1JKNA

Solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
165
structure length
165
Chain Sequence
b'GPLGSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase
publication title The structure of Ap(4)A hydrolase complexed with ATP-MgF(x) reveals the basis of substrate binding.
pubmed doi rcsb
source organism Lupinus angustifolius
molecule tags Hydrolase
total genus 27
structure length 165
sequence length 165
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1jknA00
5IW5A 3P5TA 1VIUA 5FSIA 1V8MA 2A8SA 2B06A 1RRQA 2QJTA 1Q27A 2YVMA 2G74A 1MQEA 5BS6A 3U53A 4S2WA 1G0SA 1VC9A 4N1UA 1NFSA 2A8RA 5C7QA 1XSBA 2YVOA 3MCFA 2QJOA 3N77A 5DD4A 4ZG0A 5ISYA 2FVVA 1MP2A 1MR2A 2I8UA 3N9UA 3O52A 5GHOA 2RRKA 3DUPA 2CL3A 1X83A 3BAPA 3ID9A 1VRLA 1QVJA 2GT2A 1VCDA 3CNGA 1XSCA 4IJXA 4JZTA 1PPWA 1PUNA 5I8UA 3WHWA 5GHIA 3H95A 5C7TA 2GB5A 3I9XA 5GHNA 5ANSA 2DSBA 3R03A 2ICKA 1V8LA 3O6ZA 3X0LA 1X51A 4DYWA 1NQYA 2O5FA 1MQWA 3Q93A 3QSJA 1V8RA 3X0QA 3X0KA 5DPKA 5DEQA 3Q2SA 3EESA 3F6AA 1KTGA 3GWYA 1SOIA 1U20A 2AZWA 1I9AA 5FSLA 3X0JA 4K6EA 1XSAA 1JRKA 4HVYA 1NFZA 2A8QA 2O1CA 2YYHA 5DDGA 5FSNA 3COUA 2DUKA 1VK6A 2Q9PA 3Q2TA 3GZ5A 2W4EA 3ACAA 4KYXA 1V8SA 3EEUA 1RYAA 4C9WA 5GHMA 3J7Ye 3G0QA 4YPRA 4JZVA 4NFXA 2KDVA 3Q91A 3RH7A 3X0SA 1SU2A 4C9XA 1RRSA 5LPGA 3A6SA 5ANWA 1VHGA 1PVFA 1F3YA 4V14A 3Q4IA 1V8NA 1V8TA 5ANVA 5BONA 1PUSA 1PUQA 5HZXA 3FFUA 1V8VA 3E57A 1K26A 3GG6A 5C8LA 5CFIA 4KG3A 1SZ3A 2GT4A 3EXQA 2J8QA 2A8PA 4S2XA 2I6KA 3O8SA 1KT9A 5GHPA 3SONA 3L85A 2A8TA 2FKBA 3MGMA 3MDIA 2YVPA 2DSDA 3AC9A 3EF5A 1V8WA 5GHJA 3ZR0A 3X0RA 3X0NA 2R5WA 4KTBA 3SHDA 3FK9A 3OGAA 5CFJA 4ICKA 3MDGA 1NQZA 2QKMB 4N1TA 2A6TA 1GA7A 2XSQA 1Q54A 1TUMA 1V8YA 3X0OA 3ZR1A 1G9QA 1SJYA 2VNQA 1PPVA 3GZ6A 3X0PA 4NFWA 3HYQA 4JZUA 3F13A 1MUTA 1PPXA 5GHQA 2VNPA 3I7UA 3A6TA 1VIQA 3P6YA 2JVBA 3A6UA 3DKUA 4HFQA 2G73A 1R67A 1VC8A 1VHZA 4ILQA 3SMDA 1V8IA 3FJYA 4YOQA 5FSOA 1HX3A 5IW4A 2O5WA 3O69A 5ANTA 3FSPA 1KHZA 3BM4A 3KVHA 4MPOA 1OW2A 2B0VA 4S2YA 1X84A 2I8TA 1HZTA 3X0MA 1MK1A 2ICJA 3HHJA 3O61A 3X0IA 1IRYA 4S2VA 1K2EA 3I7VA 3A6VA 2PQVA 2KDWA 3GRNA 1Q33A 3Q1PA 5FSKA 2DHOA 2FMLA 4JZSA 4KG4A 3FCMA 2PNYA 2YVNA 5FSMA 2DSCA 1V8UA 2B2KA 3GZ8A 1JKNA 5ANUA 4YPHA 3BHOA
