1JJ2K

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 29
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1jj2K02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1jj2K01
1YITO 3CCEL 1VQLL 1QVFN 1VQOL 3CMAO 1Q81P 1VQ5L 1YJWL 1VQNO 1YJ9O 1YI2L 1QVGN 1Q81M 1VQ9O 1VQ8L 1K9MP 1YJNL 1KD1P 1VQ4O 3CCLL 3CCMO 1VQML 1K9MM 3CCUO 1KD1M 2OTLL 1VQ6O 3CC4O 3OW2N 3G6EL 1W2BK 3CCRO 1M90M 3CCQO 1VQ7L 3CC2O 1QVFK 3CCSL 3G71O 3I56O 3G4SO 1M1KP 3CCJL 2OTJO 2QEXO 3CCEO 1VQLO 1QVGK 3CMEL 3CCVL 1VQOO 1M1KM 1VQ5O 1YJWO 3CPWN 1YI2O 1VQ8O 1YJNO 1M90P 3OW2K 1YIJL 1VQKL 1Q7YP 2QA4L 3CCLO 1Q86P 3CD6L 2OTLO 3CC7L 1Q7YM 1VQPL 3G6EO 1Q86M 1YHQL 3CXCN 1VQ7O 1NJIM 1JJ2N 3CCSO 3I55L 1K8AP 3CCJO 1S72L 1N8RP 3CPWK 3CMEO 1YITL 1K8AM 3CCVO 1KQSN 1N8RM 1Q82P 3CMAL 1VQNL 1VQMO 1Q82M 1YJ9L 1VQ9L 1YIJO 1NJIP 1VQKO 2QA4O 3CXCK 1K73P 1VQ4L 3CCML 1JJ2K 3CD6O 3CCUL 3CC7O 1VQPO 1VQ6L 3CC4L 1K73M 1YHQO 3CCRL 1KC8P 3CCQL 3CC2L 1KQSK 3I55O 3G71L 3I56L 1S72O 3G4SL 1KC8M 1W2BN 2OTJL 2QEXL
chains in the Genus database with same CATH superfamily
1YITO 3CCEL 1VQLL 1QVFN 1VQOL 3CMAO 1Q81P 1VQ5L 1YJWL 1VQNO 1YJ9O 1YI2L 1QVGN 1Q81M 1VQ9O 1VQ8L 1K9MP 1YJNL 1KD1P 1VQ4O 2YZSA 3CCLL 3CCMO 1VQML 1K9MM 3CCUO 5DQTA 1KD1M 2OTLL 1VQ6O 3CC4O 3OW2N 3G6EL 1W2BK 3CCRO 4P6IC 1M90M 3CCQO 1VQ7L 3CC2O 1QVFK 3CCSL 4WJ0A 3NKDA 3G71O 3I56O 3G4SO 1M1KP 3CCJL 2OTJO 2QEXO 3CCEO 1VQLO 1QVGK 3CMEL 3CCVL 1VQOO 1M1KM 1VQ5O 1YJWO 3CPWN 1YI2O 1VQ8O 4XTKA 1YJNO 1M90P 3OW2K 1YIJL 1VQKL 2QA4L 5DS6A 1Q7YP 3CCLO 1Q86P 3CD6L 2OTLO 3CC7L 1Q7YM 1VQPL 3G6EO 1Q86M 4W8KA 3CXCN 1YHQL 4QDLA 1VQ7O 1NJIM 1JJ2N 3CCSO 5DS5A 3I55L 1K8AP 3CCJO 1S72L 1N8RP 3CPWK 3CMEO 1YITL 1K8AM 3CCVO 1KQSN 1N8RM 1Q82P 3CMAL 5DQZA 5DLJA 1VQNL 1VQMO 1Q82M 1YJ9L 1VQ9L 5DS4A 1YIJO 1NJIP 1VQKO 2QA4O 3CXCK 1K73P 1VQ4L 3CCML 1JJ2K 3CD6O 3CCUL 3CC7O 1VQPO 1VQ6L 3CC4L 4N06A 1K73M 1YHQO 3GODA 3CCRL 5FCLA 1KC8P 3CCQL 3CC2L 1KQSK 3I55O 3G71L 3I56L 1S72O 3G4SL 1KC8M 1W2BN 2OTJL 2QEXL
chains in the Genus database with same CATH topology
