1JFIC

Crystal structure of the nc2-tbp-dna ternary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
SHMSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
pubmed doi rcsb
molecule keywords 5'-D(*TP*TP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*GP*CP*TP*CP*
molecule tags Transcription/dna
source organism Homo sapiens
total genus 46
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1jfiC01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1jfiC02
4WZSD 5IYCP 2IV8A 3HS8A 1RM1A 1QNBA 1TGHA 1KY6A 1D3UA 4ROCB 4B0AA 1NGMA 1R4XA 1JFIC 2Z8UA 3H1ZA 3ASMA 3VN5A 1QNCA 3OCIA 1NH2A 1QN5A 1TBPA 1PCZA 2VJ0A 1CDWA 1PZDA 1QN9A 5IYDP 1KY7A 1QN6A 1VTOA 2MJ7A 1KYDA 1QTSA 5IYBP 1QNEA 1VOLB 2D0AA 3EIKA 1MP9A 1YTFA 1W80A 1KYFA 2D0CA 3OC3C 1C9BB 4PY5A 1YTBA 1TBAB 2G30A 1QN8A 2IV9A 1QTPA 1QN7A 4RODB 1AISA 1VOKA 1QN3A 3HS9A 1QNAA 1KYUA 1QN4A 4ROEB 1E42A 1NVPA 2D0BA 1B9KA 1VTLE
chains in the Genus database with same CATH superfamily
1UT7A 3NA5A 5IYCP 3HS8A 1LWVA 3BKQX 1KY6A 2QREA 3CW7A 4B0AA 4C7PA 1C47A 4EAIA 3ASMA 3PMGA 3OCIA 1NH2A 4DULA 2QLVA 1TBPA 1PCZA 1QN9A 3CWSA 5IYDP 2EHBD 3DPUA 4MRQA 1P5GX 2NOBA 4IL8A 2NOZA 1QTSA 2YH5A 1LWYA 3EAYA 3EIKA 2Z0FA 3UW2A 1EBMA 3OC3C 2DKCA 3T4NA 4PY5A 2NWVA 2HZSA 1EUVA 3IH7A 1QN7A 1KFIA 2FUVA 2NVMA 5F9CA 2HZMA 1JDYA 1E42A 3OSTA 1B9KA 3RSMA 1V5SA 5BMPA 1RM1A 4EJYA 1LXTA 2JOIA 2OOYA 3CVTA 5JMVD 4BJUA 4EAGA 2YA3A 5HSHA 5JN5A 3PDKA 2QRDA 2F7LA 1YQKA 1CDWA 1T6AA 2JHJA 1PCMX 3TDHA 2JHNA 2MJ7A 2OOXA 1KYDA 2FKMX 2NOFA 1VOLB 2O3OA 1MP9A 2HKPA 2H4LX 2HL8A 3F0ZA 4EAKA 1YTFA 1W80A 1KYFA 5BMNA 1WJWA 2JPIA 1N39A 5KL0A 1TBAB 1QN8A 1Q9UA 3C04A 3KRMA 2NOEA 4D7QA 1QTPA 3OSMA 3I3WA 3HS9A 4ROEB 1YQMA 3SNSA 2Y8QA 2I5WA 1KO9A 2Y8LA 1TGHA 1QNBA 2V9JA 3OH6A 1D3UA 1PCJX 2H5AX 1N3AA 4CFFA 1N3CA 1NGMA 3VN5A 3CWUA 2NOLA 4Q11A 3KTUA 3I0WA 1QN5A 2VJ0A 2FGTA 4QG5A 4EJZA 3CVSA 1FN7A 1KFQA 1C4GA 5IYBP 2D0AA 2PWWA 1LWWA 3I0XA 1YQLA 1UL7A 4TPSA 3ENCA 2D0CA 1C9BB 1P5DX 5EPCA 4D7RA 2G30A 1YTBA 3RPJA 2IV9A 3OSEA 3ULXA 2XHIA 2NOIA 3F10A 2QR1A 1AISA 1QN3A 1M5Q1 1VKLA 1KYUA 4HJHA 2FKFA 1YQRA 1NVPA 4WXAA 1VTOA 3CWTA 1QNEA 1VTLE 3TE5A 3ENOC 4WZSD 1K35A 2IV8A 2V8QA 3DPTA 1UT4A 4ROCB 2NLVA 1R4XA 1JFIC 3OLPA 2Z8UA 3H1ZA 1QNCA 4I8OA 1K2YX 3D7QA 4WX8A 3D4VA 1MPGA 1PZDA 1WQAA 1HU0A 1KY7A 1QN6A 2MZ8A 5AN4A 2QRCA 3CWAA 3N89A 3OH9A 2HL9A 4EAJA 2V92A 1DIZA 1PVSA 2DKAA 2NOHA 4EALA 1XSZA 2R5XA 1TUOA 4RODB 3OGDA 2LAEA 1VOKA 2DKDA 1QNAA 1QN4A 1M3QA 1M3HA 2ZFDB 2D0BA 1J3MA
chains in the Genus database with same CATH topology