chains in the Genus database with same CATH superfamily
2CZRA 5IW5A 3P5TA 1VIUA 5FSIA 1V8MA 2A8SA 2B06A 1RRQA 2QJTA 1Q27A 2YVMA 2G74A 1MQEA 5BS6A 3U53A 4S2WA 1G0SA 1VC9A 4N1UA 1NFSA 2A8RA 5C7QA 1XSBA 2YVOA 3MCFA 2QJOA 3N77A 5DD4A 4ZG0A 5ISYA 2FVVA 1MP2A 1MR2A 2I8UA 3N9UA 3O52A 5GHOA 2RRKA 3DUPA 2CL3A 1X83A 3BAPA 3ID9A 1VRLA 1QVJA 2GT2A 1VCDA 3CNGA 1XSCA 4IJXA 4JZTA 1PPWA 1PUNA 5I8UA 3WHWA 5GHIA 3H95A 4J7GA 5C7TA 2GB5A 3I9XA 5GHNA 5ANSA 2DSBA 3R03A 2ICKA 1V8LA 3O6ZA 3X0LA 1X51A 4DYWA 1NQYA 2O5FA 1MQWA 3Q93A 3QSJA 1V8RA 3X0QA 3X0KA 5DPKA 5DEQA 3Q2SA 3EESA 3F6AA 1KTGA 3GWYA 1SOIA 1U20A 2AZWA 1I9AA 5FSLA 3X0JA 4K6EA 1XSAA 1JRKA 4HVYA 1NFZA 2A8QA 2O1CA 2YYHA 5DDGA 5FSNA 3COUA 2DUKA 1VK6A 2Q9PA 3Q2TA 3GZ5A 2W4EA 3ACAA 4KYXA 1V8SA 3EEUA 1RYAA 4C9WA 5GHMA 3J7Ye 3G0QA 4YPRA 4JZVA 4NFXA 2KDVA 3Q91A 3RH7A 3X0SA 1SU2A 4C9XA 1RRSA 5LPGA 3A6SA 5ANWA 1VHGA 1PVFA 1F3YA 4V14A 3Q4IA 1V8NA 1V8TA 5ANVA 5BONA 1PUSA 1PUQA 5HZXA 3FFUA 1V8VA 3E57A 1K26A 3GG6A 5C8LA 5CFIA 4KG3A 1SZ3A 2GT4A 3EXQA 2J8QA 2A8PA 4S2XA 2I6KA 3O8SA 1KT9A 5GHPA 3SONA 3L85A 2A8TA 2FKBA 3MGMA 3MDIA 2YVPA 2DSDA 3AC9A 3EF5A 1V8WA 5GHJA 3ZR0A 3X0RA 3X0NA 2R5WA 4KTBA 3SHDA 4J7HA 3FK9A 3OGAA 5CFJA 4ICKA 3MDGA 1NQZA 2QKMB 4N1TA 2A6TA 1GA7A 2XSQA 1Q54A 1TUMA 1V8YA 3X0OA 3ZR1A 1G9QA 1SJYA 2VNQA 1PPVA 3GZ6A 3X0PA 4NFWA 3HYQA 4JZUA 3F13A 1MUTA 1PPXA 5GHQA 2VNPA 3I7UA 3A6TA 1VIQA 3P6YA 2JVBA 3A6UA 3DKUA 4HFQA 2G73A 1R67A 1VC8A 1VHZA 4ILQA 3SMDA 1V8IA 3FJYA 4YOQA 5FSOA 1HX3A 5IW4A 2O5WA 3O69A 5ANTA 3FSPA 1KHZA 3BM4A 3KVHA 4MPOA 1OW2A 2B0VA 4S2YA 1X84A 2I8TA 1HZTA 3X0MA 1MK1A 2ICJA 3HHJA 3O61A 3X0IA 1IRYA 4S2VA 1K2EA 3I7VA 3A6VA 2PQVA 2KDWA 3GRNA 1Q33A 3Q1PA 5FSKA 2DHOA 2FMLA 4JZSA 4KG4A 3FCMA 2PNYA 2YVNA 5FSMA 2DSCA 1V8UA 2B2KA 3GZ8A 1JKNA 5ANUA 4YPHA 3BHOA
