1W70 A;  1AOJ A;  1JU5 C;  3VRZ A;  1UTI A;  2JW4 A;  4OMP A;  2DBM A;  2X3W D;  1PRM C;  1ZBJ A;  2EGE A;  1KJW A;  2J6F A;  3EGU A;  1UG1 A;  1ZX6 A;  1ZUU A;  3EHQ A;  2MIO A;  1WFW A;  1T0J A;  2KR3 A;  2QDL A;  1S1N A;  4LNP A;  2CH4 W;  1UUE A;  1M8M A;  1HJD A;  1U5S A;  3NGP A;  2DYB A;  2RQU A;  3UF4 A;  1BB9 A;  1NEB A;  1SSH A;  3ZL7 C;  5FWB A;  2EPD A;  3I5R A;  2GBQ A;  2BTT A;  3U23 A;  2KGT A;  2EBP A;  3VRY A;  2AKL A;  4RTX A;  4FSS A;  1IO6 A;  2KBT A;  1YN8 A;  2FRW A;  3PVL A;  1WXU A;  1FYN A;  1UHC A;  3M0P A;  2RMO A;  1G83 A;  5GJW B;  3TVT A;  4RUG A;  2FPD A;  3EG0 A;  2RQW A;  3A98 A;  1I0C A;  2GQI A;  2LP5 A;  3M0S A;  2OAW A;  1GCQ C;  4GBQ A;  1E7O A;  4Z88 A;  2DRM A;  1WXB A;  4CC4 B;  1CKA A;  2DE0 X;  1WI7 A;  2K3B A;  2PTK A;  2EYW A;  2VVK A;  3THK A;  4LE9 A;  2EW3 A;  4HVU A;  4QT7 A;  2DL5 A;  1X69 A;  2SRC A;  2E5K A;  2F2V A;  2W0Z A;  5IHI A;  1X6B A;  1X2Q A;  2KRM A;  2L3P A;  2JTE A;  1SEM A;  3H0F A;  1W6X A;  1XOV A;  4LN2 A;  2ED1 A;  2KEA A;  1UDL A;  2D0N A;  2LJ1 A;  3TSZ A;  2A36 A;  2K6D A;  1MV0 B;  1YCS B;  2VWF A;  4F17 A;  2KRN A;  2AZV A;  2KYM A;  1GCQ A;  5IXB A;  1GBQ A;  2HSP A;  2DIL A;  3NPF A;  1NLP C;  2CT3 A;  2GTJ A;  4AG1 C;  3VS4 A;  1I1J A;  1QWF A;  1B3Q A;  2AK5 A;  2JMA A;  2KE9 A;  2A08 A;  2HDA A;  2L2P A;  2O2O A;  3RNJ A;  2LMJ A;  2HBW A;  2M51 A;  1V1C A;  1AZG B;  2ED0 A;  2F2W A;  5I22 A;  4J9G A;  2C0T A;  1PKT A;  1NG2 A;  1ABO A;  2DL3 A;  1PNJ A;  2JM8 A;  2CRE A;  1Y0M A;  2K7A A;  2IIM A;  1H92 A;  3H41 A;  2A28 A;  1AWW A;  4CC3 A;  4F14 A;  2MCN A;  1ZLM A;  4RTT A;  1PWT A;  1ZSG A;  2O9V A;  4HVV A;  3FJ5 A;  3IQL A;  1H3H A;  1X2K A;  2LJ3 A;  4HVW A;  1KIK A;  2J06 A;  2AZS A;  3VS0 A;  4RTZ A;  2L3S A;  2MOX A;  1RUW A;  4Y92 A;  1T3S A;  1E6H A;  2P4R A;  1AWO A;  2D1X A;  1ARK A;  1YWP A;  1TG0 A;  1UHF A;  3JV3 A;  4F16 A;  1T0H A;  1GCP A;  3RBB B;  4X1V A;  1OPK A;  1TUC A;  1AEY A;  4R0K A;  4IIO A;  2RQT A;  2KNB B;  1JEG A;  2CDT A;  2V1Q A;  2H8H A;  2V1R A;  1PRL C;  2DL8 A;  2O88 A;  1M3A A;  1ZUK A;  4AFZ C;  1NYG A;  2YUQ A;  1YWO A;  3EHR A;  1Z9Q A;  