1JJ2H

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
167
structure length
156
Chain Sequence
KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 28
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2001-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1jj2H00
1K9MJ 5DM7J 1YJ9H 5MLCO 2ZJPJ 1N8RJ 3G71H 3OW2H 4WFAJ 3CCEH 4WFNJ 1YJWH 1YJNH 3DLLJ 5GAGN 3CCLH 2QA4H 3I56H 1KD1J 1VQOH 2OTLH 2QEXH 1YITH 3CCSH 3G6EH 1VQNH 4WCEJ 5JVGJ 1VQMH 5JVHJ 1WKIA 5H1SO 5DM6J 1QVFH 3CC7H 2ZJQJ 1Q86J 2ZJRJ 1VQ7H 3CXCH 1VQ8H 5GADN 3CCUH 3PIPJ 3CMAH 3CPWH 1JJ2H 1K8AJ 5HL7J 3CCRH 3CCQH 1M90J 2PA2A 5GAHN 3CCMH 1VQ6H 3I55H 4IOCJ 1KQSH 1KC8J 3CF5J 1Q82J 1QVGH 1K73J 3CC2H 3PIOJ 5AN9F 1Q7YJ 1Q81J 4WFBJ 3G4SH 1Y69K 4UY8M 1YI2H 1YHQH 1VQ4H 3J7ZM 3CD6H 4IOAJ 4IO9J 2OTJH 4U67J 3CCVH 1NJIJ 1VQPH 3CMEH 3CC4H 1VQLH 5GAEN 1VQKH 1VQ5H 1S72H 4WF9J 1VQ9H 3CCJH 1YIJH 1W2BH 1M1KJ
chains in the Genus database with same CATH superfamily
2I14A 1SIJA 1K9MJ 5DM7J 1YJ9H 3FAHA 5MLCO 2ZJPJ 1N8RJ 3G71H 4C80A 3NRZC 3OW2H 4GA6A 4WFAJ 3CCEH 4WFNJ 4US9A 1UOUA 3NVVC 4EADA 4KWVA 1QPNA 1YJWH 5AYZA 1YJNH 3DLLJ 1N62B 1RM6A 3NS1C 3VMMA 4I9AA 5GAGN 3CCLH 2QA4H 3I56H 3NVWC 2J0FA 1KD1J 1VQOH 3C2EA 2OTLH 2QEXH 1YITH 3AMZA 1QAPA 3WO0A 3CCSH 1N63B 3L4PA 1BRWA 4EAFA 3G6EH 1VQNH 5MPOC 3WNZA 3EUB4 4WCEJ 1X1OA 3FC4A 4GA5A 5JVGJ 1O4UA 2W3RB 1VQMH 1QPQA 5JVHJ 5HUOA 2WK6A 4KWWA 3NVZC 5AYYA 1WKIA 2B7NA 4US8A 1NVJA 4USAA 5H1SO 1AZYA 4X46A 1FO4A 5HUPA 3PAJA 5DM6J 4C7ZA 1QVFH 3CC7H 4AP8A 2ZJQJ 1JROB 1NVIE 1N60B 3L0GA 1Q86J 2ZJRJ 2DSJA 1VQ7H 1ZXIB 3CXCH 4LHMA 1VQ8H 5GADN 3CCUH 3PIPJ 3BIIE 3B9JC 2WP4A 3CMAH 1JRPB 3RPFA 3CPWH 1V97A 2B7QA 5EP8A 1JJ2H 1K8AJ 1QPRA 5HL7J 2W3SB 3CCRH 3CCQH 1VDVA 1SB3A 2PA2A 1M90J 1FFVB 4YYYA 5GAHN 3CCMH 1VQ6H 1N61B 3I55H 2JBMA 3TQVA 4IOCJ 1KQSH 1YTEA 3NVYC 1KC8J 4YEKA 3CF5J 1Q82J 1QVGH 4XR5A 1K73J 3CC2H 3PIOJ 1FIQC 5AN9F 1Q7YJ 1FMAE 1N5WB 2I1OA 3C2FA 3ETRC 4WFBJ 3G4SH 1Q81J 1Y69K 1FFUB 4UY8M 1YI2H 1YHQH 1WYGA 1VQ4H 3J7ZM 1QPOA 3CD6H 4C7YA 2WK5A 3C2RA 4IOAJ 2Q5WE 4IO9J 2E3TA 1DGJA 3H5QA 2OTJH 2OMDA 4U67J 3WO1A 2W54B 3SR6C 3CCVH 1NJIJ 5EY3A 1VQPH 3CMEH 1VLBA 3CC4H 1FM0E 4GA4A 1VQLH 2TPTA 3AN1A 5HULA 5GAEN 3AM9A 5AYXA 1VQKH 1VQ5H 1S72H 1N5XA 3GNNA 4WF9J 4ZOHA 1VQ9H 3C2OA 3CCJH 2QIEA 1YIJH 1OTPA 2W55B 1W2BH 1M1KJ 1YTKA 2B7PA 3C2VA 1YTDA
chains in the Genus database with same CATH topology