chains in the Genus database with same CATH topology
2CZRA 5IW5A 3P5TA 1VIUA 5FSIA 1V8MA 2A8SA 2B06A 1RRQA 2QJTA 1Q27A 2YVMA 2G74A 1MQEA 5BS6A 3U53A 4S2WA 1G0SA 1VC9A 4N1UA 1NFSA 2A8RA 5C7QA 1XSBA 2YVOA 3MCFA 2QJOA 3N77A 5DD4A 4ZG0A 5ISYA 2FVVA 1MP2A 1MR2A 2I8UA 3N9UA 3O52A 5GHOA 2RRKA 3DUPA 2CL3A 1X83A 3BAPA 3ID9A 1VRLA 1QVJA 2GT2A 1VCDA 3CNGA 1XSCA 4IJXA 4JZTA 1PPWA 1PUNA 5I8UA 3WHWA 5GHIA 3H95A 4J7GA 5C7TA 2GB5A 3I9XA 5GHNA 5ANSA 2DSBA 3R03A 2ICKA 1V8LA 3O6ZA 3X0LA 1X51A 4DYWA 1NQYA 2O5FA 1MQWA 3Q93A 3QSJA 1V8RA 3X0QA 3X0KA 5DPKA 5DEQA 3Q2SA 3EESA 3F6AA 1KTGA 3GWYA 1SOIA 1U20A 2AZWA 1I9AA 5FSLA 3X0JA 4K6EA 1XSAA 1JRKA 4HVYA 1NFZA 2A8QA 2O1CA 2YYHA 5DDGA 5FSNA 3COUA 2DUKA 1VK6A 2Q9PA 3Q2TA 3GZ5A 2W4EA 3ACAA 4KYXA 1V8SA 3EEUA 1RYAA 4C9WA 5GHMA 3J7Ye 3G0QA 4YPRA 4JZVA 4NFXA 2KDVA 3Q91A 3RH7A 3X0SA 1SU2A 4C9XA 1RRSA 5LPGA 3A6SA 5ANWA 1VHGA 1PVFA 1F3YA 4V14A 3Q4IA 1V8NA 1V8TA 5ANVA 5BONA 1PUSA 1PUQA 5HZXA 3FFUA 1V8VA 3E57A 1K26A 3GG6A 5C8LA 5CFIA 4KG3A 1SZ3A 2GT4A 3EXQA 2J8QA 2A8PA 4S2XA 2I6KA 3O8SA 1KT9A 5GHPA 3SONA 3L85A 2A8TA 2FKBA 3MGMA 3MDIA 2YVPA 2DSDA 3AC9A 3EF5A 1V8WA 5GHJA 3ZR0A 3X0RA 3X0NA 2R5WA 4KTBA 3SHDA 4J7HA 3FK9A 3OGAA 5CFJA 4ICKA 3MDGA 1NQZA 2QKMB 4N1TA 2A6TA 1GA7A 2XSQA 1Q54A 1TUMA 1V8YA 3X0OA 3ZR1A 1G9QA 1SJYA 2VNQA 1PPVA 3GZ6A 3X0PA 4NFWA 3HYQA 4JZUA 3F13A 1MUTA 1PPXA 5GHQA 2VNPA 3I7UA 3A6TA 1VIQA 3P6YA 2JVBA 3A6UA 3DKUA 4HFQA 2G73A 1R67A 1VC8A 1VHZA 4ILQA 3SMDA 1V8IA 3FJYA 4YOQA 5FSOA 1HX3A 5IW4A 2O5WA 3O69A 5ANTA 3FSPA 1KHZA 3BM4A 3KVHA 4MPOA 1OW2A 2B0VA 4S2YA 1X84A 2I8TA 1HZTA 3X0MA 1MK1A 2ICJA 3HHJA 3O61A 3X0IA 1IRYA 4S2VA 1K2EA 3I7VA 3A6VA 2PQVA 2KDWA 3GRNA 1Q33A 3Q1PA 5FSKA 2DHOA 2FMLA 4JZSA 4KG4A 3FCMA 2PNYA 2YVNA 5FSMA 2DSCA 1V8UA 2B2KA 3GZ8A 1JKNA 5ANUA 4YPHA 3BHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IW5 A;  3P5T A;  1VIU A;  5FSI A;  1V8M A;  2A8S A;  2B06 