1UT7A 5IYCP 3HS8A 1LWVA 1KY6A 4B0AA 3ASMA 3OCIA 1NH2A 4DULA 1TBPA 1PCZA 1QN9A 5IYDP 3DPUA 2NOBA 2NOZA 1QTSA 2YH5A 1LWYA 3EIKA 1EBMA 3OC3C 4PY5A 2HZSA 3IH7A 1QN7A 2HZMA 3OSTA 1E42A 1B9KA 1RM1A 4EJYA 2JOIA 1YQKA 1CDWA 2MJ7A 1KYDA 2NOFA 1VOLB 2O3OA 1MP9A 3F0ZA 1YTFA 1W80A 1KYFA 1N39A 1TBAB 1QN8A 3KRMA 2NOEA 1QTPA 3OSMA 3HS9A 4ROEB 1YQMA 3SNSA 2I5WA 1KO9A 1TGHA 1QNBA 1D3UA 1N3CA 1N3AA 1NGMA 2NOLA 3VN5A 4Q11A 3KTUA 3I0WA 1QN5A 2VJ0A 2FGTA 4EJZA 1FN7A 5IYBP 2D0AA 1LWWA 3I0XA 1YQLA 4TPSA 2D0CA 1C9BB 1YTBA 2G30A 3RPJA 2IV9A 3ULXA 2XHIA 2NOIA 3F10A 1AISA 1QN3A 1KYUA 1YQRA 1NVPA 1VTOA 1QNEA 1VTLE 4WZSD 2IV8A 3DPTA 1UT4A 4ROCB 1R4XA 1JFIC 2Z8UA 3H1ZA 1QNCA 4I8OA 1PZDA 1HU0A 1KY7A 1QN6A 2MZ8A 5AN4A 3N89A 2NOHA 4RODB 1VOKA 2LAEA 1QNAA 1QN4A 1M3QA 1M3HA 2D0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZS D;  5IYC P;  2IV8 A;  3HS8 A;  1RM1 A;  1QNB A;  1TGH A;  1KY6 A;  1D3U A;  4ROC B;  4B0A A;  1NGM A;  1R4X A;  1JFI C;  2Z8U A;  3H1Z A;  3ASM A;  3VN5 A;  1QNC A;  3OCI A;  1NH2 A;  1QN5 A;  1TBP A;  1PCZ A;  2VJ0 A;  1CDW A;  1PZD A;  1QN9 A;  5IYD P;  1KY7 A;  1QN6 A;  1VTO A;  2MJ7 A;  1KYD A;  1QTS A;  5IYB P;  1QNE A;  1VOL B;  2D0A A;  3EIK A;  1MP9 A;  1YTF A;  1W80 A;  1KYF A;  2D0C A;  3OC3 C;  1C9B B;  4PY5 A;  1YTB A;  1TBA B;  2G30 A;  1QN8 A;  2IV9 A;  1QTP A;  1QN7 A;  4ROD B;  1AIS A;  1VOK A;  1QN3 A;  3HS9 A;  1QNA A;  1KYU A;  1QN4 A;  4ROE B;  1E42 A;  1NVP A;  2D0B A;  1B9K A;  1VTL E; 
#chains in the Genus database with same CATH topology
 1UT7 A;  3NA5 A;  5IYC P;  3HS8 A;  1LWV A;  3BKQ X;  1KY6 A;  2QRE A;  3CW7 A;  4B0A A;  4C7P A;  1C47 A;  4EAI A;  3ASM A;  3PMG A;  3OCI A;  1NH2 A;  4DUL A;  2QLV A;  1TBP A;  1PCZ A;  1QN9 A;  3CWS A;  5IYD P;  2EHB D;  3DPU A;  4MRQ A;  1P5G X;  2NOB A;  4IL8 A;  2NOZ A;  1QTS A;  2YH5 A;  1LWY A;  3EAY A;  3EIK A;  2Z0F A;  3UW2 A;  1EBM A;  3OC3 C;  2DKC A;  3T4N A;  4PY5 A;  2NWV A;  2HZS A;  1EUV A;  3IH7 A;  1QN7 A;  1KFI A;  2FUV A;  2NVM A;  5F9C A;  2HZM A;  1JDY A;  1E42 A;  3OST A;  1B9K A;  3RSM A;  1V5S A;  5BMP A;  1RM1 A;  4EJY A;  1LXT A;  2JOI A;  2OOY A;  3CVT A;  5JMV D;  4BJU A;  4EAG A;  2YA3 A;  5HSH A;  5JN5 A;  3PDK A;  2QRD A;  2F7L A;  1YQK A;  1CDW A;  1T6A A;  2JHJ A;  1PCM X;  3TDH A;  2JHN A;  2MJ7 A;  2OOX A;  1KYD A;  2FKM X;  2NOF A;  1VOL B;  2O3O A;  1MP9 A;  2HKP A;  2H4L X;  2HL8 A;  3F0Z A;  4EAK A;  1YTF A;  1W80 A;  1KYF A;  5BMN A;  1WJW A;  2JPI A;  1N39 A;  5KL0 A;  1TBA B;  1QN8 A;  1Q9U A;  3C04 A;  