1YITO 3CCEL 1VQLL 1QVFN 1VQOL 3CMAO 1Q81P 1VQ5L 1YJWL 1VQNO 1YJ9O 1YI2L 1QVGN 1Q81M 1VQ9O 1VQ8L 1K9MP 1YJNL 1KD1P 1VQ4O 2YZSA 3CCLL 3CCMO 1VQML 1K9MM 3CCUO 5DQTA 1KD1M 2OTLL 1VQ6O 3CC4O 3OW2N 3G6EL 1W2BK 3CCRO 4P6IC 1M90M 3CCQO 1VQ7L 3CC2O 1QVFK 3CCSL 4WJ0A 3NKDA 3G71O 3I56O 3G4SO 1M1KP 3CCJL 2OTJO 2QEXO 3CCEO 1VQLO 1QVGK 3CMEL 3CCVL 1VQOO 1M1KM 1VQ5O 1YJWO 3CPWN 1YI2O 1VQ8O 4XTKA 1YJNO 1M90P 3OW2K 1YIJL 1VQKL 2QA4L 5DS6A 1Q7YP 3CCLO 1Q86P 3CD6L 2OTLO 3CC7L 1Q7YM 1VQPL 3G6EO 1Q86M 4W8KA 3CXCN 1YHQL 4QDLA 1VQ7O 1NJIM 1JJ2N 3CCSO 5DS5A 3I55L 1K8AP 3CCJO 1S72L 1N8RP 3CPWK 3CMEO 1YITL 1K8AM 3CCVO 1KQSN 1N8RM 1Q82P 3CMAL 5DQZA 5DLJA 1VQNL 1VQMO 1Q82M 1YJ9L 1VQ9L 5DS4A 1YIJO 1NJIP 1VQKO 2QA4O 3CXCK 1K73P 1VQ4L 3CCML 1JJ2K 3CD6O 3CCUL 3CC7O 1VQPO 1VQ6L 3CC4L 4N06A 1K73M 1YHQO 3GODA 3CCRL 5FCLA 1KC8P 3CCQL 3CC2L 1KQSK 3I55O 3G71L 3I56L 1S72O 3G4SL 1KC8M 1W2BN 2OTJL 2QEXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT O;  3CCE L;  1VQL L;  1QVF N;  1VQO L;  3CMA O;  1Q81 P;  1VQ5 L;  1YJW L;  1VQN O;  1YJ9 O;  1YI2 L;  1QVG N;  1Q81 M;  1VQ9 O;  1VQ8 L;  1K9M P;  1YJN L;  1KD1 P;  1VQ4 O;  3CCL L;  3CCM O;  1VQM L;  1K9M M;  3CCU O;  1KD1 M;  2OTL L;  1VQ6 O;  3CC4 O;  3OW2 N;  3G6E L;  1W2B K;  3CCR O;  1M90 M;  3CCQ O;  1VQ7 L;  3CC2 O;  1QVF K;  3CCS L;  3G71 O;  3I56 O;  3G4S O;  1M1K P;  3CCJ L;  2OTJ O;  2QEX O;  3CCE O;  1VQL O;  1QVG K;  3CME L;  3CCV L;  1VQO O;  1M1K M;  1VQ5 O;  1YJW O;  3CPW N;  1YI2 O;  1VQ8 O;  1YJN O;  1M90 P;  3OW2 K;  1YIJ L;  1VQK L;  1Q7Y P;  2QA4 L;  3CCL O;  1Q86 P;  3CD6 L;  2OTL O;  3CC7 L;  1Q7Y M;  1VQP L;  3G6E O;  1Q86 M;  1YHQ L;  3CXC N;  1VQ7 O;  1NJI M;  1JJ2 N;  3CCS O;  3I55 L;  1K8A P;  3CCJ O;  1S72 L;  1N8R P;  3CPW K;  3CME O;  1YIT L;  1K8A M;  3CCV O;  1KQS N;  1N8R M;  1Q82 P;  3CMA L;  1VQN L;  1VQM O;  1Q82 M;  1YJ9 L;  1VQ9 L;  1YIJ O;  1NJI P;  1VQK O;  2QA4 O;  3CXC K;  1K73 P;  1VQ4 L;  3CCM L;  1JJ2 K;  3CD6 O;  3CCU L;  3CC7 O;  1VQP O;  1VQ6 L;  3CC4 L;  1K73 M;  1YHQ O;  3CCR L;  1KC8 P;  3CCQ L;  3CC2 L;  1KQS K;  3I55 O;  3G71 L;  3I56 L;  1S72 O;  3G4S L;  1KC8 M;  1W2B N;  2OTJ L;  2QEX L; 
#chains in the Genus database with same CATH topology
 1YIT O;  3CCE L;  1VQL L;  1QVF N;  1VQO L;  3CMA O;  1Q81 P;  1VQ5 L;  1YJW L;  1VQN O;  1YJ9 O;  1YI2 L;  1QVG N;  1Q81 M;  1VQ9 O;  1VQ8 L;  1K9M P;  1YJN L;  1KD1 P;  1VQ4 O;  2YZS A;  3CCL L;  3CCM O;  1VQM L;  1K9M M;  3CCU O;  5DQT A;  1KD1 M;  2OTL L;  1VQ6 O;  3CC4 O;  3OW2 N;  3G6E L;  1W2B K;  3CCR O;  4P6I C;  1M90 M;  3CCQ O;  1VQ7 L;  3CC2 O;  1QVF K;  3CCS L;  4WJ0 A;  3NKD A;  3G71 O;  3I56 O;  3G4S O;  1M1K P;  3CCJ L;  2OTJ O;  2QEX