1K9MJ 5DM7J 1YJ9H 5MLCO 2ZJPJ 1N8RJ 3G71H 3OW2H 4WFAJ 3CCEH 4WFNJ 1YJWH 1YJNH 3DLLJ 5GAGN 3CCLH 2QA4H 3I56H 1KD1J 1VQOH 2OTLH 2QEXH 1YITH 3CCSH 3G6EH 1VQNH 4WCEJ 5JVGJ 1VQMH 5JVHJ 1WKIA 5H1SO 5DM6J 1QVFH 3CC7H 2ZJQJ 1Q86J 2ZJRJ 1VQ7H 3CXCH 1VQ8H 5GADN 3CCUH 3PIPJ 3CMAH 3CPWH 1JJ2H 1K8AJ 5HL7J 3CCRH 3CCQH 1M90J 2PA2A 5GAHN 3CCMH 1VQ6H 3I55H 4IOCJ 1KQSH 1KC8J 3CF5J 1Q82J 1QVGH 1K73J 3CC2H 3PIOJ 5AN9F 1Q7YJ 1Q81J 4WFBJ 3G4SH 1Y69K 4UY8M 1YI2H 1YHQH 1VQ4H 3J7ZM 3CD6H 4IOAJ 4IO9J 2OTJH 4U67J 3CCVH 1NJIJ 1VQPH 3CMEH 3CC4H 1VQLH 5GAEN 1VQKH 1VQ5H 1S72H 4WF9J 1VQ9H 3CCJH 1YIJH 1W2BH 1M1KJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M J;  5DM7 J;  1YJ9 H;  5MLC O;  2ZJP J;  1N8R J;  3G71 H;  3OW2 H;  4WFA J;  3CCE H;  4WFN J;  1YJW H;  1YJN H;  3DLL J;  5GAG N;  3CCL H;  2QA4 H;  3I56 H;  1KD1 J;  1VQO H;  2OTL H;  2QEX H;  1YIT H;  3CCS H;  3G6E H;  1VQN H;  4WCE J;  5JVG J;  1VQM H;  5JVH J;  1WKI A;  5H1S O;  5DM6 J;  1QVF H;  3CC7 H;  2ZJQ J;  1Q86 J;  2ZJR J;  1VQ7 H;  3CXC H;  1VQ8 H;  5GAD N;  3CCU H;  3PIP J;  3CMA H;  3CPW H;  1JJ2 H;  1K8A J;  5HL7 J;  3CCR H;  3CCQ H;  1M90 J;  2PA2 A;  5GAH N;  3CCM H;  1VQ6 H;  3I55 H;  4IOC J;  1KQS H;  1KC8 J;  3CF5 J;  1Q82 J;  1QVG H;  1K73 J;  3CC2 H;  3PIO J;  5AN9 F;  1Q7Y J;  1Q81 J;  4WFB J;  3G4S H;  1Y69 K;  4UY8 M;  1YI2 H;  1YHQ H;  1VQ4 H;  3J7Z M;  3CD6 H;  4IOA J;  4IO9 J;  2OTJ H;  4U67 J;  3CCV H;  1NJI J;  1VQP H;  3CME H;  3CC4 H;  1VQL H;  5GAE N;  1VQK H;  1VQ5 H;  1S72 H;  4WF9 J;  1VQ9 H;  3CCJ H;  1YIJ H;  1W2B H;  1M1K J; 
#chains in the Genus database with same CATH topology
 2I14 A;  1SIJ A;  1K9M J;  5DM7 J;  1YJ9 H;  3FAH A;  5MLC O;  2ZJP J;  1N8R J;  3G71 H;  4C80 A;  3NRZ C;  3OW2 H;  4GA6 A;  4WFA J;  3CCE H;  4WFN J;  4US9 A;  1UOU A;  3NVV C;  4EAD A;  4KWV A;  1QPN A;  1YJW H;  5AYZ A;  1YJN H;  3DLL J;  1N62 B;  1RM6 A;  3NS1 C;  3VMM A;  4I9A A;  5GAG N;  3CCL H;  2QA4 H;  3I56 H;  3NVW C;  2J0F A;  1KD1 J;  1VQO H;  3C2E A;  2OTL H;  2QEX H;  1YIT H;  3AMZ A;  1QAP A;  3WO0 A;  3CCS H;  1N63 B;  3L4P A;  1BRW A;  4EAF A;  3G6E H;  1VQN H;  5MPO C;  3WNZ A;  3EUB 4;  4WCE J;  1X1O A;  3FC4 A;  4GA5 A;  5JVG J;  1O4U A;  2W3R B;  1VQM H;  1QPQ A;  5JVH J;  5HUO A;  2WK6 A;  4KWW A;  3NVZ C;  5AYY A;  1WKI A;  2B7N A;  4US8 A;  1NVJ A;  