A;  1RRQ A;  2QJT A;  1Q27 A;  2YVM A;  2G74 A;  1MQE A;  5BS6 A;  3U53 A;  4S2W A;  1G0S A;  1VC9 A;  4N1U A;  1NFS A;  2A8R A;  5C7Q A;  1XSB A;  2YVO A;  3MCF A;  2QJO A;  3N77 A;  5DD4 A;  4ZG0 A;  5ISY A;  2FVV A;  1MP2 A;  1MR2 A;  2I8U A;  3N9U A;  3O52 A;  5GHO A;  2RRK A;  3DUP A;  2CL3 A;  1X83 A;  3BAP A;  3ID9 A;  1VRL A;  1QVJ A;  2GT2 A;  1VCD A;  3CNG A;  1XSC A;  4IJX A;  4JZT A;  1PPW A;  1PUN A;  5I8U A;  3WHW A;  5GHI A;  3H95 A;  5C7T A;  2GB5 A;  3I9X A;  5GHN A;  5ANS A;  2DSB A;  3R03 A;  2ICK A;  1V8L A;  3O6Z A;  3X0L A;  1X51 A;  4DYW A;  1NQY A;  2O5F A;  1MQW A;  3Q93 A;  3QSJ A;  1V8R A;  3X0Q A;  3X0K A;  5DPK A;  5DEQ A;  3Q2S A;  3EES A;  3F6A A;  1KTG A;  3GWY A;  1SOI A;  1U20 A;  2AZW A;  1I9A A;  5FSL A;  3X0J A;  4K6E A;  1XSA A;  1JRK A;  4HVY A;  1NFZ A;  2A8Q A;  2O1C A;  2YYH A;  5DDG A;  5FSN A;  3COU A;  2DUK A;  1VK6 A;  2Q9P A;  3Q2T A;  3GZ5 A;  2W4E A;  3ACA A;  4KYX A;  1V8S A;  3EEU A;  1RYA A;  4C9W A;  5GHM A;  3J7Y e;  3G0Q A;  4YPR A;  4JZV A;  4NFX A;  2KDV A;  3Q91 A;  3RH7 A;  3X0S A;  1SU2 A;  4C9X A;  1RRS A;  5LPG A;  3A6S A;  5ANW A;  1VHG A;  1PVF A;  1F3Y A;  4V14 A;  3Q4I A;  1V8N A;  1V8T A;  5ANV A;  5BON A;  1PUS A;  1PUQ A;  5HZX A;  3FFU A;  1V8V A;  3E57 A;  1K26 A;  3GG6 A;  5C8L A;  5CFI A;  4KG3 A;  1SZ3 A;  2GT4 A;  3EXQ A;  2J8Q A;  2A8P A;  4S2X A;  2I6K A;  3O8S A;  1KT9 A;  5GHP A;  3SON A;  3L85 A;  2A8T A;  2FKB A;  3MGM A;  3MDI A;  2YVP A;  2DSD A;  3AC9 A;  3EF5 A;  1V8W A;  5GHJ A;  3ZR0 A;  3X0R A;  3X0N A;  2R5W A;  4KTB A;  3SHD A;  3FK9 A;  3OGA A;  5CFJ A;  4ICK A;  3MDG A;  1NQZ A;  2QKM B;  4N1T A;  2A6T A;  1GA7 A;  2XSQ A;  1Q54 A;  1TUM A;  1V8Y A;  3X0O A;  3ZR1 A;  1G9Q A;  1SJY A;  2VNQ A;  1PPV A;  3GZ6 A;  3X0P A;  4NFW A;  3HYQ A;  4JZU A;  3F13 A;  1MUT A;  1PPX A;  5GHQ A;  2VNP A;  3I7U A;  3A6T A;  1VIQ A;  3P6Y A;  2JVB A;  3A6U A;  3DKU A;  4HFQ A;  2G73 A;  