O;  3CCE O;  1VQL O;  1QVG K;  3CME L;  3CCV L;  1VQO O;  1M1K M;  1VQ5 O;  1YJW O;  3CPW N;  1YI2 O;  1VQ8 O;  4XTK A;  1YJN O;  1M90 P;  3OW2 K;  1YIJ L;  1VQK L;  2QA4 L;  5DS6 A;  1Q7Y P;  3CCL O;  1Q86 P;  3CD6 L;  2OTL O;  3CC7 L;  1Q7Y M;  1VQP L;  3G6E O;  1Q86 M;  4W8K A;  3CXC N;  1YHQ L;  4QDL A;  1VQ7 O;  1NJI M;  1JJ2 N;  3CCS O;  5DS5 A;  3I55 L;  1K8A P;  3CCJ O;  1S72 L;  1N8R P;  3CPW K;  3CME O;  1YIT L;  1K8A M;  3CCV O;  1KQS N;  1N8R M;  1Q82 P;  3CMA L;  5DQZ A;  5DLJ A;  1VQN L;  1VQM O;  1Q82 M;  1YJ9 L;  1VQ9 L;  5DS4 A;  1YIJ O;  1NJI P;  1VQK O;  2QA4 O;  3CXC K;  1K73 P;  1VQ4 L;  3CCM L;  1JJ2 K;  3CD6 O;  3CCU L;  3CC7 O;  1VQP O;  1VQ6 L;  3CC4 L;  4N06 A;  1K73 M;  1YHQ O;  3GOD A;  3CCR L;  5FCL A;  1KC8 P;  3CCQ L;  3CC2 L;  1KQS K;  3I55 O;  3G71 L;  3I56 L;  1S72 O;  3G4S L;  1KC8 M;  1W2B N;  2OTJ L;  2QEX L; 
#chains in the Genus database with same CATH homology
 1YIT O;  3CCE L;  1VQL L;  1QVF N;  1VQO L;  3CMA O;  1Q81 P;  1VQ5 L;  1YJW L;  1VQN O;  1YJ9 O;  1YI2 L;  1QVG N;  1Q81 M;  1VQ9 O;  1VQ8 L;  1K9M P;  1YJN L;  1KD1 P;  1VQ4 O;  2YZS A;  3CCL L;  3CCM O;  1VQM L;  1K9M M;  3CCU O;  5DQT A;  1KD1 M;  2OTL L;  1VQ6 O;  3CC4 O;  3OW2 N;  3G6E L;  1W2B K;  3CCR O;  4P6I C;  1M90 M;  3CCQ O;  1VQ7 L;  3CC2 O;  1QVF K;  3CCS L;  4WJ0 A;  3NKD A;  3G71 O;  3I56 O;  3G4S O;  1M1K P;  3CCJ L;  2OTJ O;  2QEX O;  3CCE O;  1VQL O;  1QVG K;  3CME L;  3CCV L;  1VQO O;  1M1K M;  1VQ5 O;  1YJW O;  3CPW N;  1YI2 O;  1VQ8 O;  4XTK A;  1YJN O;  1M90 P;  3OW2 K;  1YIJ L;  1VQK L;  2QA4 L;  5DS6 A;  1Q7Y P;  3CCL O;  1Q86 P;  3CD6 L;  2OTL O;  3CC7 L;  1Q7Y M;  1VQP L;  3G6E O;  1Q86 M;  4W8K A;  3CXC N;  1YHQ L;  4QDL A;  1VQ7 O;  1NJI M;  1JJ2 N;  3CCS O;  5DS5 A;  3I55 L;  1K8A P;  3CCJ O;  1S72 L;  1N8R P;  3CPW K;  3CME O;  1YIT L;  1K8A M;  3CCV O;  1KQS N;  1N8R M;  1Q82 P;  3CMA L;  5DQZ A;  5DLJ A;  1VQN L;  1VQM O;  1Q82 M;  1YJ9 L;  1VQ9 L;  5DS4 A;  1YIJ O;  1NJI P;  1VQK O;  2QA4 O;  3CXC K;  1K73 P;  1VQ4 L;  3CCM L;  1JJ2 K;  3CD6 O;  3CCU L;  3CC7 O;  1VQP O;  1VQ6 L;  3CC4 L;  4N06 A;  1K73 M;  1YHQ O;  3GOD A;  3CCR L;  5FCL A;  1KC8 P;  3CCQ L;  3CC2 L;  1KQS K;  3I55 O;  3G71 L;  3I56 L;  1S72 O;  3G4S L;  1KC8 M;  1W2B N;  2OTJ L;  2QEX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...