4USA A;  5H1S O;  1AZY A;  4X46 A;  1FO4 A;  5HUP A;  3PAJ A;  5DM6 J;  4C7Z A;  1QVF H;  3CC7 H;  4AP8 A;  2ZJQ J;  1JRO B;  1NVI E;  1N60 B;  3L0G A;  1Q86 J;  2ZJR J;  2DSJ A;  1VQ7 H;  1ZXI B;  3CXC H;  4LHM A;  1VQ8 H;  5GAD N;  3CCU H;  3PIP J;  3BII E;  3B9J C;  2WP4 A;  3CMA H;  1JRP B;  3RPF A;  3CPW H;  1V97 A;  2B7Q A;  5EP8 A;  1JJ2 H;  1K8A J;  1QPR A;  5HL7 J;  2W3S B;  3CCR H;  3CCQ H;  1VDV A;  1SB3 A;  2PA2 A;  1M90 J;  1FFV B;  4YYY A;  5GAH N;  3CCM H;  1VQ6 H;  1N61 B;  3I55 H;  2JBM A;  3TQV A;  4IOC J;  1KQS H;  1YTE A;  3NVY C;  1KC8 J;  4YEK A;  3CF5 J;  1Q82 J;  1QVG H;  4XR5 A;  1K73 J;  3CC2 H;  3PIO J;  1FIQ C;  5AN9 F;  1Q7Y J;  1FMA E;  1N5W B;  2I1O A;  3C2F A;  3ETR C;  4WFB J;  3G4S H;  1Q81 J;  1Y69 K;  1FFU B;  4UY8 M;  1YI2 H;  1YHQ H;  1WYG A;  1VQ4 H;  3J7Z M;  1QPO A;  3CD6 H;  4C7Y A;  2WK5 A;  3C2R A;  4IOA J;  2Q5W E;  4IO9 J;  2E3T A;  1DGJ A;  3H5Q A;  2OTJ H;  2OMD A;  4U67 J;  3WO1 A;  2W54 B;  3SR6 C;  3CCV H;  1NJI J;  5EY3 A;  1VQP H;  3CME H;  1VLB A;  3CC4 H;  1FM0 E;  4GA4 A;  1VQL H;  2TPT A;  3AN1 A;  5HUL A;  5GAE N;  3AM9 A;  5AYX A;  1VQK H;  1VQ5 H;  1S72 H;  1N5X A;  3GNN A;  4WF9 J;  4ZOH A;  1VQ9 H;  3C2O A;  3CCJ H;  2QIE A;  1YIJ H;  1OTP A;  2W55 B;  1W2B H;  1M1K J;  1YTK A;  2B7P A;  3C2V A;  1YTD A; 
#chains in the Genus database with same CATH homology
 1K9M J;  5DM7 J;  1YJ9 H;  5MLC O;  2ZJP J;  1N8R J;  3G71 H;  3OW2 H;  4WFA J;  3CCE H;  4WFN J;  1YJW H;  1YJN H;  3DLL J;  5GAG N;  3CCL H;  2QA4 H;  3I56 H;  1KD1 J;  1VQO H;  2OTL H;  2QEX H;  1YIT H;  3CCS H;  3G6E H;  1VQN H;  4WCE J;  5JVG J;  1VQM H;  5JVH J;  1WKI A;  5H1S O;  5DM6 J;  1QVF H;  3CC7 H;  2ZJQ J;  1Q86 J;  2ZJR J;  1VQ7 H;  3CXC H;  1VQ8 H;  5GAD N;  3CCU H;  3PIP J;  3CMA H;  3CPW H;  1JJ2 H;  1K8A J;  5HL7 J;  3CCR H;  3CCQ H;  1M90 J;  2PA2 A;  5GAH N;  3CCM H;  1VQ6 H;  3I55 H;  4IOC J;  1KQS H;  1KC8 J;  3CF5 J;  1Q82 J;  1QVG H;  1K73 J;  3CC2 H;  3PIO J;  5AN9 F;  1Q7Y J;  1Q81 J;  4WFB J;  3G4S H;  1Y69 K;  4UY8 M;  1YI2 H;  1YHQ H;  1VQ4 H;  3J7Z M;  3CD6 H;  4IOA J;  4IO9 J;  2OTJ H;  4U67 J;  3CCV H;  1NJI J;  1VQP H;  3CME H;  3CC4 H;  1VQL H;  5GAE N;  1VQK H;  1VQ5 H;  1S72 H;  4WF9 J;  1VQ9 H;  3CCJ H;  1YIJ H;  1W2B H;  1M1K J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...