1R67 A;  1VC8 A;  1VHZ A;  4ILQ A;  3SMD A;  1V8I A;  3FJY A;  4YOQ A;  5FSO A;  1HX3 A;  5IW4 A;  2O5W A;  3O69 A;  5ANT A;  3FSP A;  1KHZ A;  3BM4 A;  3KVH A;  4MPO A;  1OW2 A;  2B0V A;  4S2Y A;  1X84 A;  2I8T A;  1HZT A;  3X0M A;  1MK1 A;  2ICJ A;  3HHJ A;  3O61 A;  3X0I A;  1IRY A;  4S2V A;  1K2E A;  3I7V A;  3A6V A;  2PQV A;  2KDW A;  3GRN A;  1Q33 A;  3Q1P A;  5FSK A;  2DHO A;  2FML A;  4JZS A;  4KG4 A;  3FCM A;  2PNY A;  2YVN A;  5FSM A;  2DSC A;  1V8U A;  2B2K A;  3GZ8 A;  1JKN A;  5ANU A;  4YPH A;  3BHO A; 
#chains in the Genus database with same CATH topology
 2CZR A;  5IW5 A;  3P5T A;  1VIU A;  5FSI A;  1V8M A;  2A8S A;  2B06 A;  1RRQ A;  2QJT A;  1Q27 A;  2YVM A;  2G74 A;  1MQE A;  5BS6 A;  3U53 A;  4S2W A;  1G0S A;  1VC9 A;  4N1U A;  1NFS A;  2A8R A;  5C7Q A;  1XSB A;  2YVO A;  3MCF A;  2QJO A;  3N77 A;  5DD4 A;  4ZG0 A;  5ISY A;  2FVV A;  1MP2 A;  1MR2 A;  2I8U A;  3N9U A;  3O52 A;  5GHO A;  2RRK A;  3DUP A;  2CL3 A;  1X83 A;  3BAP A;  3ID9 A;  1VRL A;  1QVJ A;  2GT2 A;  1VCD A;  3CNG A;  1XSC A;  4IJX A;  4JZT A;  1PPW A;  1PUN A;  5I8U A;  3WHW A;  5GHI A;  3H95 A;  4J7G A;  5C7T A;  2GB5 A;  3I9X A;  5GHN A;  5ANS A;  2DSB A;  3R03 A;  2ICK A;  1V8L A;  3O6Z A;  3X0L A;  1X51 A;  4DYW A;  1NQY A;  2O5F A;  1MQW A;  3Q93 A;  3QSJ A;  1V8R A;  3X0Q A;  3X0K A;  5DPK A;  5DEQ A;  3Q2S A;  3EES A;  3F6A A;  1KTG A;  3GWY A;  1SOI A;  1U20 A;  2AZW A;  1I9A A;  5FSL A;  3X0J A;  4K6E A;  1XSA A;  1JRK A;  4HVY A;  1NFZ A;  2A8Q A;  2O1C A;  2YYH A;  5DDG A;  5FSN A;  3COU A;  2DUK A;  1VK6 A;  2Q9P A;  3Q2T A;  3GZ5 A;  2W4E A;  3ACA A;  4KYX A;  1V8S A;  3EEU A;  1RYA A;  4C9W A;  5GHM A;  3J7Y e;  3G0Q A;  4YPR A;  4JZV A;  4NFX A;  2KDV A;  3Q91 A;  3RH7 A;  3X0S A;  1SU2 A;  4C9X A;  1RRS A;  5LPG A;  3A6S A;  5ANW A;  1VHG A;  1PVF A;  1F3Y A;  4V14 A;  3Q4I A;  1V8N A;  1V8T A;  5ANV A;  5BON A;  1PUS A;  1PUQ A;  5HZX A;  3FFU A;  1V8V A;  3E57 