1VYU A;  2RNA A;  1FMK A;  2GTO A;  4JJB A;  1B07 A;  3SEM A;  1K0X A;  2AKK A;  4AG2 C;  2CT4 A;  2B86 A;  2FPE A;  1M30 A;  2GNC A;  5IH2 A;  3R6N A;  2DVJ A;  2CUB A;  1NM7 A;  2ROT A;  1YP5 A;  2DF6 A;  2FEI A;  1K9A A;  5FW9 A;  2FRY A;  1MV3 A;  1OPL A;  1WA7 A;  4Z8A A;  3CQT A;  1QCF A;  2FO0 A;  1Y57 A;  2ECZ A;  3QWY A;  2JXB A;  1X6G A;  2J05 A;  3M0R A;  1RI9 A;  4EIK A;  2RPN A;  1GL5 A;  2JS0 A;  1GFC A;  3NHN A;  2L0A A;  2X3X D;  2I0N A;  1PKS A;  1SRM A;  1WYX A;  3VS3 A;  1KSW A;  1AVZ C;  2YUO A;  4AFS C;  1AWJ A;  2EVR A;  1RLQ C;  2LJ0 A;  1ABQ A;  1YNZ A;  4A63 B;  1WLP B;  3VS6 A;  1W1F A;  2LQW A;  2D8J A;  4LUE A;  2BZ8 A;  4OMQ A;  1UEC A;  2J6K A;  4CC2 A;  1BU1 A;  4HXJ A;  1CSK A;  3I5S A;  4OML A;  1TUD A;  1BBZ A;  2PZ1 A;  1JQQ A;  2VKN A;  2DL7 A;  3VS2 A;  3H0H A;  3REB B;  4AFU C;  4J9C A;  2RQV A;  2J7I A;  2DA9 A;  2K9G A;  1UGV A;  4J9E A;  2DLP A;  1OEB A;  1T3L A;  3NMZ C;  4RTW A;  1GFD A;  2DM1 A;  1ZUY A;  2A37 A;  3VS1 A;  2DX1 A;  2LZ6 B;  2EYZ A;  3EG2 A;  2EYX A;  4JJC A;  5EC7 A;  1QKW A;  4DEX A;  1X43 A;  2DMO A;  3EG1 A;  2LNH B;  1UFF A;  2C0O A;  2KRS A;  2CH4 A;  2ABL A;  3C0C A;  3I35 A;  1SRL A;  2BZX A;  1Z9Z A;  2YUP A;  3REA B;  2PNI A;  1NLO C;  1UJY A;  4K11 A;  2JM9 A;  2GGR A;  1KFZ A;  2JMC A;  2LCS A;  2O9S A;  2SEM A;  5I11 A;  2C0I A;  2OI3 A;  2EGA A;  4JJD A;  4RTU A;  2KXD A;  2CSI A;  4WCI A;  2DL4 A;  2LX7 A;  2YUN A;  1WX6 A;  3KFV A;  1SHG A;  1WXT A;  3ULR B;  4IIM A;  1LCK A;  4J9I A;  1E6G A;  1K76 A;  4AFQ C;  4ESR A;  2YDL A;  1JXO A;  4D8D A;  2KT1 A;  4D8K A;  2HCK A;  5IHN A;  1QKX A;  2M0Y A;  1SHF A;  1M3B A;  1M27 C;  3VS5 A;  2K2M A;  2KXC A;  4E6R A;  4RTY A;  4ZNX A;  1AWX A;  4OMN A;  4Z89 A;  3O5Z A;  2K79 A;  3PVQ A;  1OOT A;  3M0Q A;  3QWX X;  1A0N B;  2ESW A;  2KRO A;  1CKB A;  1K0S A;  1UJ0 A;  4JPB W;  2ENM A;  1U06 A;  3M0U A;  4LUD A;  1I07 A;  1JXM A;  4J9F A;  5HCK A;  2G6F X;  5L23 A;  1NYF A;  2EKH A;  4RTV A;  1NEG A;  3PE0 A;  1QWE A;  1H8K A;  2BZY A;  1K4U S;  4OMO A;  2FG0 A;  2RQR A;  5IXF A;  2DBK A;  2NWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...