3KRM A;  2NOE A;  4D7Q A;  1QTP A;  3OSM A;  3I3W A;  3HS9 A;  4ROE B;  1YQM A;  3SNS A;  2Y8Q A;  2I5W A;  1KO9 A;  2Y8L A;  1TGH A;  1QNB A;  2V9J A;  3OH6 A;  1D3U A;  1PCJ X;  2H5A X;  1N3A A;  4CFF A;  1N3C A;  1NGM A;  3VN5 A;  3CWU A;  2NOL A;  4Q11 A;  3KTU A;  3I0W A;  1QN5 A;  2VJ0 A;  2FGT A;  4QG5 A;  4EJZ A;  3CVS A;  1FN7 A;  1KFQ A;  1C4G A;  5IYB P;  2D0A A;  2PWW A;  1LWW A;  3I0X A;  1YQL A;  1UL7 A;  4TPS A;  3ENC A;  2D0C A;  1C9B B;  1P5D X;  5EPC A;  4D7R A;  2G30 A;  1YTB A;  3RPJ A;  2IV9 A;  3OSE A;  3ULX A;  2XHI A;  2NOI A;  3F10 A;  2QR1 A;  1AIS A;  1QN3 A;  1M5Q 1;  1VKL A;  1KYU A;  4HJH A;  2FKF A;  1YQR A;  1NVP A;  4WXA A;  1VTO A;  3CWT A;  1QNE A;  1VTL E;  3TE5 A;  3ENO C;  4WZS D;  1K35 A;  2IV8 A;  2V8Q A;  3DPT A;  1UT4 A;  4ROC B;  2NLV A;  1R4X A;  1JFI C;  3OLP A;  2Z8U A;  3H1Z A;  1QNC A;  4I8O A;  1K2Y X;  3D7Q A;  4WX8 A;  3D4V A;  1MPG A;  1PZD A;  1WQA A;  1HU0 A;  1KY7 A;  1QN6 A;  2MZ8 A;  5AN4 A;  2QRC A;  3CWA A;  3N89 A;  3OH9 A;  2HL9 A;  4EAJ A;  2V92 A;  1DIZ A;  1PVS A;  2DKA A;  2NOH A;  4EAL A;  1XSZ A;  2R5X A;  1TUO A;  4ROD B;  3OGD A;  2LAE A;  1VOK A;  2DKD A;  1QNA A;  1QN4 A;  1M3Q A;  1M3H A;  2ZFD B;  2D0B A;  1J3M A; 
#chains in the Genus database with same CATH homology
 1UT7 A;  5IYC P;  3HS8 A;  1LWV A;  1KY6 A;  4B0A A;  3ASM A;  3OCI A;  1NH2 A;  4DUL A;  1TBP A;  1PCZ A;  1QN9 A;  5IYD P;  3DPU A;  2NOB A;  2NOZ A;  1QTS A;  2YH5 A;  1LWY A;  3EIK A;  1EBM A;  3OC3 C;  4PY5 A;  2HZS A;  3IH7 A;  1QN7 A;  2HZM A;  3OST A;  1E42 A;  1B9K A;  1RM1 A;  4EJY A;  2JOI A;  1YQK A;  1CDW A;  2MJ7 A;  1KYD A;  2NOF A;  1VOL B;  2O3O A;  1MP9 A;  3F0Z A;  1YTF A;  1W80 A;  1KYF A;  1N39 A;  1TBA B;  1QN8 A;  3KRM A;  2NOE A;  1QTP A;  3OSM A;  3HS9 A;  4ROE B;  1YQM A;  3SNS A;  2I5W A;  1KO9 A;  1TGH A;  1QNB A;  1D3U A;  1N3C A;  1N3A A;  1NGM A;  2NOL A;  3VN5 A;  4Q11 A;  3KTU A;  3I0W A;  1QN5 A;  2VJ0 A;  2FGT A;  4EJZ A;  1FN7 A;  5IYB P;  2D0A A;  1LWW A;  3I0X A;  1YQL A;  4TPS A;  2D0C A;  1C9B B;  1YTB A;  2G30 A;  3RPJ A;  2IV9 A;  3ULX A;  2XHI A;  2NOI A;  3F10 A;  1AIS A;  1QN3 A;  1KYU A;  1YQR A;  1NVP A;  1VTO A;  1QNE A;  1VTL E;  4WZS D;  2IV8 A;  3DPT A;  1UT4 A;  4ROC B;  1R4X A;  1JFI C;  2Z8U A;  3H1Z A;  1QNC A;  4I8O A;  1PZD A;  1HU0 A;  1KY7 A;  1QN6 A;  2MZ8 A;  5AN4 A;  3N89 A;  2NOH A;  4ROD B;  1VOK A;  2LAE A;  1QNA A;  1QN4 A;  1M3Q A;  1M3H A;  2D0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...