A;  1K26 A;  3GG6 A;  5C8L A;  5CFI A;  4KG3 A;  1SZ3 A;  2GT4 A;  3EXQ A;  2J8Q A;  2A8P A;  4S2X A;  2I6K A;  3O8S A;  1KT9 A;  5GHP A;  3SON A;  3L85 A;  2A8T A;  2FKB A;  3MGM A;  3MDI A;  2YVP A;  2DSD A;  3AC9 A;  3EF5 A;  1V8W A;  5GHJ A;  3ZR0 A;  3X0R A;  3X0N A;  2R5W A;  4KTB A;  3SHD A;  4J7H A;  3FK9 A;  3OGA A;  5CFJ A;  4ICK A;  3MDG A;  1NQZ A;  2QKM B;  4N1T A;  2A6T A;  1GA7 A;  2XSQ A;  1Q54 A;  1TUM A;  1V8Y A;  3X0O A;  3ZR1 A;  1G9Q A;  1SJY A;  2VNQ A;  1PPV A;  3GZ6 A;  3X0P A;  4NFW A;  3HYQ A;  4JZU A;  3F13 A;  1MUT A;  1PPX A;  5GHQ A;  2VNP A;  3I7U A;  3A6T A;  1VIQ A;  3P6Y A;  2JVB A;  3A6U A;  3DKU A;  4HFQ A;  2G73 A;  1R67 A;  1VC8 A;  1VHZ A;  4ILQ A;  3SMD A;  1V8I A;  3FJY A;  4YOQ A;  5FSO A;  1HX3 A;  5IW4 A;  2O5W A;  3O69 A;  5ANT A;  3FSP A;  1KHZ A;  3BM4 A;  3KVH A;  4MPO A;  1OW2 A;  2B0V A;  4S2Y A;  1X84 A;  2I8T A;  1HZT A;  3X0M A;  1MK1 A;  2ICJ A;  3HHJ A;  3O61 A;  3X0I A;  1IRY A;  4S2V A;  1K2E A;  3I7V A;  3A6V A;  2PQV A;  2KDW A;  3GRN A;  1Q33 A;  3Q1P A;  5FSK A;  2DHO A;  2FML A;  4JZS A;  4KG4 A;  3FCM A;  2PNY A;  2YVN A;  5FSM A;  2DSC A;  1V8U A;  2B2K A;  3GZ8 A;  1JKN A;  5ANU A;  4YPH A;  3BHO A; 
#chains in the Genus database with same CATH homology
 2CZR A;  5IW5 A;  3P5T A;  1VIU A;  5FSI A;  1V8M A;  2A8S A;  2B06 A;  1RRQ A;  2QJT A;  1Q27 A;  2YVM A;  2G74 A;  1MQE A;  5BS6 A;  3U53 A;  4S2W A;  1G0S A;  1VC9 A;  4N1U A;  1NFS A;  2A8R A;  5C7Q A;  1XSB A;  2YVO A;  3MCF A;  2QJO A;  3N77 A;  5DD4 A;  4ZG0 A;  5ISY A;  2FVV A;  1MP2 A;  1MR2 A;  2I8U A;  3N9U A;  3O52 A;  5GHO A;  2RRK A;  3DUP A;  2CL3 A;  1X83 A;  3BAP A;  3ID9 A;  1VRL A;  1QVJ A;  2GT2 A;  1VCD A;  3CNG A;  1XSC A;  4IJX A;  4JZT A;  1PPW A;  1PUN A;  5I8U A;  3WHW A;  5GHI A;  3H95 A;  4J7G A;  5C7T A;  2GB5 A;  3I9X A;  5GHN A;  5ANS A;  2DSB A;  3R03 A;  2ICK A;  1V8L A;  3O6Z A;  3X0L A;  1X51 A;  4DYW A;  1NQY A;  2O5F A;  1MQW A;  3Q93 A;  3QSJ A;  1V8R A;  3X0Q A;  3X0K A;  5DPK A;  5DEQ A;  3Q2S A;  3EES A;  3F6A A;  1KTG A;  3GWY A;  1SOI A;  1U20 A;  2AZW A;  1I9A A;  5FSL A;  3X0J A;  4K6E A;  1XSA A;  1JRK A;  4HVY A;  1NFZ A;  2A8Q A;  2O1C A;  2YYH A;  5DDG A;  5FSN A;  3COU A;  2DUK A;  1VK6 A;  2Q9P A;  3Q2T A;  3GZ5 A;  2W4E A;  3ACA A;  4KYX A;  1V8S A;  3EEU A;  1RYA A;  4C9W A;  5GHM A;  3J7Y e;  3G0Q A;  4YPR A;  4JZV A;  4NFX A;  2KDV A;  3Q91 A;  3RH7 A;  3X0S A;  1SU2 A;  4C9X A;  1RRS A;  5LPG A;  3A6S A;  5ANW A;  1VHG A;  1PVF A;  1F3Y A;  4V14 A;  3Q4I A;  1V8N A;  1V8T A;  5ANV A;  5BON A;  1PUS A;  1PUQ A;  5HZX A;  3FFU A;  1V8V A;  3E57 A;  1K26 A;  3GG6 A;  5C8L A;  5CFI A;  4KG3 A;  1SZ3 A;  2GT4 A;  3EXQ A;  2J8Q A;  2A8P A;  4S2X A;  2I6K A;  3O8S A;  1KT9 A;  5GHP A;  3SON A;  3L85 A;  2A8T A;  2FKB A;  3MGM A;  3MDI A;  2YVP A;  2DSD A;  3AC9 A;  3EF5 A;  1V8W A;  5GHJ A;  3ZR0 A;  3X0R A;  3X0N A;  2R5W A;  4KTB A;  3SHD A;  4J7H A;  3FK9 A;  3OGA A;  5CFJ A;  4ICK A;  3MDG A;  1NQZ A;  2QKM B;  4N1T A;  2A6T A;  1GA7 A;  2XSQ A;  1Q54 A;  1TUM A;  1V8Y A;  3X0O A;  3ZR1 A;  1G9Q A;  1SJY A;  2VNQ A;  1PPV A;  3GZ6 A;  3X0P A;  4NFW A;  3HYQ A;  4JZU A;  3F13 A;  1MUT A;  1PPX A;  5GHQ A;  2VNP A;  3I7U A;  3A6T A;  1VIQ A;  3P6Y A;  2JVB A;  3A6U A;  3DKU A;  4HFQ A;  2G73 A;  1R67 A;  1VC8 A;  1VHZ A;  4ILQ A;  3SMD A;  1V8I A;  3FJY A;  4YOQ A;  5FSO A;  1HX3 A;  5IW4 A;  2O5W A;  3O69 A;  5ANT A;  3FSP A;  1KHZ A;  3BM4 A;  3KVH A;  4MPO A;  1OW2 A;  2B0V A;  4S2Y A;  1X84 A;  2I8T A;  1HZT A;  3X0M A;  1MK1 A;  2ICJ A;  3HHJ A;  3O61 A;  3X0I A;  1IRY A;  4S2V A;  1K2E A;  3I7V A;  3A6V A;  2PQV A;  2KDW A;  3GRN A;  1Q33 A;  3Q1P A;  5FSK A;  2DHO A;  2FML A;  4JZS A;  4KG4 A;  3FCM A;  2PNY A;  2YVN A;  5FSM A;  2DSC A;  1V8U A;  2B2K A;  3GZ8 A;  1JKN A;  5ANU A;  4YPH A;  3BHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...